data_9XGR # _entry.id 9XGR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.417 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9XGR pdb_00009xgr 10.2210/pdb9xgr/pdb WWPDB D_1300065345 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-11-04 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9XGR _pdbx_database_status.recvd_initial_deposition_date 2025-10-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBC _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 3 _pdbx_contact_author.email yibei.xiao@cpu.edu.cn _pdbx_contact_author.name_first XIAO _pdbx_contact_author.name_last Yibei _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-4716-5526 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bian, W.J.' 1 0009-0004-3496-8105 'Li, M.' 2 0009-0001-9961-1260 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'crystal structure of STING-CTD complex with small molecule 09-B11' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # _citation_author.citation_id primary _citation_author.name 'Bian, W.J.' _citation_author.ordinal 1 _citation_author.identifier_ORCID 0009-0004-3496-8105 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Stimulator of interferon genes protein' 27141.633 1 ? ? ? ? 2 non-polymer syn '(2S,3S)-2-(3,4-DIHYDROXYPHENYL)-3,5,7-TRIHYDROXY-2,3-DIHYDRO-4H-CHROMEN-4-ONE' 304.252 1 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? 4 water nat water 18.015 24 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'hSTING,Endoplasmic reticulum interferon stimulator,ERIS,Mediator of IRF3 activation,hMITA,Transmembrane protein 173' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPN IRFLDKLPQQTGDRAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDI LADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDF S ; _entity_poly.pdbx_seq_one_letter_code_can ;MAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPN IRFLDKLPQQTGDRAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDI LADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDF S ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(2S,3S)-2-(3,4-DIHYDROXYPHENYL)-3,5,7-TRIHYDROXY-2,3-DIHYDRO-4H-CHROMEN-4-ONE' DH2 3 'CALCIUM ION' CA 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 PRO n 1 4 ALA n 1 5 GLU n 1 6 ILE n 1 7 SER n 1 8 ALA n 1 9 VAL n 1 10 CYS n 1 11 GLU n 1 12 LYS n 1 13 GLY n 1 14 ASN n 1 15 PHE n 1 16 ASN n 1 17 VAL n 1 18 ALA n 1 19 HIS n 1 20 GLY n 1 21 LEU n 1 22 ALA n 1 23 TRP n 1 24 SER n 1 25 TYR n 1 26 TYR n 1 27 ILE n 1 28 GLY n 1 29 TYR n 1 30 LEU n 1 31 ARG n 1 32 LEU n 1 33 ILE n 1 34 LEU n 1 35 PRO n 1 36 GLU n 1 37 LEU n 1 38 GLN n 1 39 ALA n 1 40 ARG n 1 41 ILE n 1 42 ARG n 1 43 THR n 1 44 TYR n 1 45 ASN n 1 46 GLN n 1 47 HIS n 1 48 TYR n 1 49 ASN n 1 50 ASN n 1 51 LEU n 1 52 LEU n 1 53 ARG n 1 54 GLY n 1 55 ALA n 1 56 VAL n 1 57 SER n 1 58 GLN n 1 59 ARG n 1 60 LEU n 1 61 TYR n 1 62 ILE n 1 63 LEU n 1 64 LEU n 1 65 PRO n 1 66 LEU n 1 67 ASP n 1 68 CYS n 1 69 GLY n 1 70 VAL n 1 71 PRO n 1 72 ASP n 1 73 ASN n 1 74 LEU n 1 75 SER n 1 76 MET n 1 77 ALA n 1 78 ASP n 1 79 PRO n 1 80 ASN n 1 81 ILE n 1 82 ARG n 1 83 PHE n 1 84 LEU n 1 85 ASP n 1 86 LYS n 1 87 LEU n 1 88 PRO n 1 89 GLN n 1 90 GLN n 1 91 THR n 1 92 GLY n 1 93 ASP n 1 94 ARG n 1 95 ALA n 1 96 GLY n 1 97 ILE n 1 98 LYS n 1 99 ASP n 1 100 ARG n 1 101 VAL n 1 102 TYR n 1 103 SER n 1 104 ASN n 1 105 SER n 1 106 ILE n 1 107 TYR n 1 108 GLU n 1 109 LEU n 1 110 LEU n 1 111 GLU n 1 112 ASN n 1 113 GLY n 1 114 GLN n 1 115 ARG n 1 116 ALA n 1 117 GLY n 1 118 THR n 1 119 CYS n 1 120 VAL n 1 121 LEU n 1 122 GLU n 1 123 TYR n 1 124 ALA n 1 125 THR n 1 126 PRO n 1 127 LEU n 1 128 GLN n 1 129 THR n 1 130 LEU n 1 131 PHE n 1 132 ALA n 1 133 MET n 1 134 SER n 1 135 GLN n 1 136 TYR n 1 137 SER n 1 138 GLN n 1 139 ALA n 1 140 GLY n 1 141 PHE n 1 142 SER n 1 143 ARG n 1 144 GLU n 1 145 ASP n 1 146 ARG n 1 147 LEU n 1 148 GLU n 1 149 GLN n 1 150 ALA n 1 151 LYS n 1 152 LEU n 1 153 PHE n 1 154 CYS n 1 155 ARG n 1 156 THR n 1 157 LEU n 1 158 GLU n 1 159 ASP n 1 160 ILE n 1 161 LEU n 1 162 ALA n 1 163 ASP n 1 164 ALA n 1 165 PRO n 1 166 GLU n 1 167 SER n 1 168 GLN n 1 169 ASN n 1 170 ASN n 1 171 CYS n 1 172 ARG n 1 173 LEU n 1 174 ILE n 1 175 ALA n 1 176 TYR n 1 177 GLN n 1 178 GLU n 1 179 PRO n 1 180 ALA n 1 181 ASP n 1 182 ASP n 1 183 SER n 1 184 SER n 1 185 PHE n 1 186 SER n 1 187 LEU n 1 188 SER n 1 189 GLN n 1 190 GLU n 1 191 VAL n 1 192 LEU n 1 193 ARG n 1 194 HIS n 1 195 LEU n 1 196 ARG n 1 197 GLN n 1 198 GLU n 1 199 GLU n 1 200 LYS n 1 201 GLU n 1 202 GLU n 1 203 VAL n 1 204 THR n 1 205 VAL n 1 206 GLY n 1 207 SER n 1 208 LEU n 1 209 LYS n 1 210 THR n 1 211 SER n 1 212 ALA n 1 213 VAL n 1 214 PRO n 1 215 SER n 1 216 THR n 1 217 SER n 1 218 THR n 1 219 MET n 1 220 SER n 1 221 GLN n 1 222 GLU n 1 223 PRO n 1 224 GLU n 1 225 LEU n 1 226 LEU n 1 227 ILE n 1 228 SER n 1 229 GLY n 1 230 MET n 1 231 GLU n 1 232 LYS n 1 233 PRO n 1 234 LEU n 1 235 PRO n 1 236 LEU n 1 237 ARG n 1 238 THR n 1 239 ASP n 1 240 PHE n 1 241 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 241 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'STING1, ERIS, MITA, STING, TMEM173' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DH2 non-polymer . '(2S,3S)-2-(3,4-DIHYDROXYPHENYL)-3,5,7-TRIHYDROXY-2,3-DIHYDRO-4H-CHROMEN-4-ONE' '(2S,3S)-TRANS-DIHYDROQUERCETIN' 'C15 H12 O7' 304.252 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 139 ? ? ? A . n A 1 2 ALA 2 140 ? ? ? A . n A 1 3 PRO 3 141 ? ? ? A . n A 1 4 ALA 4 142 ? ? ? A . n A 1 5 GLU 5 143 ? ? ? A . n A 1 6 ILE 6 144 ? ? ? A . n A 1 7 SER 7 145 ? ? ? A . n A 1 8 ALA 8 146 ? ? ? A . n A 1 9 VAL 9 147 ? ? ? A . n A 1 10 CYS 10 148 ? ? ? A . n A 1 11 GLU 11 149 ? ? ? A . n A 1 12 LYS 12 150 ? ? ? A . n A 1 13 GLY 13 151 ? ? ? A . n A 1 14 ASN 14 152 ? ? ? A . n A 1 15 PHE 15 153 153 PHE PHE A . n A 1 16 ASN 16 154 154 ASN ASN A . n A 1 17 VAL 17 155 155 VAL VAL A . n A 1 18 ALA 18 156 156 ALA ALA A . n A 1 19 HIS 19 157 157 HIS HIS A . n A 1 20 GLY 20 158 158 GLY GLY A . n A 1 21 LEU 21 159 159 LEU LEU A . n A 1 22 ALA 22 160 160 ALA ALA A . n A 1 23 TRP 23 161 161 TRP TRP A . n A 1 24 SER 24 162 162 SER SER A . n A 1 25 TYR 25 163 163 TYR TYR A . n A 1 26 TYR 26 164 164 TYR TYR A . n A 1 27 ILE 27 165 165 ILE ILE A . n A 1 28 GLY 28 166 166 GLY GLY A . n A 1 29 TYR 29 167 167 TYR TYR A . n A 1 30 LEU 30 168 168 LEU LEU A . n A 1 31 ARG 31 169 169 ARG ARG A . n A 1 32 LEU 32 170 170 LEU LEU A . n A 1 33 ILE 33 171 171 ILE ILE A . n A 1 34 LEU 34 172 172 LEU LEU A . n A 1 35 PRO 35 173 173 PRO PRO A . n A 1 36 GLU 36 174 174 GLU GLU A . n A 1 37 LEU 37 175 175 LEU LEU A . n A 1 38 GLN 38 176 176 GLN GLN A . n A 1 39 ALA 39 177 177 ALA ALA A . n A 1 40 ARG 40 178 178 ARG ARG A . n A 1 41 ILE 41 179 179 ILE ILE A . n A 1 42 ARG 42 180 180 ARG ARG A . n A 1 43 THR 43 181 181 THR THR A . n A 1 44 TYR 44 182 182 TYR TYR A . n A 1 45 ASN 45 183 183 ASN ASN A . n A 1 46 GLN 46 184 184 GLN GLN A . n A 1 47 HIS 47 185 185 HIS HIS A . n A 1 48 TYR 48 186 186 TYR TYR A . n A 1 49 ASN 49 187 187 ASN ASN A . n A 1 50 ASN 50 188 188 ASN ASN A . n A 1 51 LEU 51 189 189 LEU LEU A . n A 1 52 LEU 52 190 190 LEU LEU A . n A 1 53 ARG 53 191 191 ARG ARG A . n A 1 54 GLY 54 192 192 GLY GLY A . n A 1 55 ALA 55 193 193 ALA ALA A . n A 1 56 VAL 56 194 194 VAL VAL A . n A 1 57 SER 57 195 195 SER SER A . n A 1 58 GLN 58 196 196 GLN GLN A . n A 1 59 ARG 59 197 ? ? ? A . n A 1 60 LEU 60 198 198 LEU LEU A . n A 1 61 TYR 61 199 199 TYR TYR A . n A 1 62 ILE 62 200 200 ILE ILE A . n A 1 63 LEU 63 201 201 LEU LEU A . n A 1 64 LEU 64 202 202 LEU LEU A . n A 1 65 PRO 65 203 203 PRO PRO A . n A 1 66 LEU 66 204 204 LEU LEU A . n A 1 67 ASP 67 205 205 ASP ASP A . n A 1 68 CYS 68 206 206 CYS CYS A . n A 1 69 GLY 69 207 207 GLY GLY A . n A 1 70 VAL 70 208 208 VAL VAL A . n A 1 71 PRO 71 209 209 PRO PRO A . n A 1 72 ASP 72 210 210 ASP ASP A . n A 1 73 ASN 73 211 211 ASN ASN A . n A 1 74 LEU 74 212 212 LEU LEU A . n A 1 75 SER 75 213 213 SER SER A . n A 1 76 MET 76 214 214 MET MET A . n A 1 77 ALA 77 215 215 ALA ALA A . n A 1 78 ASP 78 216 216 ASP ASP A . n A 1 79 PRO 79 217 217 PRO PRO A . n A 1 80 ASN 80 218 218 ASN ASN A . n A 1 81 ILE 81 219 219 ILE ILE A . n A 1 82 ARG 82 220 220 ARG ARG A . n A 1 83 PHE 83 221 221 PHE PHE A . n A 1 84 LEU 84 222 222 LEU LEU A . n A 1 85 ASP 85 223 223 ASP ASP A . n A 1 86 LYS 86 224 224 LYS LYS A . n A 1 87 LEU 87 225 225 LEU LEU A . n A 1 88 PRO 88 226 226 PRO PRO A . n A 1 89 GLN 89 227 227 GLN GLN A . n A 1 90 GLN 90 228 228 GLN GLN A . n A 1 91 THR 91 229 229 THR THR A . n A 1 92 GLY 92 230 230 GLY GLY A . n A 1 93 ASP 93 231 ? ? ? A . n A 1 94 ARG 94 232 ? ? ? A . n A 1 95 ALA 95 233 ? ? ? A . n A 1 96 GLY 96 234 ? ? ? A . n A 1 97 ILE 97 235 ? ? ? A . n A 1 98 LYS 98 236 ? ? ? A . n A 1 99 ASP 99 237 ? ? ? A . n A 1 100 ARG 100 238 ? ? ? A . n A 1 101 VAL 101 239 239 VAL VAL A . n A 1 102 TYR 102 240 240 TYR TYR A . n A 1 103 SER 103 241 241 SER SER A . n A 1 104 ASN 104 242 242 ASN ASN A . n A 1 105 SER 105 243 243 SER SER A . n A 1 106 ILE 106 244 244 ILE ILE A . n A 1 107 TYR 107 245 245 TYR TYR A . n A 1 108 GLU 108 246 246 GLU GLU A . n A 1 109 LEU 109 247 247 LEU LEU A . n A 1 110 LEU 110 248 248 LEU LEU A . n A 1 111 GLU 111 249 249 GLU GLU A . n A 1 112 ASN 112 250 250 ASN ASN A . n A 1 113 GLY 113 251 251 GLY GLY A . n A 1 114 GLN 114 252 252 GLN GLN A . n A 1 115 ARG 115 253 253 ARG ARG A . n A 1 116 ALA 116 254 254 ALA ALA A . n A 1 117 GLY 117 255 255 GLY GLY A . n A 1 118 THR 118 256 256 THR THR A . n A 1 119 CYS 119 257 257 CYS CYS A . n A 1 120 VAL 120 258 258 VAL VAL A . n A 1 121 LEU 121 259 259 LEU LEU A . n A 1 122 GLU 122 260 260 GLU GLU A . n A 1 123 TYR 123 261 261 TYR TYR A . n A 1 124 ALA 124 262 262 ALA ALA A . n A 1 125 THR 125 263 263 THR THR A . n A 1 126 PRO 126 264 264 PRO PRO A . n A 1 127 LEU 127 265 265 LEU LEU A . n A 1 128 GLN 128 266 266 GLN GLN A . n A 1 129 THR 129 267 267 THR THR A . n A 1 130 LEU 130 268 268 LEU LEU A . n A 1 131 PHE 131 269 269 PHE PHE A . n A 1 132 ALA 132 270 270 ALA ALA A . n A 1 133 MET 133 271 271 MET MET A . n A 1 134 SER 134 272 272 SER SER A . n A 1 135 GLN 135 273 273 GLN GLN A . n A 1 136 TYR 136 274 274 TYR TYR A . n A 1 137 SER 137 275 275 SER SER A . n A 1 138 GLN 138 276 276 GLN GLN A . n A 1 139 ALA 139 277 277 ALA ALA A . n A 1 140 GLY 140 278 278 GLY GLY A . n A 1 141 PHE 141 279 279 PHE PHE A . n A 1 142 SER 