data_9XE5 # _entry.id 9XE5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.417 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9XE5 pdb_00009xe5 10.2210/pdb9xe5/pdb WWPDB D_1300065095 ? ? BMRB 36804 ? 10.13018/BMR36804 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-10-28 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9XE5 _pdbx_database_status.recvd_initial_deposition_date 2025-10-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Defensin-like inhibitor of mammalian amylases, magnificamide-2, from the sea anemone Heteractis magnifica' _pdbx_database_related.db_id 36804 _pdbx_database_related.content_type unspecified # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 a.s.paramonov@gmail.com Alexander Paramonov ? 'principal investigator/group leader' 0000-0003-3614-560X 3 daria.vladipo@yandex.ru Daria Popkova ? 'principal investigator/group leader' 0000-0002-7463-5653 4 zakhar-shenkarev@yandex.ru Zakhar Shenkarev ? 'principal investigator/group leader' 0000-0003-1383-3522 5 leychenko@gmail.com Elena Leychenko ? 'principal investigator/group leader' 0000-0002-2360-1365 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Menshov, A.' 1 0000-0002-8790-9289 'Paramonov, A.' 2 0000-0003-3614-560X 'Popkova, D.' 3 0000-0002-7463-5653 'Shenkarev, Z.' 4 0000-0003-1383-3522 'Leychenko, E.' 5 0000-0002-2360-1365 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Int.J.Biol.Macromol. _citation.journal_id_ASTM IJBMDR _citation.journal_id_CSD 0708 _citation.journal_id_ISSN 0141-8130 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 376 _citation.language ? _citation.page_first 153418 _citation.page_last 153418 _citation.title 'Novel beta-defensin-like marine miniprotein magnificamide-2 with a remarkable potency in inhibiting mammalian alpha-amylases.' _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.ijbiomac.2026.153418 _citation.pdbx_database_id_PubMed 42419540 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Popkova, D.' 1 ? primary 'Menshov, A.' 2 ? primary 'Sintsova, O.' 3 ? primary 'Paramonov, A.' 4 ? primary 'Kalina, R.' 5 ? primary 'Panina, I.' 6 ? primary 'Kalinovskii, A.' 7 ? primary 'Osmakov, D.' 8 ? primary 'Shamatova, M.' 9 ? primary 'Dmitrenok, P.' 10 ? primary 'Chugunov, A.' 11 ? primary 'Kozlov, S.' 12 ? primary 'Efremov, R.' 13 ? primary 'Shenkarev, Z.' 14 ? primary 'Gladkikh, I.' 15 ? primary 'Leychenko, E.' 16 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Alpha-amylase inhibitor magnificamide' _entity.formula_weight 4790.499 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SEGNSCYIYHGVYGICKAKCAEDEKAMAGMGVCEGDLCCYKTPW _entity_poly.pdbx_seq_one_letter_code_can SEGNSCYIYHGVYGICKAKCAEDEKAMAGMGVCEGDLCCYKTPW _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLU n 1 3 GLY n 1 4 ASN n 1 5 SER n 1 6 CYS n 1 7 TYR n 