142 280 280 SER SER A . n A 1 143 ARG 143 281 281 ARG ARG A . n A 1 144 GLU 144 282 282 GLU GLU A . n A 1 145 ASP 145 283 283 ASP ASP A . n A 1 146 ARG 146 284 284 ARG ARG A . n A 1 147 LEU 147 285 285 LEU LEU A . n A 1 148 GLU 148 286 286 GLU GLU A . n A 1 149 GLN 149 287 287 GLN GLN A . n A 1 150 ALA 150 288 288 ALA ALA A . n A 1 151 LYS 151 289 289 LYS LYS A . n A 1 152 LEU 152 290 290 LEU LEU A . n A 1 153 PHE 153 291 291 PHE PHE A . n A 1 154 CYS 154 292 292 CYS CYS A . n A 1 155 ARG 155 293 293 ARG ARG A . n A 1 156 THR 156 294 294 THR THR A . n A 1 157 LEU 157 295 295 LEU LEU A . n A 1 158 GLU 158 296 296 GLU GLU A . n A 1 159 ASP 159 297 297 ASP ASP A . n A 1 160 ILE 160 298 298 ILE ILE A . n A 1 161 LEU 161 299 299 LEU LEU A . n A 1 162 ALA 162 300 300 ALA ALA A . n A 1 163 ASP 163 301 301 ASP ASP A . n A 1 164 ALA 164 302 302 ALA ALA A . n A 1 165 PRO 165 303 303 PRO PRO A . n A 1 166 GLU 166 304 304 GLU GLU A . n A 1 167 SER 167 305 305 SER SER A . n A 1 168 GLN 168 306 306 GLN GLN A . n A 1 169 ASN 169 307 307 ASN ASN A . n A 1 170 ASN 170 308 308 ASN ASN A . n A 1 171 CYS 171 309 309 CYS CYS A . n A 1 172 ARG 172 310 310 ARG ARG A . n A 1 173 LEU 173 311 311 LEU LEU A . n A 1 174 ILE 174 312 312 ILE ILE A . n A 1 175 ALA 175 313 313 ALA ALA A . n A 1 176 TYR 176 314 314 TYR TYR A . n A 1 177 GLN 177 315 315 GLN GLN A . n A 1 178 GLU 178 316 316 GLU GLU A . n A 1 179 PRO 179 317 317 PRO PRO A . n A 1 180 ALA 180 318 318 ALA ALA A . n A 1 181 ASP 181 319 319 ASP ASP A . n A 1 182 ASP 182 320 320 ASP ASP A . n A 1 183 SER 183 321 321 SER SER A . n A 1 184 SER 184 322 322 SER SER A . n A 1 185 PHE 185 323 323 PHE PHE A . n A 1 186 SER 186 324 324 SER SER A . n A 1 187 LEU 187 325 325 LEU LEU A . n A 1 188 SER 188 326 326 SER SER A . n A 1 189 GLN 189 327 327 GLN GLN A . n A 1 190 GLU 190 328 328 GLU GLU A . n A 1 191 VAL 191 329 329 VAL VAL A . n A 1 192 LEU 192 330 330 LEU LEU A . n A 1 193 ARG 193 331 331 ARG ARG A . n A 1 194 HIS 194 332 332 HIS HIS A . n A 1 195 LEU 195 333 333 LEU LEU A . n A 1 196 ARG 196 334 334 ARG ARG A . n A 1 197 GLN 197 335 335 GLN GLN A . n A 1 198 GLU 198 336 336 GLU GLU A . n A 1 199 GLU 199 337 337 GLU GLU A . n A 1 200 LYS 200 338 338 LYS LYS A . n A 1 201 GLU 201 339 339 GLU GLU A . n A 1 202 GLU 202 340 340 GLU GLU A . n A 1 203 VAL 203 341 341 VAL VAL A . n A 1 204 THR 204 342 342 THR THR A . n A 1 205 VAL 205 343 343 VAL VAL A . n A 1 206 GLY 206 344 ? ? ? A . n A 1 207 SER 207 345 ? ? ? A . n A 1 208 LEU 208 346 ? ? ? A . n A 1 209 LYS 209 347 ? ? ? A . n A 1 210 THR 210 348 ? ? ? A . n A 1 211 SER 211 349 ? ? ? A . n A 1 212 ALA 212 350 ? ? ? A . n A 1 213 VAL 213 351 ? ? ? A . n A 1 214 PRO 214 352 ? ? ? A . n A 1 215 SER 215 353 ? ? ? A . n A 1 216 THR 216 354 ? ? ? A . n A 1 217 SER 217 355 ? ? ? A . n A 1 218 THR 218 356 ? ? ? A . n A 1 219 MET 219 357 ? ? ? A . n A 1 220 SER 220 358 ? ? ? A . n A 1 221 GLN 221 359 ? ? ? A . n A 1 222 GLU 222 360 ? ? ? A . n A 1 223 PRO 223 361 ? ? ? A . n A 1 224 GLU 224 362 ? ? ? A . n A 1 225 LEU 225 363 ? ? ? A . n A 1 226 LEU 226 364 ? ? ? A . n A 1 227 ILE 227 365 ? ? ? A . n A 1 228 SER 228 366 ? ? ? A . n A 1 229 GLY 229 367 ? ? ? A . n A 1 230 MET 230 368 ? ? ? A . n A 1 231 GLU 231 369 ? ? ? A . n A 1 232 LYS 232 370 ? ? ? A . n A 1 233 PRO 233 371 ? ? ? A . n A 1 234 LEU 234 372 ? ? ? A . n A 1 235 PRO 235 373 ? ? ? A . n A 1 236 LEU 236 374 ? ? ? A . n A 1 237 ARG 237 375 ? ? ? A . n A 1 238 THR 238 376 ? ? ? A . n A 1 239 ASP 239 377 ? ? ? A . n A 1 240 PHE 240 378 ? ? ? A . n A 1 241 SER 241 379 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id DH2 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id DH2 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 DH2 1 401 1 DH2 LIG A . C 3 CA 1 402 1 CA CA A . D 3 CA 1 403 2 CA CA A . E 4 HOH 1 501 17 HOH HOH A . E 4 HOH 2 502 25 HOH HOH A . E 4 HOH 3 503 23 HOH HOH A . E 4 HOH 4 504 12 HOH HOH A . E 4 HOH 5 505 13 HOH HOH A . E 4 HOH 6 506 9 HOH HOH A . E 4 HOH 7 507 8 HOH HOH A . E 4 HOH 8 508 18 HOH HOH A . E 4 HOH 9 509 21 HOH HOH A . E 4 HOH 10 510 20 HOH HOH A . E 4 HOH 11 511 3 HOH HOH A . E 4 HOH 12 512 1 HOH HOH A . E 4 HOH 13 513 7 HOH HOH A . E 4 HOH 14 514 26 HOH HOH A . E 4 HOH 15 515 2 HOH HOH A . E 4 HOH 16 516 6 HOH HOH A . E 4 HOH 17 517 22 HOH HOH A . E 4 HOH 18 518 4 HOH HOH A . E 4 HOH 19 519 16 HOH HOH A . E 4 HOH 20 520 15 HOH HOH A . E 4 HOH 21 521 5 HOH HOH A . E 4 HOH 22 522 11 HOH HOH A . E 4 HOH 23 523 14 HOH HOH A . E 4 HOH 24 524 24 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 174 ? CG ? A GLU 36 CG 2 1 Y 1 A GLU 174 ? CD ? A GLU 36 CD 3 1 Y 1 A GLU 174 ? OE1 ? A GLU 36 OE1 4 1 Y 1 A GLU 174 ? OE2 ? A GLU 36 OE2 5 1 Y 1 A ARG 180 ? CG ? A ARG 42 CG 6 1 Y 1 A ARG 180 ? CD ? A ARG 42 CD 7 1 Y 1 A ARG 180 ? NE ? A ARG 42 NE 8 1 Y 1 A ARG 180 ? CZ ? A ARG 42 CZ 9 1 Y 1 A ARG 180 ? NH1 ? A ARG 42 NH1 10 1 Y 1 A ARG 180 ? NH2 ? A ARG 42 NH2 11 1 Y 1 A LEU 190 ? CG ? A LEU 52 CG 12 1 Y 1 A LEU 190 ? CD1 ? A LEU 52 CD1 13 1 Y 1 A LEU 190 ? CD2 ? A LEU 52 CD2 14 1 Y 1 A MET 214 ? CG ? A MET 76 CG 15 1 Y 1 A MET 214 ? SD ? A MET 76 SD 16 1 Y 1 A MET 214 ? CE ? A MET 76 CE 17 1 Y 1 A ASP 319 ? CG ? A ASP 181 CG 18 1 Y 1 A ASP 319 ? OD1 ? A ASP 181 OD1 19 1 Y 1 A ASP 319 ? OD2 ? A ASP 181 OD2 20 1 Y 1 A ASP 320 ? CG ? A ASP 182 CG 21 1 Y 1 A ASP 320 ? OD1 ? A ASP 182 OD1 22 1 Y 1 A ASP 320 ? OD2 ? A ASP 182 OD2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.20.1_4487: ???)' ? 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . ? 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . ? 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? . ? 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9XGR _cell.details ? _cell.formula_units_Z ? _cell.length_a 81.750 _cell.length_a_esd ? _cell.length_b 92.100 _cell.length_b_esd ? _cell.length_c 73.140 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9XGR _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9XGR _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.54 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.50 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;14.4%PEG8000 80mM Sodium cacodylate/Hydrochloric acid ph6.5 160mM Calcium acetate 20%Glycerol ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 289.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 289.15 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2025-10-07 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97853 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL18U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97853 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL18U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9XGR _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.27 _reflns.d_resolution_low 28.74 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13092 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 24.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.95 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.061 _reflns.pdbx_Rpim_I_all 0.017 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 169536 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.058 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.27 _reflns_shell.d_res_low 2.33 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all 12383 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 942 _reflns_shell.percent_possible_obs 100.0 _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 13.1 _reflns_shell.pdbx_chi_squared 0.90 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 1.6 _reflns_shell.pdbx_Rrim_I_all 2.002 _reflns_shell.pdbx_Rpim_I_all 0.548 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.750 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.924 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9XGR _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.27 _refine.ls_d_res_low 26.13 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13060 _refine.ls_number_reflns_R_free 1303 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.90 _refine.ls_percent_reflns_R_free 9.98 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2300 _refine.ls_R_factor_R_free 0.2650 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2261 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 34.73 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.36 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.27 _refine_hist.d_res_low 26.13 _refine_hist.number_atoms_solvent 24 _refine_hist.number_atoms_total 1492 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1444 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 24 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.005 ? 1495 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.802 ? 2033 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 6.197 ? 207 ? f_dihedral_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.043 ? 223 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.008 ? 266 ? f_plane_restr ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.27 2.36 . . 142 1277 100.00 . . . . 0.3532 . . . . . . . . . . . . . . . 0.4088 'X-RAY DIFFRACTION' 2.36 2.47 . . 141 1294 100.00 . . . . 0.2978 . . . . . . . . . . . . . . . 0.3284 'X-RAY DIFFRACTION' 2.47 2.60 . . 141 1265 100.00 . . . . 0.2919 . . . . . . . . . . . . . . . 0.4171 'X-RAY DIFFRACTION' 2.60 2.76 . . 143 1293 100.00 . . . . 0.2847 . . . . . . . . . . . . . . . 0.3305 'X-RAY DIFFRACTION' 2.76 2.97 . . 145 1308 100.00 . . . . 0.2752 . . . . . . . . . . . . . . . 0.3748 'X-RAY DIFFRACTION' 2.97 3.27 . . 144 1298 100.00 . . . . 0.2680 . . . . . . . . . . . . . . . 0.2851 'X-RAY DIFFRACTION' 3.27 3.74 . . 146 1309 100.00 . . . . 0.2323 . . . . . . . . . . . . . . . 0.2828 'X-RAY DIFFRACTION' 3.75 4.71 . . 148 1326 100.00 . . . . 0.1887 . . . . . . . . . . . . . . . 0.2303 'X-RAY DIFFRACTION' 4.71 26.13 . . 153 1387 100.00 . . . . 0.1989 . . . . . . . . . . . . . . . 