1 8 ILE n 1 9 TYR n 1 10 HIS n 1 11 GLY n 1 12 VAL n 1 13 TYR n 1 14 GLY n 1 15 ILE n 1 16 CYS n 1 17 LYS n 1 18 ALA n 1 19 LYS n 1 20 CYS n 1 21 ALA n 1 22 GLU n 1 23 ASP n 1 24 GLU n 1 25 LYS n 1 26 ALA n 1 27 MET n 1 28 ALA n 1 29 GLY n 1 30 MET n 1 31 GLY n 1 32 VAL n 1 33 CYS n 1 34 GLU n 1 35 GLY n 1 36 ASP n 1 37 LEU n 1 38 CYS n 1 39 CYS n 1 40 TYR n 1 41 LYS n 1 42 THR n 1 43 PRO n 1 44 TRP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 44 _entity_src_gen.gene_src_common_name 'magnificent sea anemone' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Heteractis magnifica' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 38281 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 MET 27 27 27 MET MET A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 TRP 44 44 44 TRP TRP A . n # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9XE5 _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.000 _cell.length_a_esd ? _cell.length_b 1.000 _cell.length_b_esd ? _cell.length_c 1.000 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9XE5 _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9XE5 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _database_PDB_matrix.entry_id 9XE5 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 9XE5 _struct.title 'Defensin-like inhibitor of mammalian amylases, magnificamide-2, from the sea anemone Heteractis magnifica' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9XE5 _struct_keywords.text 'Hydrolase inhibitor, beta-defensin, mammalian alpha-amylase inhibitor, TOXIN' _struct_keywords.pdbx_keywords TOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code IAA1_HETMG _struct_ref.pdbx_db_accession C0HK71 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SEGTSCYIYHGVYGICKAKCAEDMKAMAGMGVCEGDLCCYKTPW _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9XE5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 44 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession C0HK71 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 44 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 44 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9XE5 ASN A 4 ? UNP C0HK71 THR 4 conflict 4 1 1 9XE5 GLU A 24 ? UNP C0HK71 MET 24 conflict 24 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 6 A CYS 38 1_555 ? ? ? ? ? ? ? 1.904 ? ? disulf2 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 33 SG ? ? A CYS 16 A CYS 33 1_555 ? ? ? ? ? ? ? 1.980 ? ? disulf3 disulf ? ? A CYS 20 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 20 A CYS 39 1_555 ? ? ? ? ? ? ? 1.977 ? ? disulf4 disulf ? ? A CYS 33 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 33 A CYS 38 1_555 ? ? ? ? ? ? ? 4.657 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 6 ? CYS A 38 ? CYS A 6 ? 1_555 CYS A 38 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 16 ? CYS A 33 ? CYS A 16 ? 1_555 CYS A 33 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 20 ? CYS A 39 ? CYS A 20 ? 1_555 CYS A 39 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 33 ? CYS A 38 ? CYS A 33 ? 1_555 CYS A 38 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 5 ? TYR A 7 ? SER A 5 TYR A 7 AA1 2 TYR A 13 ? LYS A 17 ? TYR A 13 LYS A 17 AA1 3 LEU A 37 ? TYR A 40 ? LEU A 37 TYR A 40 AA1 4 LYS A 25 ? MET A 27 ? LYS A 25 MET A 27 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N CYS A 6 ? N CYS A 6 O GLY A 14 ? O GLY A 14 AA1 2 3 N LYS A 17 ? N LYS A 17 O LEU A 37 ? O LEU A 37 AA1 3 4 O TYR A 40 ? O TYR A 40 N LYS A 25 ? N LYS A 25 # _pdbx_entry_details.entry_id 9XE5 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 8 ? ? -101.08 -66.53 2 1 ALA A 21 ? ? -100.23 -169.64 3 1 MET A 30 ? ? -131.89 -45.89 4 2 ILE A 8 ? ? -103.03 -65.31 5 2 ALA A 21 ? ? -100.10 -169.52 6 3 ILE A 8 ? ? -101.32 -66.53 7 3 MET A 30 ? ? -141.94 -41.88 8 4 TYR A 9 ? ? -174.61 149.25 9 5 ILE A 8 ? ? -100.20 -69.77 10 5 MET A 30 ? ? -135.93 -41.12 11 6 ILE A 8 ? ? -97.04 -61.44 12 6 MET A 30 ? ? -135.65 -41.25 13 7 ILE A 8 ? ? -105.30 -69.22 14 7 CYS A 33 ? ? -94.17 37.24 15 8 ILE A 8 ? ? -94.04 -63.60 16 8 ALA A 21 ? ? -100.19 -169.88 17 9 ILE A 8 ? ? -105.71 -68.88 18 9 ALA A 21 ? ? -100.20 -169.83 19 10 ILE A 8 ? ? -105.24 -68.11 20 10 ALA A 21 ? ? -100.19 -169.73 21 11 ILE A 8 ? ? -97.74 -62.96 22 12 CYS A 6 ? ? -111.53 -169.74 23 12 ILE A 8 ? ? -102.72 -68.84 24 13 ILE A 8 ? ? -103.79 -64.90 25 13 CYS A 33 ? ? -92.86 32.28 26 14 ILE A 8 ? ? -104.08 -68.21 27 14 ALA A 21 ? ? -100.13 -169.67 28 15 ILE A 8 ? ? -106.86 -62.64 29 15 GLU A 34 ? ? 56.47 84.33 30 16 ILE A 8 ? ? -101.03 -66.61 31 16 CYS A 33 ? ? -94.86 35.98 32 17 ILE A 8 ? ? -101.67 -60.79 33 17 CYS A 33 ? ? -94.06 32.74 34 18 ILE A 8 ? ? -104.16 -65.00 35 18 CYS A 33 ? ? -94.30 36.71 36 19 ILE A 8 ? ? -102.83 -66.24 37 19 ASP A 23 ? ? -95.45 34.67 38 19 MET A 30 ? ? -50.56 -70.63 39 20 ILE A 8 ? ? -108.07 -68.98 # _pdbx_nmr_ensemble.entry_id 9XE5 _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9XE5 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.46 mM [U-15N] Magnificamide-2, 1.5 mM sodium azide, 95% H2O/5% D2O' '95% H2O/5% D2O' 15N_sample solution ? 2 '1.0 mM Magnificamide-2, 100% D2O' '100% D2O' NA_sample solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 Magnificamide-2 0.46 ? mM '[U-15N]' 1 'sodium azide' 1.5 ? mM 'natural abundance' 2 Magnificamide-2 1.0 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 1.5 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 1 _pdbx_nmr_exptl_sample_conditions.pH_err 0.05 _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 3 1 1 '2D 1H-15N HSQC' 1 isotropic 4 1 1 '2D 1H-13C HSQC aliphatic' 1 isotropic 6 1 1 '3D 