0.2141 # _struct.entry_id 9XGR _struct.title 'crystal structure of STING-CTD complex with small molecule 09-B11' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9XGR _struct_keywords.text 'Inhibitor, Complex, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code STING_HUMAN _struct_ref.pdbx_db_accession Q86WV6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;APAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNI RFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDIL ADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS ; _struct_ref.pdbx_align_begin 140 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9XGR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 241 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q86WV6 _struct_ref_seq.db_align_beg 140 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 379 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 140 _struct_ref_seq.pdbx_auth_seq_align_end 379 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9XGR MET A 1 ? UNP Q86WV6 ? ? 'initiating methionine' 139 1 1 9XGR ARG A 94 ? UNP Q86WV6 HIS 232 variant 232 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0 0.0 0.0 0.0 0.0 1.0 0.0 0.0 0.0 0.0 1.0 0.0 2 'point symmetry operation' 3_555 -x,y,-z+1/2 -1.0 0.0 0.0 0.0 0.0 1.0 0.0 0.0 0.0 0.0 -1.0 36.57 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 16 ? TYR A 29 ? ASN A 154 TYR A 167 1 ? 14 HELX_P HELX_P2 AA2 TYR A 29 ? ARG A 53 ? TYR A 167 ARG A 191 1 ? 25 HELX_P HELX_P3 AA3 ASN A 73 ? ASP A 78 ? ASN A 211 ASP A 216 1 ? 6 HELX_P HELX_P4 AA4 THR A 125 ? GLN A 135 ? THR A 263 GLN A 273 1 ? 11 HELX_P HELX_P5 AA5 TYR A 136 ? GLY A 140 ? TYR A 274 GLY A 278 5 ? 5 HELX_P HELX_P6 AA6 SER A 142 ? ASP A 163 ? SER A 280 ASP A 301 1 ? 22 HELX_P HELX_P7 AA7 GLU A 166 ? CYS A 171 ? GLU A 304 CYS A 309 1 ? 6 HELX_P HELX_P8 AA8 SER A 186 ? VAL A 205 ? SER A 324 VAL A 343 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A TYR 136 O ? ? ? 1_555 D CA . CA ? ? A TYR 274 A CA 403 1_555 ? ? ? ? ? ? ? 2.738 ? ? metalc2 metalc ? ? A PHE 141 O ? ? ? 1_555 D CA . CA ? ? A PHE 279 A CA 403 1_555 ? ? ? ? ? ? ? 3.082 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_struct_conn_angle.id 1 _pdbx_struct_conn_angle.ptnr1_label_atom_id O _pdbx_struct_conn_angle.ptnr1_label_alt_id ? _pdbx_struct_conn_angle.ptnr1_label_asym_id A _pdbx_struct_conn_angle.ptnr1_label_comp_id TYR _pdbx_struct_conn_angle.ptnr1_label_seq_id 136 _pdbx_struct_conn_angle.ptnr1_auth_atom_id ? _pdbx_struct_conn_angle.ptnr1_auth_asym_id A _pdbx_struct_conn_angle.ptnr1_auth_comp_id TYR _pdbx_struct_conn_angle.ptnr1_auth_seq_id 274 _pdbx_struct_conn_angle.ptnr1_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr1_symmetry 1_555 _pdbx_struct_conn_angle.ptnr2_label_atom_id CA _pdbx_struct_conn_angle.ptnr2_label_alt_id ? _pdbx_struct_conn_angle.ptnr2_label_asym_id D _pdbx_struct_conn_angle.ptnr2_label_comp_id CA _pdbx_struct_conn_angle.ptnr2_label_seq_id . _pdbx_struct_conn_angle.ptnr2_auth_atom_id ? _pdbx_struct_conn_angle.ptnr2_auth_asym_id A _pdbx_struct_conn_angle.ptnr2_auth_comp_id CA _pdbx_struct_conn_angle.ptnr2_auth_seq_id 403 _pdbx_struct_conn_angle.ptnr2_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr2_symmetry 1_555 _pdbx_struct_conn_angle.ptnr3_label_atom_id O _pdbx_struct_conn_angle.ptnr3_label_alt_id ? _pdbx_struct_conn_angle.ptnr3_label_asym_id A _pdbx_struct_conn_angle.ptnr3_label_comp_id PHE _pdbx_struct_conn_angle.ptnr3_label_seq_id 141 _pdbx_struct_conn_angle.ptnr3_auth_atom_id ? _pdbx_struct_conn_angle.ptnr3_auth_asym_id A _pdbx_struct_conn_angle.ptnr3_auth_comp_id PHE _pdbx_struct_conn_angle.ptnr3_auth_seq_id 279 _pdbx_struct_conn_angle.ptnr3_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr3_symmetry 1_555 _pdbx_struct_conn_angle.value 140.7 _pdbx_struct_conn_angle.value_esd ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 81 ? LYS A 86 ? ILE A 219 LYS A 224 AA1 2 SER A 105 ? GLU A 111 ? SER A 243 GLU A 249 AA1 3 GLN A 114 ? TYR A 123 ? GLN A 252 TYR A 261 AA1 4 TYR A 61 ? PRO A 65 ? TYR A 199 PRO A 203 AA1 5 ARG A 172 ? TYR A 176 ? ARG A 310 TYR A 314 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASP A 85 ? N ASP A 223 O ILE A 106 ? O ILE A 244 AA1 2 3 N LEU A 109 ? N LEU A 247 O ALA A 116 ? O ALA A 254 AA1 3 4 O GLU A 122 ? O GLU A 260 N LEU A 63 ? N LEU A 201 AA1 4 5 N ILE A 62 ? N ILE A 200 O ARG A 172 ? O ARG A 310 # _pdbx_entry_details.entry_id 9XGR _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 NH1 A ARG 178 ? ? O A HOH 501 ? ? 2.12 2 1 OH A TYR 199 ? ? OE1 A GLU 336 ? ? 2.17 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OG _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 SER _pdbx_validate_symm_contact.auth_seq_id_1 162 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O30 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 DH2 _pdbx_validate_symm_contact.auth_seq_id_2 401 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 3_555 _pdbx_validate_symm_contact.dist 1.96 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 167 ? ? -125.45 -58.01 2 1 ALA A 193 ? ? -170.45 137.95 3 1 GLU A 304 ? ? 64.41 -0.62 4 1 ASP A 320 ? ? -65.01 3.21 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A CA 402 ? C CA . 2 1 A HOH 519 ? E HOH . # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 523 ? 6.32 . 2 1 O ? A HOH 524 ? 