1H-15N TOCSY' 1 isotropic 5 1 1 '3D 1H-15N NOESY' 1 isotropic 8 1 1 '3D HNHA' 1 isotropic 7 1 1 '3D HNHB' 1 isotropic 10 1 2 '2D 1H-13C HSQC aliphatic' 1 isotropic 9 1 2 '2D 1H-1H NOESY' 1 isotropic 11 1 2 '2D 1H-1H TOCSY' 1 isotropic # _pdbx_nmr_refine.entry_id 9XE5 _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CYANA 3.98.13 'Guntert, Mumenthaler and Wuthrich' 2 'structure calculation' CYANA 3.98.13 'Guntert, Mumenthaler and Wuthrich' 3 collection TopSpin ? 'Bruker Biospin' 4 'chemical shift assignment' CARA 1.8 'Keller and Wuthrich' 5 'peak picking' CARA ? 'Keller and Wuthrich' 6 'data analysis' MddNMR ? 'Kazimierczuk and Orekhov' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLU N N N N 61 GLU CA C N S 62 GLU C C N N 63 GLU O O N N 64 GLU CB C N N 65 GLU CG C N N 66 GLU CD C N N 67 GLU OE1 O N N 68 GLU OE2 O N N 69 GLU OXT O N N 70 GLU H H N N 71 GLU H2 H N N 72 GLU HA H N N 73 GLU HB2 H N N 74 GLU HB3 H N N 75 GLU HG2 H N N 76 GLU HG3 H N N 77 GLU HE2 H N N 78 GLU HXT H N N 79 GLY N N N N 80 GLY CA C N N 81 GLY C C N N 82 GLY O O N N 83 GLY OXT O N N 84 GLY H H N N 85 GLY H2 H N N 86 GLY HA2 H N N 87 GLY HA3 H N N 88 GLY HXT H N N 89 HIS N N N N 90 HIS CA C N S 91 HIS C C N N 92 HIS O O N N 93 HIS CB C N N 94 HIS CG C Y N 95 HIS ND1 N Y N 96 HIS CD2 C Y N 97 HIS CE1 C Y N 98 HIS NE2 N Y N 99 HIS OXT O N N 100 HIS H H N N 101 HIS H2 H N N 102 HIS HA H N N 103 HIS HB2 H N N 104 HIS HB3 H N N 105 HIS HD1 H N N 106 HIS HD2 H N N 107 HIS HE1 H N N 108 HIS HE2 H N N 109 HIS HXT H N N 110 ILE N N N N 111 ILE CA C N S 112 ILE C C N N 113 ILE O O N N 114 ILE CB C N S 115 ILE CG1 C N N 116 ILE CG2 C N N 117 ILE CD1 C N N 118 ILE OXT O N N 119 ILE H H N N 120 ILE H2 H N N 121 ILE HA H N N 122 ILE HB H N N 123 ILE HG12 H N N 124 ILE HG13 H N N 125 ILE HG21 H N N 126 ILE HG22 H N N 127 ILE HG23 H N N 128 ILE HD11 H N N 129 ILE HD12 H N N 130 ILE HD13 H N N 131 ILE HXT H N N 132 LEU N N N N 133 LEU CA C N S 134 LEU C C N N 135 LEU O O N N 136 LEU CB C N N 137 LEU CG C N N 138 LEU CD1 C N N 139 LEU CD2 C N N 140 LEU OXT O N N 141 LEU H H N N 142 LEU H2 H N N 143 LEU HA H N N 144 LEU HB2 H N N 145 LEU HB3 H N N 146 LEU HG H N N 147 LEU HD11 H N N 148 LEU HD12 H N N 149 LEU HD13 H N N 150 LEU HD21 H N N 151 LEU HD22 H N N 152 LEU HD23 H N N 153 LEU HXT H N N 154 LYS N N N N 155 LYS CA C N S 156 LYS C C N N 157 LYS O O N N 158 LYS CB C N N 159 LYS CG C N N 160 LYS CD C N N 161 LYS CE C N N 162 LYS NZ N N N 163 LYS OXT O N N 164 LYS H H N N 165 LYS H2 H N N 166 LYS HA H N N 167 LYS HB2 H N N 168 LYS HB3 H N N 169 LYS HG2 H N N 170 LYS HG3 H N N 171 LYS HD2 H N N 172 LYS HD3 H N N 173 LYS HE2 H N N 174 LYS HE3 H N N 175 LYS HZ1 H N N 176 LYS HZ2 H N N 177 LYS HZ3 H N N 178 LYS HXT H N N 179 MET N N N N 180 MET CA C N S 181 MET C C N N 182 MET O O N N 183 MET CB C N N 184 MET CG C N N 185 MET SD S N N 186 MET CE C N N 187 MET OXT O N N 188 MET H H N N 189 MET H2 H N N 190 MET HA H N N 191 MET HB2 H N N 192 MET HB3 H N N 193 MET HG2 H N N 194 MET HG3 H N N 195 MET HE1 H N N 196 MET HE2 H N N 197 MET HE3 H N N 198 MET HXT H N N 199 PRO N N N N 200 PRO CA C N S 201 PRO C C N N 202 PRO O O N N 203 PRO CB C N N 204 PRO CG C N N 205 PRO CD C N N 206 PRO OXT O N N 207 PRO H H N N 208 PRO HA H N N 209 PRO HB2 H N N 210 PRO HB3 H N N 211 PRO HG2 H N N 212 PRO HG3 H N N 213 PRO HD2 H N N 214 PRO HD3 H N N 215 PRO HXT H N N 216 SER N N N N 217 SER CA C N S 218 SER C C N N 219 SER O O N N 220 SER CB C N N 221 SER OG O N N 222 SER OXT O N N 223 SER H H N N 224 SER H2 H N N 225 SER HA H N N 226 SER HB2 H N N 227 SER HB3 H N N 228 SER HG H N N 229 SER HXT H N N 230 THR N N N N 231 THR CA C N S 232 THR C C N N 233 THR O O N N 234 THR CB C N R 235 THR OG1 O N N 236 THR CG2 C N N 237 THR OXT O N N 238 THR H H N N 239 THR H2 H N N 240 THR HA H N N 241 THR HB H N N 242 THR HG1 H N N 243 THR HG21 H N N 244 THR HG22 H N N 245 THR HG23 H N N 246 THR HXT H N N 247 TRP N N N N 248 TRP CA C N S 249 TRP C C N N 250 TRP O O N N 251 TRP CB C N N 252 TRP CG C Y N 253 TRP CD1 C Y N 254 TRP CD2 C Y N 255 TRP NE1 N Y N 256 TRP CE2 C Y N 257 TRP CE3 C Y N 258 TRP CZ2 C Y N 259 TRP CZ3 C Y N 260 TRP CH2 C Y N 261 TRP OXT O N N 262 TRP H H N N 263 TRP H2 H N N 264 TRP HA H N N 265 TRP HB2 H N N 266 TRP HB3 H N N 267 TRP HD1 H N N 268 TRP HE1 H N N 269 TRP HE3 H N N 270 TRP HZ2 H N N 271 TRP HZ3 H N N 272 TRP HH2 H N N 273 TRP HXT H N N 274 TYR N N N N 275 TYR CA C N S 276 TYR C C N N 277 TYR O O N N 278 TYR CB C N N 279 TYR CG C Y N 280 TYR CD1 C Y N 281 TYR CD2 C Y N 282 TYR CE1 C Y N 283 TYR CE2 C Y N 284 TYR CZ C Y N 285 TYR OH O N N 286 TYR OXT O N N 287 TYR H H N N 288 TYR H2 H N N 289 TYR HA H N N 290 TYR HB2 H N N 291 TYR HB3 H N N 292 TYR HD1 H N N 293 TYR HD2 H N N 294 TYR HE1 H N N 295 TYR HE2 H N N 296 TYR HH H N N 297 TYR HXT H N N 298 VAL N N N N 299 VAL CA C N S 300 VAL C C N N 301 VAL O O N N 302 VAL CB C N N 303 VAL CG1 C N N 304 VAL CG2 C N N 305 VAL OXT O N N 306 VAL H H N N 307 VAL H2 H N N 308 VAL HA H N N 309 VAL HB H N N 310 VAL HG11 H N N 311 VAL HG12 H N N 312 VAL HG13 H N N 313 VAL HG21 H N N 314 VAL HG22 H N N 315 VAL HG23 H N N 316 VAL HXT H N N 317 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLU N CA sing N N 57 GLU N H sing N N 58 GLU N H2 sing N N 59 GLU CA C sing N N 60 GLU CA CB sing N N 61 GLU CA HA sing N N 62 GLU C O doub N N 63 GLU C OXT sing N N 64 GLU CB CG sing N N 65 GLU CB HB2 sing N N 66 GLU CB HB3 sing N N 67 GLU CG CD sing N N 68 GLU CG HG2 sing N N 69 GLU CG HG3 sing N N 70 GLU CD OE1 doub N N 71 GLU CD OE2 sing N N 72 GLU OE2 HE2 sing N N 73 GLU OXT HXT sing N N 74 GLY N CA sing N N 75 GLY N H sing N N 76 GLY N H2 