6.37 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 139 ? A MET 1 2 1 Y 1 A ALA 140 ? A ALA 2 3 1 Y 1 A PRO 141 ? A PRO 3 4 1 Y 1 A ALA 142 ? A ALA 4 5 1 Y 1 A GLU 143 ? A GLU 5 6 1 Y 1 A ILE 144 ? A ILE 6 7 1 Y 1 A SER 145 ? A SER 7 8 1 Y 1 A ALA 146 ? A ALA 8 9 1 Y 1 A VAL 147 ? A VAL 9 10 1 Y 1 A CYS 148 ? A CYS 10 11 1 Y 1 A GLU 149 ? A GLU 11 12 1 Y 1 A LYS 150 ? A LYS 12 13 1 Y 1 A GLY 151 ? A GLY 13 14 1 Y 1 A ASN 152 ? A ASN 14 15 1 Y 1 A ARG 197 ? A ARG 59 16 1 Y 1 A ASP 231 ? A ASP 93 17 1 Y 1 A ARG 232 ? A ARG 94 18 1 Y 1 A ALA 233 ? A ALA 95 19 1 Y 1 A GLY 234 ? A GLY 96 20 1 Y 1 A ILE 235 ? A ILE 97 21 1 Y 1 A LYS 236 ? A LYS 98 22 1 Y 1 A ASP 237 ? A ASP 99 23 1 Y 1 A ARG 238 ? A ARG 100 24 1 Y 1 A GLY 344 ? A GLY 206 25 1 Y 1 A SER 345 ? A SER 207 26 1 Y 1 A LEU 346 ? A LEU 208 27 1 Y 1 A LYS 347 ? A LYS 209 28 1 Y 1 A THR 348 ? A THR 210 29 1 Y 1 A SER 349 ? A SER 211 30 1 Y 1 A ALA 350 ? A ALA 212 31 1 Y 1 A VAL 351 ? A VAL 213 32 1 Y 1 A PRO 352 ? A PRO 214 33 1 Y 1 A SER 353 ? A SER 215 34 1 Y 1 A THR 354 ? A THR 216 35 1 Y 1 A SER 355 ? A SER 217 36 1 Y 1 A THR 356 ? A THR 218 37 1 Y 1 A MET 357 ? A MET 219 38 1 Y 1 A SER 358 ? A SER 220 39 1 Y 1 A GLN 359 ? A GLN 221 40 1 Y 1 A GLU 360 ? A GLU 222 41 1 Y 1 A PRO 361 ? A PRO 223 42 1 Y 1 A GLU 362 ? A GLU 224 43 1 Y 1 A LEU 363 ? A LEU 225 44 1 Y 1 A LEU 364 ? A LEU 226 45 1 Y 1 A ILE 365 ? A ILE 227 46 1 Y 1 A SER 366 ? A SER 228 47 1 Y 1 A GLY 367 ? A GLY 229 48 1 Y 1 A MET 368 ? A MET 230 49 1 Y 1 A GLU 369 ? A GLU 231 50 1 Y 1 A LYS 370 ? A LYS 232 51 1 Y 1 A PRO 371 ? A PRO 233 52 1 Y 1 A LEU 372 ? A LEU 234 53 1 Y 1 A PRO 373 ? A PRO 235 54 1 Y 1 A LEU 374 ? A LEU 236 55 1 Y 1 A ARG 375 ? A ARG 237 56 1 Y 1 A THR 376 ? A THR 238 57 1 Y 1 A ASP 377 ? A ASP 239 58 1 Y 1 A PHE 378 ? A PHE 240 59 1 Y 1 A SER 379 ? A SER 241 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 DH2 C1 C Y N 89 DH2 C2 C Y N 90 DH2 C3 C Y N 91 DH2 C4 C Y N 92 DH2 C5 C Y N 93 DH2 C6 C Y N 94 DH2 C9 C N N 95 DH2 C10 C N S 96 DH2 C11 C N S 97 DH2 C14 C Y N 98 DH2 C15 C Y N 99 DH2 C16 C Y N 100 DH2 C17 C Y N 101 DH2 C18 C Y N 102 DH2 C19 C Y N 103 DH2 O12 O N N 104 DH2 O13 O N N 105 DH2 O23 O N N 106 DH2 O24 O N N 107 DH2 O27 O N N 108 DH2 O29 O N N 109 DH2 O30 O N N 110 DH2 H1 H N N 111 DH2 HB H N N 112 DH2 HD H N N 113 DH2 H11 H N N 114 DH2 H15 H N N 115 DH2 H16 H N N 116 DH2 H19 H N N 117 DH2 H23 H N N 118 DH2 H24 H N N 119 DH2 H27 H N N 120 DH2 HC H N N 121 DH2 HA H N N 122 GLN N N N N 123 GLN CA C N S 124 GLN C C N N 125 GLN O O N N 126 GLN CB C N N 127 GLN CG C N N 128 GLN CD C N N 129 GLN OE1 O N N 130 GLN NE2 N N N 131 GLN OXT O N N 132 GLN H H N N 133 GLN H2 H N N 134 GLN HA H N N 135 GLN HB2 H N N 136 GLN HB3 H N N 137 GLN HG2 H N N 138 GLN HG3 H N N 139 GLN HE21 H N N 140 GLN HE22 H N N 141 GLN HXT H N N 142 GLU N N N N 143 GLU CA C N S 144 GLU C C N N 145 GLU O O N N 146 GLU CB C N N 147 GLU CG C N N 148 GLU CD C N N 149 GLU OE1 O N N 150 GLU OE2 O N N 151 GLU OXT O N N 152 GLU H H N N 153 GLU H2 H N N 154 GLU HA H N N 155 GLU HB2 H N N 156 GLU HB3 H N N 157 GLU HG2 H N N 158 GLU HG3 H N N 159 GLU HE2 H N N 160 GLU HXT H N N 161 GLY N N N N 162 GLY CA C N N 163 GLY C C N N 164 GLY O O N N 165 GLY OXT O N N 166 GLY H H N N 167 GLY H2 H N N 168 GLY HA2 H N N 169 GLY HA3 H N N 170 GLY HXT H N N 171 HIS N N N N 172 HIS CA C N S 173 HIS C C N N 174 HIS O O N N 175 HIS CB C N N 176 HIS CG C Y N 177 HIS ND1 N Y N 178 HIS CD2 C Y N 179 HIS CE1 C Y N 180 HIS NE2 N Y N 181 HIS OXT O N N 182 HIS H H N N 183 HIS H2 H N N 184 HIS HA H N N 185 HIS HB2 H N N 186 HIS HB3 H N N 187 HIS HD1 H N N 188 HIS HD2 H N N 189 HIS HE1 H N N 190 HIS HE2 H N N 191 HIS HXT H N N 192 HOH O O N N 193 HOH H1 H N N 194 HOH H2 H N N 195 ILE N N N N 196 ILE CA C N S 197 ILE C C N N 198 ILE O O N N 199 ILE CB C N S 200 ILE CG1 C N N 201 ILE CG2 C N N 202 ILE CD1 C N N 203 ILE OXT O N N 204 ILE H H N N 205 ILE H2 H N N 206 ILE HA H N N 207 ILE HB H N N 208 ILE HG12 H N N 209 ILE HG13 H N N 210 ILE HG21 H N N 211 ILE HG22 H N N 212 ILE HG23 H N N 213 ILE HD11 H N N 214 ILE HD12 H N N 215 ILE HD13 H N N 216 ILE HXT H N N 217 LEU N N N N 218 LEU CA C N S 219 LEU C C N N 220 LEU O O N N 221 LEU CB C N N 222 LEU CG C N N 223 LEU CD1 C N N 224 LEU CD2 C N N 225 LEU OXT O N N 226 LEU H H N N 227 LEU H2 H N N 228 LEU HA H N N 229 LEU HB2 H N N 230 LEU HB3 H N N 231 LEU HG H N N 232 LEU HD11 H N N 233 LEU HD12 H N N 234 LEU HD13 H N N 235 LEU HD21 H N N 236 LEU HD22 H N N 237 LEU HD23 H N N 238 LEU HXT H N N 239 LYS N N N N 240 LYS CA C N S 241 LYS C C N N 242 LYS O O N N 243 LYS CB C N N 244 LYS CG C N N 245 LYS CD C N N 246 LYS CE C N N 247 LYS NZ N N N 248 LYS OXT O N N 249 LYS H H N N 250 LYS H2 H N N 251 LYS HA H N N 252 LYS HB2 H N N 253 LYS HB3 H N N 254 LYS HG2 H N N 255 LYS HG3 H N N 256 LYS HD2 H N N 257 LYS HD3 H N N 258 LYS HE2 H N N 259 LYS HE3 H N N 260 LYS HZ1 H N N 261 LYS HZ2 H N N 262 LYS HZ3 H N N 263 LYS HXT H N N 264 MET N N N N 265 MET CA C N S 266 MET C C N N 267 MET O O N N 268 MET CB C N N 269 MET CG C N N 270 MET SD S N N 271 MET CE C N N 272 MET OXT O N N 273 MET H H N N 274 MET H2 H N N 275 MET HA H N N 276 MET HB2 H N N 277 MET HB3 H N N 278 MET HG2 H N N 279 MET HG3 H N N 280 MET HE1 H N N 281 MET HE2 H N N 282 MET HE3 H N N 283 MET HXT H N N 284 PHE N N N N 285 PHE CA C N S 286 PHE C C N N 287 PHE O O N N 288 PHE CB C N N 289 PHE CG C Y N 290 PHE CD1 C Y N 291 PHE CD2 C Y N 292 PHE CE1 C Y N 293 PHE CE2 C Y N 294 PHE CZ C Y N 295 PHE OXT O N N 296 PHE H H N N 297 PHE H2 H N N 298 PHE HA H N N 299 PHE HB2 H N N 300 PHE HB3 H N N 301 PHE HD1 H N N 302 PHE HD2 H N N 303 PHE HE1 H N N 304 PHE HE2 H N N 305 PHE HZ H N N 306 PHE HXT H N N 307 PRO N N N N 308 PRO CA C N S 309 PRO C C N N 310 PRO O O N N 311 PRO CB C N N 312 PRO CG C N N 313 PRO CD C N N 314 PRO OXT O N N 315 PRO H H N N 316 PRO HA H N N 317 PRO HB2 H N N 318 PRO HB3 H N N 319 PRO HG2 H N N 320 PRO HG3 H N N 321 PRO HD2 H N N 322 PRO HD3 H N N 323 PRO HXT H N N 324 SER N N N N 325 SER CA C N S 326 SER C C N N 327 SER O O N N 328 SER CB C N N 329 SER OG O N N 330 SER OXT O N N 331 SER H H N N 332 SER H2 H N N 333 SER HA H N N 334 SER HB2 H N N 335 SER HB3 H N N 336 SER HG H N N 337 SER HXT H N N 338 THR N N N N 339 THR CA C N S 340 THR C C N N 341 THR O O N N 342 THR CB C N R 343 THR OG1 O N N 344 THR CG2 C N N 345 THR OXT O N N 346 THR H H N N 347 THR H2 H N N 348 THR HA H N N 349 THR HB H N N 350 THR HG1 H N N 351 THR HG21 H N N 352 THR HG22 H N N 353 THR HG23 H N N 354 THR HXT H N N 355 TRP N N N N 356 TRP CA C N S 357 TRP C C N N 358 TRP O O N N 359 TRP CB C N N 360 TRP CG C Y N 361 TRP CD1 C Y N 362 TRP CD2 C Y N 363 TRP NE1 N Y N 364 TRP CE2 C Y N 365 TRP CE3 C Y N 366 TRP CZ2 C Y N 367 TRP CZ3 C Y N 368 TRP CH2 C Y N 369 TRP OXT O N N 370 TRP H H N N 371 TRP H2 H N N 372 TRP HA H N N 373 TRP HB2 H N N 374 TRP HB3 H N N 375 TRP HD1 H N N 376 TRP HE1 H N N 377 TRP HE3 H N N 378 TRP HZ2 H N N 379 TRP HZ3 H N N 380 TRP HH2 H N N 381 TRP HXT H N N 382 TYR N N N N 383 TYR CA C N S 384 TYR C C N N 385 TYR O O N N 386 TYR CB C N N 387 TYR CG C Y N 388 TYR CD1 C Y N 389 TYR CD2 C Y N 390 TYR CE1 C Y N 391 TYR CE2 C Y N 392 TYR CZ C Y N 393 TYR OH O N N 394 TYR OXT O N N 395 TYR H H N N 396 TYR H2 H N N 397 TYR HA H N N 398 TYR HB2 H N N 399 TYR HB3 H N N 400 TYR HD1 H N N 401 TYR HD2 H N N 402 TYR HE1 H N N 403 TYR HE2 H N N 404 TYR HH H N N 405 TYR HXT H N N 406 VAL N N N N 407 VAL CA C N S 408 VAL C C N N 409 VAL O O N N 410 VAL CB C N N 411 VAL CG1 C N N 412 VAL CG2 C N N 413 VAL OXT O N N 414 VAL H H N N 415 VAL H2 H N N 416 VAL HA H N N 417 VAL HB H N N 418 VAL HG11 H N N 419 VAL HG12 H N N 420 VAL HG13 H N N 421 VAL HG21 H N N 422 VAL HG22 H N N 423 VAL HG23 H N N 424 VAL HXT H N N 425 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 DH2 C1 C2 doub Y N 83 DH2 C1 C6 sing Y N 84 DH2 C1 H1 sing N N 85 DH2 C2 C3 sing Y N 86 DH2 C2 O30 sing N N 87 DH2 C3 C4 doub Y N 88 DH2 C3 C9 sing N N 89 DH2 C4 C5 sing Y N 90 DH2 C4 O12 sing N N 91 DH2 C5 C6 doub Y N 92 DH2 C5 HB sing N N 93 DH2 C6 O29 sing N N 94 DH2 C9 C10 sing N N 95 DH2 C9 O13 doub N N 96 DH2 C10 C11 sing N N 97 DH2 C10 O27 sing N N 98 DH2 C10 HD sing N N 99 DH2 C11 C14 sing N N 100 DH2 C11 O12 sing N N 101 DH2 C11 H11 sing N N 102 DH2 C14 C15 doub Y N 103 DH2 C14 C19 sing Y N 104 DH2 C15 C16 sing Y N 105 DH2 C15 H15 sing N N 106 DH2 C16 C17 doub Y N 107 DH2 C16 H16 sing N N 108 DH2 C17 C18 sing Y N 109 DH2 C17 O24 sing N N 110 DH2 C18 C19 doub Y N 111 DH2 C18 O23 sing N N 112 DH2 C19 H19 sing N N 113 DH2 O23 H23 sing N N 114 DH2 O24 H24 sing N N 115 DH2 O27 H27 sing N N 116 DH2 O29 HC sing N N 117 DH2 O30 HA sing N N 118 GLN N CA sing N N 119 GLN N H sing N N 120 GLN N H2 sing N N 121 GLN CA C sing N N 122 GLN CA CB sing N N 123 GLN CA HA sing N N 124 GLN C O doub N N 125 GLN C OXT sing N N 126 GLN CB CG sing N N 127 GLN CB HB2 sing N N 128 GLN CB HB3 sing N N 129 GLN CG CD sing N N 130 GLN CG HG2 sing N N 131 GLN CG HG3 sing N N 132 GLN CD OE1 doub N N 133 GLN CD NE2 sing N N 134 GLN NE2 HE21 sing N N 135 GLN NE2 HE22 sing N N 136 GLN OXT HXT sing N N 137 GLU N CA sing N N 138 GLU N H sing N N 139 GLU N H2 sing N N 140 GLU CA C sing N N 141 GLU CA CB sing N N 142 GLU CA HA sing N N 143 GLU C O doub N N 144 GLU C OXT sing N N 145 GLU CB CG sing N N 146 GLU CB HB2 sing N N 147 GLU CB HB3 sing N N 148 GLU CG CD sing N N 149 GLU CG HG2 sing N N 150 GLU CG HG3 sing N N 151 GLU CD OE1 doub N N 152 GLU CD OE2 sing N N 153 GLU OE2 HE2 sing N N 154 GLU OXT HXT sing N N 155 GLY N CA sing N N 156 GLY N H sing N N 157 GLY N H2 sing N N 158 GLY CA C sing N N 159 GLY CA HA2 sing N N 160 GLY CA HA3 sing N N 161 GLY C O doub N N 162 GLY C OXT sing N N 163 GLY OXT HXT sing N N 164 HIS N CA sing N N 165 HIS N H sing N N 166 HIS N H2 sing N N 167 HIS CA C sing N N 168 HIS CA CB sing N N 169 HIS CA HA sing N N 170 HIS C O doub N N 171 HIS C OXT sing N N 172 HIS CB CG sing N N 173 HIS CB HB2 sing N N 174 HIS CB HB3 sing N N 175 HIS CG ND1 sing Y N 176 HIS CG CD2 doub Y N 177 HIS ND1 CE1 doub Y N 178 HIS ND1 HD1 sing N N 179 HIS CD2 NE2 sing Y N 180 HIS CD2 HD2 sing N N 181 HIS CE1 NE2 sing Y N 182 HIS CE1 HE1 sing N N 183 HIS NE2 HE2 sing N N 184 HIS OXT HXT sing N N 185 HOH O H1 sing N N 186 HOH O H2 sing N N 187 ILE N CA sing N N 188 ILE N H sing N N 189 ILE N H2 sing N N 190 ILE CA C sing N N 191 ILE CA CB sing N N 192 ILE CA HA sing N N 193 ILE C O doub N N 194 ILE C OXT sing N N 195 ILE CB CG1 sing N N 196 ILE CB CG2 sing N N 197 ILE CB HB sing N N 198 ILE CG1 CD1 sing N N 199 ILE CG1 HG12 sing N N 200 ILE CG1 HG13 sing N N 201 ILE CG2 HG21 sing N N 202 ILE CG2 HG22 sing N N 203 ILE CG2 HG23 sing N N 204 ILE CD1 HD11 sing N N 205 ILE CD1 HD12 sing N N 206 ILE CD1 HD13 sing N N 207 ILE OXT HXT sing N N 208 LEU N CA sing N N 209 LEU N H sing N N 210 LEU N H2 sing N N 211 LEU CA C sing N N 212 LEU CA CB sing N N 213 LEU CA HA sing N N 214 LEU C O doub N N 215 LEU C OXT sing N N 216 LEU CB CG sing N N 217 LEU CB HB2 sing N N 218 LEU CB HB3 sing N N 219 LEU CG CD1 sing N N 220 LEU CG CD2 sing N N 221 LEU CG HG sing N N 222 LEU CD1 HD11 sing N N 223 LEU CD1 HD12 sing N N 224 LEU CD1 HD13 sing N N 225 LEU CD2 HD21 sing N N 226 LEU CD2 HD22 sing N N 227 LEU CD2 HD23 sing N N 228 LEU OXT HXT sing N N 229 LYS N CA sing N N 230 LYS N H sing N N 231 LYS N H2 sing N N 232 LYS CA C sing N N 233 LYS CA CB sing N N 234 LYS CA HA sing N N 235 LYS C O doub N N 236 LYS C OXT sing N N 237 LYS CB CG sing N N 238 LYS CB HB2 sing N N 239 LYS CB HB3 sing N N 240 LYS CG CD sing N N 241 LYS CG HG2 sing N N 242 LYS CG HG3 sing N N 243 LYS CD CE sing N N 244 LYS CD HD2 sing N N 245 LYS CD HD3 sing N N 246 LYS CE NZ sing N N 247 LYS CE HE2 sing N N 248 LYS CE HE3 sing N N 249 LYS NZ HZ1 sing N N 250 LYS NZ HZ2 sing N N 251 LYS NZ HZ3 sing N N 252 LYS OXT HXT sing N N 253 MET N CA sing N N 254 MET N H sing N N 255 MET N H2 sing N N 256 MET CA C sing N N 257 MET CA CB sing N N 258 MET CA HA sing N N 259 MET C O doub N N 260 MET C OXT sing N N 261 MET CB CG sing N N 262 MET CB HB2 sing N N 263 MET CB HB3 sing N N 264 MET CG SD sing N N 265 MET CG HG2 sing N N 266 MET CG HG3 sing N N 267 MET SD CE sing N N 268 MET CE HE1 sing N N 269 MET CE HE2 sing N N 270 MET CE HE3 sing N N 271 MET OXT HXT sing N N 272 PHE N CA sing N N 273 PHE N H sing N N 274 PHE N H2 sing N N 275 PHE CA C sing N N 276 PHE CA CB sing N N 277 PHE CA HA sing N N 278 PHE C O doub N N 279 PHE C OXT sing N N 280 PHE CB CG sing N N 281 PHE CB HB2 sing N N 282 PHE CB HB3 sing N N 283 PHE CG CD1 doub Y N 284 PHE CG CD2 sing Y N 285 PHE CD1 CE1 sing Y N 286 PHE CD1 HD1 sing N N 287 PHE CD2 CE2 doub Y N 288 PHE CD2 HD2 sing N N 289 PHE CE1 CZ doub Y N 290 PHE CE1 HE1 sing N N 291 PHE CE2 CZ sing Y N 292 PHE CE2 HE2 sing N N 293 PHE CZ HZ sing N N 294 PHE OXT HXT sing N N 295 PRO N CA sing N N 296 PRO N CD sing N N 297 PRO N H sing N N 298 PRO CA C sing N N 299 PRO CA CB sing N N 300 PRO CA HA sing N N 301 PRO C O doub N N 302 PRO C OXT sing N N 303 PRO CB CG sing N N 304 PRO CB HB2 sing N N 305 PRO CB HB3 sing N N 306 PRO CG CD sing N N 307 PRO CG HG2 sing N N 308 PRO CG HG3 sing N N 309 PRO CD HD2 sing N N 310 PRO CD HD3 sing N N 311 PRO OXT HXT sing N N 312 SER N CA sing N N 313 SER N H sing N N 314 SER N H2 sing N N 315 SER CA C sing N N 316 SER CA CB sing N N 317 SER CA HA sing N N 318 SER C O doub N N 319 SER C OXT sing N N 320 SER CB OG sing N N 321 SER CB HB2 sing N N 322 SER CB HB3 sing N N 323 SER OG HG sing N N 324 SER OXT HXT sing N N 325 THR N CA sing N N 326 THR N H sing N N 327 THR N H2 sing N N 328 THR CA C sing N N 329 THR CA CB sing N N 330 THR CA HA sing N N 331 THR C O doub N N 332 THR C OXT sing N N 333 THR CB OG1 sing N N 334 THR CB CG2 sing N N 335 THR CB HB sing N N 336 THR OG1 HG1 sing N N 337 THR CG2 HG21 sing N N 338 THR CG2 HG22 sing N N 339 THR CG2 HG23 sing N N 340 THR OXT HXT sing N N 341 TRP N CA sing N N 342 TRP N H sing N N 343 TRP N H2 sing N N 344 TRP CA C sing N N 345 TRP CA CB sing N N 346 TRP CA HA sing N N 347 TRP C O doub N N 348 TRP C OXT sing N N 349 TRP CB CG sing N N 350 TRP CB HB2 sing N N 351 TRP CB HB3 sing N N 352 TRP CG CD1 doub Y N 353 TRP CG CD2 sing Y N 354 TRP CD1 NE1 sing Y N 355 TRP CD1 HD1 sing N N 356 TRP CD2 CE2 doub Y N 357 TRP CD2 CE3 sing Y N 358 TRP NE1 CE2 sing Y N 359 TRP NE1 HE1 sing N N 360 TRP CE2 CZ2 sing Y N 361 TRP CE3 CZ3 doub Y N 362 TRP CE3 HE3 sing N N 363 TRP CZ2 CH2 doub Y N 364 TRP CZ2 HZ2 sing N N 365 TRP CZ3 CH2 sing Y N 366 TRP CZ3 HZ3 sing N N 367 TRP CH2 HH2 sing N N 368 TRP OXT HXT sing N N 369 TYR N CA sing N N 370 TYR N H sing N N 371 TYR N H2 sing N N 372 TYR CA C sing N N 373 TYR CA CB sing N N 374 TYR CA HA sing N N 375 TYR C O doub N N 376 TYR C OXT sing N N 377 TYR CB CG sing N N 378 TYR CB HB2 sing N N 379 TYR CB HB3 sing N N 380 TYR CG CD1 doub Y N 381 TYR CG CD2 sing Y N 382 TYR CD1 CE1 sing Y N 383 TYR CD1 HD1 sing N N 384 TYR CD2 CE2 doub Y N 385 TYR CD2 HD2 sing N N 386 TYR CE1 CZ doub Y N 387 TYR CE1 HE1 sing N N 388 TYR CE2 CZ sing Y N 389 TYR CE2 HE2 sing N N 390 TYR CZ OH sing N N 391 TYR OH HH sing N N 392 TYR OXT HXT sing N N 393 VAL N CA sing N N 394 VAL N H sing N N 395 VAL N H2 sing N N 396 VAL CA C sing N N 397 VAL CA CB sing N N 398 VAL CA HA sing N N 399 VAL C O doub N N 400 VAL C OXT sing N N 401 VAL CB CG1 sing N N 402 VAL CB CG2 sing N N 403 VAL CB HB sing N N 404 VAL CG1 HG11 sing N N 405 VAL CG1 HG12 sing N N 406 VAL CG1 HG13 sing N N 407 VAL CG2 HG21 sing N N 408 VAL CG2 HG22 sing N N 409 VAL CG2 HG23 sing N N 410 VAL OXT HXT sing N N 411 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4f5w _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9XGR _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.012232 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010858 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013672 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CA H N O S # loop_ #