sing N N 77 GLY CA C sing N N 78 GLY CA HA2 sing N N 79 GLY CA HA3 sing N N 80 GLY C O doub N N 81 GLY C OXT sing N N 82 GLY OXT HXT sing N N 83 HIS N CA sing N N 84 HIS N H sing N N 85 HIS N H2 sing N N 86 HIS CA C sing N N 87 HIS CA CB sing N N 88 HIS CA HA sing N N 89 HIS C O doub N N 90 HIS C OXT sing N N 91 HIS CB CG sing N N 92 HIS CB HB2 sing N N 93 HIS CB HB3 sing N N 94 HIS CG ND1 sing Y N 95 HIS CG CD2 doub Y N 96 HIS ND1 CE1 doub Y N 97 HIS ND1 HD1 sing N N 98 HIS CD2 NE2 sing Y N 99 HIS CD2 HD2 sing N N 100 HIS CE1 NE2 sing Y N 101 HIS CE1 HE1 sing N N 102 HIS NE2 HE2 sing N N 103 HIS OXT HXT sing N N 104 ILE N CA sing N N 105 ILE N H sing N N 106 ILE N H2 sing N N 107 ILE CA C sing N N 108 ILE CA CB sing N N 109 ILE CA HA sing N N 110 ILE C O doub N N 111 ILE C OXT sing N N 112 ILE CB CG1 sing N N 113 ILE CB CG2 sing N N 114 ILE CB HB sing N N 115 ILE CG1 CD1 sing N N 116 ILE CG1 HG12 sing N N 117 ILE CG1 HG13 sing N N 118 ILE CG2 HG21 sing N N 119 ILE CG2 HG22 sing N N 120 ILE CG2 HG23 sing N N 121 ILE CD1 HD11 sing N N 122 ILE CD1 HD12 sing N N 123 ILE CD1 HD13 sing N N 124 ILE OXT HXT sing N N 125 LEU N CA sing N N 126 LEU N H sing N N 127 LEU N H2 sing N N 128 LEU CA C sing N N 129 LEU CA CB sing N N 130 LEU CA HA sing N N 131 LEU C O doub N N 132 LEU C OXT sing N N 133 LEU CB CG sing N N 134 LEU CB HB2 sing N N 135 LEU CB HB3 sing N N 136 LEU CG CD1 sing N N 137 LEU CG CD2 sing N N 138 LEU CG HG sing N N 139 LEU CD1 HD11 sing N N 140 LEU CD1 HD12 sing N N 141 LEU CD1 HD13 sing N N 142 LEU CD2 HD21 sing N N 143 LEU CD2 HD22 sing N N 144 LEU CD2 HD23 sing N N 145 LEU OXT HXT sing N N 146 LYS N CA sing N N 147 LYS N H sing N N 148 LYS N H2 sing N N 149 LYS CA C sing N N 150 LYS CA CB sing N N 151 LYS CA HA sing N N 152 LYS C O doub N N 153 LYS C OXT sing N N 154 LYS CB CG sing N N 155 LYS CB HB2 sing N N 156 LYS CB HB3 sing N N 157 LYS CG CD sing N N 158 LYS CG HG2 sing N N 159 LYS CG HG3 sing N N 160 LYS CD CE sing N N 161 LYS CD HD2 sing N N 162 LYS CD HD3 sing N N 163 LYS CE NZ sing N N 164 LYS CE HE2 sing N N 165 LYS CE HE3 sing N N 166 LYS NZ HZ1 sing N N 167 LYS NZ HZ2 sing N N 168 LYS NZ HZ3 sing N N 169 LYS OXT HXT sing N N 170 MET N CA sing N N 171 MET N H sing N N 172 MET N H2 sing N N 173 MET CA C sing N N 174 MET CA CB sing N N 175 MET CA HA sing N N 176 MET C O doub N N 177 MET C OXT sing N N 178 MET CB CG sing N N 179 MET CB HB2 sing N N 180 MET CB HB3 sing N N 181 MET CG SD sing N N 182 MET CG HG2 sing N N 183 MET CG HG3 sing N N 184 MET SD CE sing N N 185 MET CE HE1 sing N N 186 MET CE HE2 sing N N 187 MET CE HE3 sing N N 188 MET OXT HXT sing N N 189 PRO N CA sing N N 190 PRO N CD sing N N 191 PRO N H sing N N 192 PRO CA C sing N N 193 PRO CA CB sing N N 194 PRO CA HA sing N N 195 PRO C O doub N N 196 PRO C OXT sing N N 197 PRO CB CG sing N N 198 PRO CB HB2 sing N N 199 PRO CB HB3 sing N N 200 PRO CG CD sing N N 201 PRO CG HG2 sing N N 202 PRO CG HG3 sing N N 203 PRO CD HD2 sing N N 204 PRO CD HD3 sing N N 205 PRO OXT HXT sing N N 206 SER N CA sing N N 207 SER N H sing N N 208 SER N H2 sing N N 209 SER CA C sing N N 210 SER CA CB sing N N 211 SER CA HA sing N N 212 SER C O doub N N 213 SER C OXT sing N N 214 SER CB OG sing N N 215 SER CB HB2 sing N N 216 SER CB HB3 sing N N 217 SER OG HG sing N N 218 SER OXT HXT sing N N 219 THR N CA sing N N 220 THR N H sing N N 221 THR N H2 sing N N 222 THR CA C sing N N 223 THR CA CB sing N N 224 THR CA HA sing N N 225 THR C O doub N N 226 THR C OXT sing N N 227 THR CB OG1 sing N N 228 THR CB CG2 sing N N 229 THR CB HB sing N N 230 THR OG1 HG1 sing N N 231 THR CG2 HG21 sing N N 232 THR CG2 HG22 sing N N 233 THR CG2 HG23 sing N N 234 THR OXT HXT sing N N 235 TRP N CA sing N N 236 TRP N H sing N N 237 TRP N H2 sing N N 238 TRP CA C sing N N 239 TRP CA CB sing N N 240 TRP CA HA sing N N 241 TRP C O doub N N 242 TRP C OXT sing N N 243 TRP CB CG sing N N 244 TRP CB HB2 sing N N 245 TRP CB HB3 sing N N 246 TRP CG CD1 doub Y N 247 TRP CG CD2 sing Y N 248 TRP CD1 NE1 sing Y N 249 TRP CD1 HD1 sing N N 250 TRP CD2 CE2 doub Y N 251 TRP CD2 CE3 sing Y N 252 TRP NE1 CE2 sing Y N 253 TRP NE1 HE1 sing N N 254 TRP CE2 CZ2 sing Y N 255 TRP CE3 CZ3 doub Y N 256 TRP CE3 HE3 sing N N 257 TRP CZ2 CH2 doub Y N 258 TRP CZ2 HZ2 sing N N 259 TRP CZ3 CH2 sing Y N 260 TRP CZ3 HZ3 sing N N 261 TRP CH2 HH2 sing N N 262 TRP OXT HXT sing N N 263 TYR N CA sing N N 264 TYR N H sing N N 265 TYR N H2 sing N N 266 TYR CA C sing N N 267 TYR CA CB sing N N 268 TYR CA HA sing N N 269 TYR C O doub N N 270 TYR C OXT sing N N 271 TYR CB CG sing N N 272 TYR CB HB2 sing N N 273 TYR CB HB3 sing N N 274 TYR CG CD1 doub Y N 275 TYR CG CD2 sing Y N 276 TYR CD1 CE1 sing Y N 277 TYR CD1 HD1 sing N N 278 TYR CD2 CE2 doub Y N 279 TYR CD2 HD2 sing N N 280 TYR CE1 CZ doub Y N 281 TYR CE1 HE1 sing N N 282 TYR CE2 CZ sing Y N 283 TYR CE2 HE2 sing N N 284 TYR CZ OH sing N N 285 TYR OH HH sing N N 286 TYR OXT HXT sing N N 287 VAL N CA sing N N 288 VAL N H sing N N 289 VAL N H2 sing N N 290 VAL CA C sing N N 291 VAL CA CB sing N N 292 VAL CA HA sing N N 293 VAL C O doub N N 294 VAL C OXT sing N N 295 VAL CB CG1 sing N N 296 VAL CB CG2 sing N N 297 VAL CB HB sing N N 298 VAL CG1 HG11 sing N N 299 VAL CG1 HG12 sing N N 300 VAL CG1 HG13 sing N N 301 VAL CG2 HG21 sing N N 302 VAL CG2 HG22 sing N N 303 VAL CG2 HG23 sing N N 304 VAL OXT HXT sing N N 305 # _pdbx_audit_support.funding_organization 'Russian Science Foundation' _pdbx_audit_support.country 'Russian Federation' _pdbx_audit_support.grant_number 21-74-20147 _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 9XE5 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #