data_9XIJ # _entry.id 9XIJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.417 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9XIJ pdb_00009xij 10.2210/pdb9xij/pdb WWPDB D_1300065424 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-11-11 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9XIJ _pdbx_database_status.recvd_initial_deposition_date 2025-11-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBC _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email gzhao@cau.edu.cn _pdbx_contact_author.name_first Guanghua _pdbx_contact_author.name_last Zhao _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-8587-9680 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Guan, L.' 1 0009-0009-1892-7369 'Zhao, G.' 2 0000-0001-8587-9680 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of Macrobrachium rosenbergii lipocalin in complex with canthaxanthin' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Guan, L.' 1 0009-0009-1892-7369 primary 'Zhao, G.' 2 0000-0001-8587-9680 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Crustacyanin-like lipocalin' 23617.729 1 ? ? ? '-19 to +1 = His-tag + linker 2-187 = mature MrLC' 2 non-polymer syn "beta,beta-carotene-4,4'-dione" 564.840 1 ? ? ? ? 3 water nat water 18.015 78 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMDEVPDFVIKGKCPAVDEQRLWQQQLPRHSSFGGVWYQQAISTNPYQLLKKCVRIQYDYN GKGFDVKTAGITPEGNQLKRKGVLTPMPLGDPHLMINLENSFPAPLVILDTDYNNYACMYSCMDYNYGYHSDFAFFFARA PEAYDKYIAKCRAAFDSIGVDSNRLIKTEQGRGCDYEQLTKLIKDEL ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMDEVPDFVIKGKCPAVDEQRLWQQQLPRHSSFGGVWYQQAISTNPYQLLKKCVRIQYDYN GKGFDVKTAGITPEGNQLKRKGVLTPMPLGDPHLMINLENSFPAPLVILDTDYNNYACMYSCMDYNYGYHSDFAFFFARA PEAYDKYIAKCRAAFDSIGVDSNRLIKTEQGRGCDYEQLTKLIKDEL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "beta,beta-carotene-4,4'-dione" 45D 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 ASP n 1 23 GLU n 1 24 VAL n 1 25 PRO n 1 26 ASP n 1 27 PHE n 1 28 VAL n 1 29 ILE n 1 30 LYS n 1 31 GLY n 1 32 LYS n 1 33 CYS n 1 34 PRO n 1 35 ALA n 1 36 VAL n 1 37 ASP n 1 38 GLU n 1 39 GLN n 1 40 ARG n 1 41 LEU n 1 42 TRP n 1 43 GLN n 1 44 GLN n 1 45 GLN n 1 46 LEU n 1 47 PRO n 1 48 ARG n 1 49 HIS n 1 50 SER n 1 51 SER n 1 52 PHE n 1 53 GLY n 1 54 GLY n 1 55 VAL n 1 56 TRP n 1 57 TYR n 1 58 GLN n 1 59 GLN n 1 60 ALA n 1 61 ILE n 1 62 SER n 1 63 THR n 1 64 ASN n 1 65 PRO n 1 66 TYR n 1 67 GLN n 1 68 LEU n 1 69 LEU n 1 70 LYS n 1 71 LYS n 1 72 CYS n 1 73 VAL n 1 74 ARG n 1 75 ILE n 1 76 GLN n 1 77 TYR n 1 78 ASP n 1 79 TYR n 1 80 ASN n 1 81 GLY n 1 82 LYS n 1 83 GLY n 1 84 PHE n 1 85 ASP n 1 86 VAL n 1 87 LYS n 1 88 THR n 1 89 ALA n 1 90 GLY n 1 91 ILE n 1 92 THR n 1 93 PRO n 1 94 GLU n 1 95 GLY n 1 96 ASN n 1 97 GLN n 1 98 LEU n 1 99 LYS n 1 100 ARG n 1 101 LYS n 1 102 GLY n 1 103 VAL n 1 104 LEU n 1 105 THR n 1 106 PRO n 1 107 MET n 1 108 PRO n 1 109 LEU n 1 110 GLY n 1 111 ASP n 1 112 PRO n 1 113 HIS n 1 114 LEU n 1 115 MET n 1 116 ILE n 1 117 ASN n 1 118 LEU n 1 119 GLU n 1 120 ASN n 1 121 SER n 1 122 PHE n 1 123 PRO n 1 124 ALA n 1 125 PRO n 1 126 LEU n 1 127 VAL n 1 128 ILE n 1 129 LEU n 1 130 ASP n 1 131 THR n 1 132 ASP n 1 133 TYR n 1 134 ASN n 1 135 ASN n 1 136 TYR n 1 137 ALA n 1 138 CYS n 1 139 MET n 1 140 TYR n 1 141 SER n 1 142 CYS n 1 143 MET n 1 144 ASP n 1 145 TYR n 1 146 ASN n 1 147 TYR n 1 148 GLY n 1 149 TYR n 1 150 HIS n 1 151 SER n 1 152 ASP n 1 153 PHE n 1 154 ALA n 1 155 PHE n 1 156 PHE n 1 157 PHE n 1 158 ALA n 1 159 ARG n 1 160 ALA n 1 161 PRO n 1 162 GLU n 1 163 ALA n 1 164 TYR n 1 165 ASP n 1 166 LYS n 1 167 TYR n 1 168 ILE n 1 169 ALA n 1 170 LYS n 1 171 CYS n 1 172 ARG n 1 173 ALA n 1 174 ALA n 1 175 PHE n 1 176 ASP n 1 177 SER n 1 178 ILE n 1 179 GLY n 1 180 VAL n 1 181 ASP n 1 182 SER n 1 183 ASN n 1 184 ARG n 1 185 LEU n 1 186 ILE n 1 187 LYS n 1 188 THR n 1 189 GLU n 1 190 GLN n 1 191 GLY n 1 192 ARG n 1 193 GLY n 1 194 CYS n 1 195 ASP n 1 196 TYR n 1 197 GLU n 1 198 GLN n 1 199 LEU n 1 200 THR n 1 201 LYS n 1 202 LEU n 1 203 ILE n 1 204 LYS n 1 205 ASP n 1 206 GLU n 1 207 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 207 _entity_src_gen.gene_src_common_name 'giant freshwater prawn' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Macrobrachium rosenbergii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 79674 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 45D non-polymer . "beta,beta-carotene-4,4'-dione" 'Isomer of Canthaxanthin' 'C40 H52 O2' 564.840 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -19 ? ? ? A . n A 1 2 GLY 2 -18 ? ? ? A . n A 1 3 SER 3 -17 ? ? ? A . n A 1 4 SER 4 -16 ? ? ? A . n A 1 5 HIS 5 -15 ? ? ? A . n A 1 6 HIS 6 -14 ? ? ? A . n A 1 7 HIS 7 -13 ? ? ? A . n A 1 8 HIS 8 -12 ? ? ? A . n A 1 9 HIS 9 -11 ? ? ? A . n A 1 10 HIS 10 -10 ? ? ? A . n A 1 11 SER 11 -9 ? ? ? A . n A 1 12 SER 12 -8 ? ? ? A . n A 1 13 GLY 13 -7 ? ? ? A . n A 1 14 LEU 14 -6 ? ? ? A . n A 1 15 VAL 15 -5 ? ? ? A . n A 1 16 PRO 16 -4 ? ? ? A . n A 1 17 ARG 17 -3 ? ? ? A . n A 1 18 GLY 18 -2 ? ? ? A . n A 1 19 SER 19 -1 ? ? ? A . n A 1 20 HIS 20 0 ? ? ? A . n A 1 21 MET 21 1 ? ? ? A . n A 1 22 ASP 22 2 2 ASP ASP A . n A 1 23 GLU 23 3 3 GLU GLU A . n A 1 24 VAL 24 4 4 VAL VAL A . n A 1 25 PRO 25 5 5 PRO PRO A . n A 1 26 ASP 26 6 6 ASP ASP A . n A 1 27 PHE 27 7 7 PHE PHE A . n A 1 28 VAL 28 8 8 VAL VAL A . n A 1 29 ILE 29 9 9 ILE ILE A . n A 1 30 LYS 30 10 10 LYS LYS A . n A 1 31 GLY 31 11 11 GLY GLY A . n A 1 32 LYS 32 12 12 LYS LYS A . n A 1 33 CYS 33 13 13 CYS CYS A . n A 1 34 PRO 34 14 14 PRO PRO A . n A 1 35 ALA 35 15 15 ALA ALA A . n A 1 36 VAL 36 16 16 VAL VAL A . n A 1 37 ASP 37 17 17 ASP ASP A . n A 1 38 GLU 38 18 18 GLU GLU A . n A 1 39 GLN 39 19 19 GLN GLN A . n A 1 40 ARG 40 20 20 ARG ARG A . n A 1 41 LEU 41 21 21 LEU LEU A . n A 1 42 TRP 42 22 22 TRP TRP A . n A 1 43 GLN 43 23 23 GLN GLN A . n A 1 44 GLN 44 24 24 GLN GLN A . n A 1 45 GLN 45 25 25 GLN GLN A . n A 1 46 LEU 46 26 26 LEU LEU A . n A 1 47 PRO 47 27 27 PRO PRO A . n A 1 48 ARG 48 28 28 ARG ARG A . n A 1 49 HIS 49 29 29 HIS HIS A . n A 1 50 SER 50 30 30 SER SER A . n A 1 51 SER 51 31 31 SER SER A . n A 1 52 PHE 52 32 32 PHE PHE A . n A 1 53 GLY 53 33 33 GLY GLY A . n A 1 54 GLY 54 34 34 GLY GLY A . n A 1 55 VAL 55 35 35 VAL VAL A . n A 1 56 TRP 56 36 36 TRP TRP A . n A 1 57 TYR 57 37 37 TYR TYR A . n A 1 58 GLN 58 38 38 GLN GLN A . n A 1 59 GLN 59 39 39 GLN GLN A . n A 1 60 ALA 60 40 40 ALA ALA A . n A 1 61 ILE 61 41 41 ILE ILE A . n A 1 62 SER 62 42 42 SER SER A . n A 1 63 THR 63 43 43 THR THR A . n A 1 64 ASN 64 44 44 ASN ASN A . n A 1 65 PRO 65 45 45 PRO PRO A . n A 1 66 TYR 66 46 46 TYR TYR A . n A 1 67 GLN 67 47 47 GLN GLN A . n A 1 68 LEU 68 48 48 LEU LEU A . n A 1 69 LEU 69 49 49 LEU LEU A . n A 1 70 LYS 70 50 50 LYS LYS A . n A 1 71 LYS 71 51 51 LYS LYS A . n A 1 72 CYS 72 52 52 CYS CYS A . n A 1 73 VAL 73 53 53 VAL VAL A . n A 1 74 ARG 74 54 54 ARG ARG A . n A 1 75 ILE 75 55 55 ILE ILE A . n A 1 76 GLN 76 56 56 GLN GLN A . n A 1 77 TYR 77 57 57 TYR TYR A . n A 1 78 ASP 78 58 58 ASP ASP A . n A 1 79 TYR 79 59 59 TYR TYR A . n A 1 80 ASN 80 60 60 ASN ASN A . n A 1 81 GLY 81 61 61 GLY GLY A . n A 1 82 LYS 82 62 62 LYS LYS A . n A 1 83 GLY 83 63 63 GLY GLY A . n A 1 84 PHE 84 64 64 PHE PHE A . n A 1 85 ASP 85 65 65 ASP ASP A . n A 1 86 VAL 86 66 66 VAL VAL A . n A 1 87 LYS 87 67 67 LYS LYS A . n A 1 88 THR 88 68 68 THR THR A . n A 1 89 ALA 89 69 69 ALA ALA A . n A 1 90 GLY 90 70 70 GLY GLY A . n A 1 91 ILE 91 71 71 ILE ILE A . n A 1 92 THR 92 72 72 THR THR A . n A 1 93 PRO 93 73 73 PRO PRO A . n A 1 94 GLU 94 74 74 GLU GLU A . n A 1 95 GLY 95 75 75 GLY GLY A . n A 1 96 ASN 96 76 76 ASN ASN A . n A 1 97 GLN 97 77 77 GLN GLN A . n A 1 98 LEU 98 78 78 LEU LEU A . n A 1 99 LYS 99 79 79 LYS LYS A . n A 1 100 ARG 100 80 80 ARG ARG A . n A 1 101 LYS 101 81 81 LYS LYS A . n A 1 102 GLY 102 82 82 GLY GLY A . n A 1 103 VAL 103 83 83 VAL VAL A . n A 1 104 LEU 104 84 84 LEU LEU A . n A 1 105 THR 105 85 85 THR THR A . n A 1 106 PRO 106 86 86 PRO PRO A . n A 1 107 MET 107 87 87 MET MET A . n A 1 108 PRO 108 88 88 PRO PRO A . n A 1 109 LEU 109 89 89 LEU LEU A . n A 1 110 GLY 110 90 90 GLY GLY A . n A 1 111 ASP 111 91 91 ASP ASP A . n A 1 112 PRO 112 92 92 PRO PRO A . n A 1 113 HIS 113 93 93 HIS HIS A . n A 1 114 LEU 114 94 94 LEU LEU A . n A 1 115 MET 115 95 95 MET MET A . n A 1 116 ILE 116 96 96 ILE ILE A . n A 1 117 ASN 117 97 97 ASN ASN A . n A 1 118 LEU 118 98 98 LEU LEU A . n A 1 119 GLU 119 99 99 GLU GLU A . n A 1 120 ASN 120 100 100 ASN ASN A . n A 1 121 SER 121 101 101 SER SER A . n A 1 122 PHE 122 102 102 PHE PHE A . n A 1 123 PRO 123 103 103 PRO PRO A . n A 1 124 ALA 124 104 104 ALA ALA A . n A 1 125 PRO 125 105 105 PRO PRO A . n A 1 126 LEU 126 106 106 LEU LEU A . n A 1 127 VAL 127 107 107 VAL VAL A . n A 1 128 ILE 128 108 108 ILE ILE A . n A 1 129 LEU 129 109 109 LEU LEU A . n A 1 130 ASP 130 110 110 ASP ASP A . n A 1 131 THR 131 111 111 THR THR A . n A 1 132 ASP 132 112 112 ASP ASP A . n A 1 133 TYR 133 113 113 TYR TYR A . n A 1 134 ASN 134 114 114 ASN ASN A . n A 1 135 ASN 135 115 115 ASN ASN A . n A 1 136 TYR 136 116 116 TYR TYR A . n A 1 137 ALA 137 117 117 ALA ALA A . n A 1 138 CYS 138 118 118 CYS CYS A . n A 1 139 MET 139 119 119 MET MET A . n A 1 140 TYR 140 120 120 TYR TYR A . n A 1 141 SER 141 121 121 SER SER A . n A 1 142 CYS 142 122 122 CYS CYS A . n A 1 143 MET 143 123 123 MET MET A . n A 1 144 ASP 144 124 124 ASP ASP A . n A 1 145 TYR 145 125 125 TYR TYR A . n A 1 146 ASN 146 126 126 ASN ASN A . n A 1 147 TYR 147 127 127 TYR TYR A . n A 1 148 GLY 148 128 128 GLY GLY A . n A 1 149 TYR 149 129 129 TYR TYR A . n A 1 150 HIS 150 130 130 HIS HIS A . n A 1 151 SER 151 131 131 SER SER A . n A 1 152 ASP 152 132 132 ASP ASP A . n A 1 153 PHE 153 133 133 PHE PHE A . n A 1 154 ALA 154 134 134 ALA ALA A . n A 1 155 PHE 155 135 135 PHE PHE A . n A 1 156 PHE 156 136 136 PHE PHE A . n A 1 157 PHE 157 137 137 PHE PHE A . n A 1 158 ALA 158 138 138 ALA ALA A . n A 1 159 ARG 159 139 139 ARG ARG A . n A 1 160 ALA 160 140 140 ALA ALA A . n A 1 161 PRO 161 141 141 PRO PRO A . n A 1 162 GLU 162 142 142 GLU GLU A . n A 1 163 ALA 163 143 143 ALA ALA A . n A 1 164 TYR 164 144 144 TYR TYR A . n A 1 165 ASP 165 145 145 ASP ASP A . n A 1 166 LYS 166 146 146 LYS LYS A . n A 1 167 TYR 167 147 147 TYR TYR A . n A 1 168 ILE 168 148 148 ILE ILE A . n A 1 169 ALA 169 149 149 ALA ALA A . n A 1 170 LYS 170 150 150 LYS LYS A . n A 1 171 CYS 171 151 151 CYS CYS A . n A 1 172 ARG 172 152 152 ARG ARG A . n A 1 173 ALA 173 153 153 ALA ALA A . n A 1 174 ALA 174 154 154 ALA ALA A . n A 1 175 PHE 175 155 155 PHE PHE A . n A 1 176 ASP 176 156 156 ASP ASP A . n A 1 177 SER 177 157 157 SER SER A . n A 1 178 ILE 178 158 158 ILE ILE A . n A 1 179 GLY 179 159 159 GLY GLY A . n A 1 180 VAL 180 160 160 VAL VAL A . n A 1 181 ASP 181 161 161 ASP ASP A . n A 1 182 SER 182 162 162 SER SER A . n A 1 183 ASN 183 163 163 ASN ASN A . n A 1 184 ARG 184 164 164 ARG ARG A . n A 1 185 LEU 185 165 165 LEU LEU A . n A 1 186 ILE 186 166 166 ILE ILE A . n A 1 187 LYS 187 167 167 LYS LYS A . n A 1 188 THR 188 168 168 THR THR A . n A 1 189 GLU 189 169 169 GLU GLU A . n A 1 190 GLN 190 170 170 GLN GLN A . n A 1 191 GLY 191 171 171 GLY GLY A . n A 1 192 ARG 192 172 172 ARG ARG A . n A 1 193 GLY 193 173 173 GLY GLY A . n A 1 194 CYS 194 174 174 CYS CYS A . n A 1 195 ASP 195 175 175 ASP ASP A . n A 1 196 TYR 196 176 176 TYR TYR A . n A 1 197 GLU 197 177 177 GLU GLU A . n A 1 198 GLN 198 178 178 GLN GLN A . n A 1 199 LEU 199 179 179 LEU LEU A . n A 1 200 THR 200 180 180 THR THR A . n A 1 201 LYS 201 181 181 LYS LYS A . n A 1 202 LEU 202 182 182 LEU LEU A . n A 1 203 ILE 203 183 183 ILE ILE A . n A 1 204 LYS 204 184 184 LYS LYS A . n A 1 205 ASP 205 185 ? ? ? A . n A 1 206 GLU 206 186 ? ? ? A . n A 1 207 LEU 207 187 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id 45D _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id 45D _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 45D 1 201 201 45D 45D A . C 3 HOH 1 301 56 HOH HOH A . C 3 HOH 2 302 62 HOH HOH A . C 3 HOH 3 303 75 HOH HOH A . C 3 HOH 4 304 35 HOH HOH A . C 3 HOH 5 305 9 HOH HOH A . C 3 HOH 6 306 23 HOH HOH A . C 3 HOH 7 307 60 HOH HOH A . C 3 HOH 8 308 37 HOH HOH A . C 3 HOH 9 309 47 HOH HOH A . C 3 HOH 10 310 15 HOH HOH A . C 3 HOH 11 311 32 HOH HOH A . C 3 HOH 12 312 78 HOH HOH A . C 3 HOH 13 313 36 HOH HOH A . C 3 HOH 14 314 68 HOH HOH A . C 3 HOH 15 315 16 HOH HOH A . C 3 HOH 16 316 4 HOH HOH A . C 3 HOH 17 317 54 HOH HOH A . C 3 HOH 18 318 6 HOH HOH A . C 3 HOH 19 319 53 HOH HOH A . C 3 HOH 20 320 30 HOH HOH A . C 3 HOH 21 321 140 HOH HOH A . C 3 HOH 22 322 29 HOH HOH A . C 3 HOH 23 323 74 HOH HOH A . C 3 HOH 24 324 41 HOH HOH A . C 3 HOH 25 325 57 HOH HOH A . C 3 HOH 26 326 87 HOH HOH A . C 3 HOH 27 327 14 HOH HOH A . C 3 HOH 28 328 25 HOH HOH A . C 3 HOH 29 329 72 HOH HOH A . C 3 HOH 30 330 161 HOH HOH A . C 3 HOH 31 331 105 HOH HOH A . C 3 HOH 32 332 76 HOH HOH A . C 3 HOH 33 333 83 HOH HOH A . C 3 HOH 34 334 39 HOH HOH A . C 3 HOH 35 335 27 HOH HOH A . C 3 HOH 36 336 51 HOH HOH A . C 3 HOH 37 337 69 HOH HOH A . C 3 HOH 38 338 26 HOH HOH A . C 3 HOH 39 339 20 HOH HOH A . C 3 HOH 40 340 28 HOH HOH A . C 3 HOH 41 341 42 HOH HOH A . C 3 HOH 42 342 43 HOH HOH A . C 3 HOH 43 343 5 HOH HOH A . C 3 HOH 44 344 18 HOH HOH A . C 3 HOH 45 345 71 HOH HOH A . C 3 HOH 46 346 11 HOH HOH A . C 3 HOH 47 347 10 HOH HOH A . C 3 HOH 48 348 46 HOH HOH A . C 3 HOH 49 349 45 HOH HOH A . C 3 HOH 50 350 92 HOH HOH A . C 3 HOH 51 351 22 HOH HOH A . C 3 HOH 52 352 8 HOH HOH A . C 3 HOH 53 353 101 HOH HOH A . C 3 HOH 54 354 31 HOH HOH A . C 3 HOH 55 355 44 HOH HOH A . C 3 HOH 56 356 34 HOH HOH A . C 3 HOH 57 357 52 HOH HOH A . C 3 HOH 58 358 77 HOH HOH A . C 3 HOH 59 359 40 HOH HOH A . C 3 HOH 60 360 13 HOH HOH A . C 3 HOH 61 362 19 HOH HOH A . C 3 HOH 62 363 55 HOH HOH A . C 3 HOH 63 364 33 HOH HOH A . C 3 HOH 64 365 24 HOH HOH A . C 3 HOH 65 366 58 HOH HOH A . C 3 HOH 66 367 3 HOH HOH A . C 3 HOH 67 368 21 HOH HOH A . C 3 HOH 68 369 17 HOH HOH A . C 3 HOH 69 370 48 HOH HOH A . C 3 HOH 70 371 307 HOH HOH A . C 3 HOH 71 372 80 HOH HOH A . C 3 HOH 72 373 205 HOH HOH A . C 3 HOH 73 374 186 HOH HOH A . C 3 HOH 74 375 63 HOH HOH A . C 3 HOH 75 376 190 HOH HOH A . C 3 HOH 76 377 50 HOH HOH A . C 3 HOH 77 378 64 HOH HOH A . C 3 HOH 78 379 189 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21.2_5419 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? '0.7.7 (CCP4 7.1.015)' ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . ? 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 9XIJ _cell.details ? _cell.formula_units_Z ? _cell.length_a 55.100 _cell.length_a_esd ? _cell.length_b 55.100 _cell.length_b_esd ? _cell.length_c 137.170 _cell.length_c_esd ? _cell.volume 360655.839 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9XIJ _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ;P 31 2" ; _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9XIJ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.55 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.67 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;20% (w/v) PEG 6000 100 mM Sodium citrate/ Citric acid pH 4.0 1000 mM Lithium chloride ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2025-03-08 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97946 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL18U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97946 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL18U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 16.43 _reflns.entry_id 9XIJ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.76 _reflns.d_resolution_low 45.72 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 24710 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.5 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.984 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.76 _reflns_shell.d_res_low 1.81 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.8 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1741 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 4.0 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.560 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 97.7 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.698 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 24.21 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9XIJ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.76 _refine.ls_d_res_low 39.17 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 24656 _refine.ls_number_reflns_R_free 2011 _refine.ls_number_reflns_R_work 22645 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.74 _refine.ls_percent_reflns_R_free 8.16 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1980 _refine.ls_R_factor_R_free 0.2228 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1958 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 20.1093 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1917 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.76 _refine_hist.d_res_low 39.17 _refine_hist.number_atoms_solvent 79 _refine_hist.number_atoms_total 1594 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1473 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 42 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0064 ? 1555 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.9080 ? 2107 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0585 ? 210 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0073 ? 280 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 17.6844 ? 587 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.76 1.80 . . 134 1555 97.35 . . . . 0.2699 . . . . . . . . . . . . . . . 0.3037 'X-RAY DIFFRACTION' 1.80 1.85 . . 141 1579 99.36 . . . . 0.2541 . . . . . . . . . . . . . . . 0.2624 'X-RAY DIFFRACTION' 1.85 1.91 . . 143 1589 99.94 . . . . 0.2317 . . . . . . . . . . . . . . . 0.2899 'X-RAY DIFFRACTION' 1.91 1.97 . . 139 1599 100.00 . . . . 0.2140 . . . . . . . . . . . . . . . 0.2807 'X-RAY DIFFRACTION' 1.97 2.04 . . 141 1587 100.00 . . . . 0.1910 . . . . . . . . . . . . . . . 0.2253 'X-RAY DIFFRACTION' 2.04 2.12 . . 142 1614 100.00 . . . . 0.1896 . . . . . . . . . . . . . . . 0.2325 'X-RAY DIFFRACTION' 2.12 2.22 . . 142 1588 100.00 . . . . 0.1910 . . . . . . . . . . . . . . . 0.1936 'X-RAY DIFFRACTION' 2.22 2.33 . . 147 1593 100.00 . . . . 0.1891 . . . . . . . . . . . . . . . 0.2333 'X-RAY DIFFRACTION' 2.33 2.48 . . 142 1621 99.94 . . . . 0.1958 . . . . . . . . . . . . . . . 0.2273 'X-RAY DIFFRACTION' 2.48 2.67 . . 141 1612 100.00 . . . . 0.2083 . . . . . . . . . . . . . . . 0.2382 'X-RAY DIFFRACTION' 2.67 2.94 . . 142 1643 100.00 . . . . 0.2099 . . . . . . . . . . . . . . . 0.2335 'X-RAY DIFFRACTION' 2.94 3.37 . . 149 1631 100.00 . . . . 0.1986 . . . . . . . . . . . . . . . 0.2069 'X-RAY DIFFRACTION' 3.37 4.24 . . 149 1685 100.00 . . . . 0.1735 . . . . . . . . . . . . . . . 0.1999 'X-RAY DIFFRACTION' 4.24 39.17 . . 159 1749 99.69 . . . . 0.1744 . . . . . . . . . . . . . . . 0.1961 # _struct.entry_id 9XIJ _struct.title 'Crystal structure of Macrobrachium rosenbergii lipocalin in complex with canthaxanthin' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9XIJ _struct_keywords.text 'lipocalin, carotenoid binding, canthaxanthin complex, Macrobrachium rosenbergii, LIPID BINDING PROTEIN' _struct_keywords.pdbx_keywords 'LIPID BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A4Z4V4_MACRS _struct_ref.pdbx_db_accession A4Z4V4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DEVPDFVIKGKCPAVDEQRLWQQQLPRHSSFGGVWYQQAISTNPYQLLKKCVRIQYDYNGKGFDVKTAGITPEGNQLKRK GVLTPMPLGDPHLMINLENSFPAPLVILDTDYNNYACMYSCMDYNYGYHSDFAFFFARAPEAYDKYIAKCRAAFDSIGVD SNRLIKTEQGRGCDYEQLTKLIKDEL ; _struct_ref.pdbx_align_begin 18 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9XIJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 22 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 207 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A4Z4V4 _struct_ref_seq.db_align_beg 18 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 203 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 187 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9XIJ MET A 1 ? UNP A4Z4V4 ? ? 'initiating methionine' -19 1 1 9XIJ GLY A 2 ? UNP A4Z4V4 ? ? 'expression tag' -18 2 1 9XIJ SER A 3 ? UNP A4Z4V4 ? ? 'expression tag' -17 3 1 9XIJ SER A 4 ? UNP A4Z4V4 ? ? 'expression tag' -16 4 1 9XIJ HIS A 5 ? UNP A4Z4V4 ? ? 'expression tag' -15 5 1 9XIJ HIS A 6 ? UNP A4Z4V4 ? ? 'expression tag' -14 6 1 9XIJ HIS A 7 ? UNP A4Z4V4 ? ? 'expression tag' -13 7 1 9XIJ HIS A 8 ? UNP A4Z4V4 ? ? 'expression tag' -12 8 1 9XIJ HIS A 9 ? UNP A4Z4V4 ? ? 'expression tag' -11 9 1 9XIJ HIS A 10 ? UNP A4Z4V4 ? ? 'expression tag' -10 10 1 9XIJ SER A 11 ? UNP A4Z4V4 ? ? 'expression tag' -9 11 1 9XIJ SER A 12 ? UNP A4Z4V4 ? ? 'expression tag' -8 12 1 9XIJ GLY A 13 ? UNP A4Z4V4 ? ? 'expression tag' -7 13 1 9XIJ LEU A 14 ? UNP A4Z4V4 ? ? 'expression tag' -6 14 1 9XIJ VAL A 15 ? UNP A4Z4V4 ? ? 'expression tag' -5 15 1 9XIJ PRO A 16 ? UNP A4Z4V4 ? ? 'expression tag' -4 16 1 9XIJ ARG A 17 ? UNP A4Z4V4 ? ? 'expression tag' -3 17 1 9XIJ GLY A 18 ? UNP A4Z4V4 ? ? 'expression tag' -2 18 1 9XIJ SER A 19 ? UNP A4Z4V4 ? ? 'expression tag' -1 19 1 9XIJ HIS A 20 ? UNP A4Z4V4 ? ? 'expression tag' 0 20 1 9XIJ MET A 21 ? UNP A4Z4V4 ? ? 'expression tag' 1 21 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3900 ? 1 MORE -26 ? 1 'SSA (A^2)' 16610 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support homology _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_555 -x,-x+y,-z+1/3 -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 45.7233333333 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 163 ? ILE A 178 ? ALA A 143 ILE A 158 1 ? 16 HELX_P HELX_P2 AA2 ASP A 181 ? LEU A 185 ? ASP A 161 LEU A 165 5 ? 5 HELX_P HELX_P3 AA3 ASP A 195 ? LYS A 204 ? ASP A 175 LYS A 184 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 33 SG ? ? ? 1_555 A CYS 142 SG ? ? A CYS 13 A CYS 122 1_555 ? ? ? ? ? ? ? 2.045 ? ? disulf2 disulf ? ? A CYS 72 SG ? ? ? 1_555 A CYS 194 SG ? ? A CYS 52 A CYS 174 1_555 ? ? ? ? ? ? ? 2.008 ? ? disulf3 disulf ? ? A CYS 138 SG ? ? ? 1_555 A CYS 171 SG ? ? A CYS 118 A CYS 151 1_555 ? ? ? ? ? ? ? 2.042 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 33 ? CYS A 142 ? CYS A 13 ? 1_555 CYS A 122 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 72 ? CYS A 194 ? CYS A 52 ? 1_555 CYS A 174 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 138 ? CYS A 171 ? CYS A 118 ? 1_555 CYS A 151 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 46 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 26 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 47 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 27 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 4.03 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 10 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA2 7 8 ? anti-parallel AA2 8 9 ? anti-parallel AA2 9 10 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 28 ? LYS A 30 ? VAL A 8 LYS A 10 AA1 2 TYR A 149 ? ALA A 158 ? TYR A 129 ALA A 138 AA1 3 GLY A 54 ? ILE A 61 ? GLY A 34 ILE A 41 AA1 4 ILE A 186 ? LYS A 187 ? ILE A 166 LYS A 167 AA2 1 VAL A 28 ? LYS A 30 ? VAL A 8 LYS A 10 AA2 2 TYR A 149 ? ALA A 158 ? TYR A 129 ALA A 138 AA2 3 TYR A 136 ? ASN A 146 ? TYR A 116 ASN A 126 AA2 4 PRO A 123 ? THR A 131 ? PRO A 103 THR A 111 AA2 5 MET A 115 ? LEU A 118 ? MET A 95 LEU A 98 AA2 6 GLN A 97 ? THR A 105 ? GLN A 77 THR A 85 AA2 7 PHE A 84 ? ILE A 91 ? PHE A 64 ILE A 71 AA2 8 LYS A 71 ? TYR A 79 ? LYS A 51 TYR A 59 AA2 9 GLY A 54 ? ILE A 61 ? GLY A 34 ILE A 41 AA2 10 ILE A 186 ? LYS A 187 ? ILE A 166 LYS A 167 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 29 ? N ILE A 9 O HIS A 150 ? O HIS A 130 AA1 2 3 O ALA A 158 ? O ALA A 138 N TYR A 57 ? N TYR A 37 AA1 3 4 N ILE A 61 ? N ILE A 41 O ILE A 186 ? O ILE A 166 AA2 1 2 N ILE A 29 ? N ILE A 9 O HIS A 150 ? O HIS A 130 AA2 2 3 O PHE A 157 ? O PHE A 137 N ALA A 137 ? N ALA A 117 AA2 3 4 O CYS A 138 ? O CYS A 118 N ASP A 130 ? N ASP A 110 AA2 4 5 O LEU A 126 ? O LEU A 106 N MET A 115 ? N MET A 95 AA2 5 6 O ILE A 116 ? O ILE A 96 N THR A 105 ? N THR A 85 AA2 6 7 O LEU A 104 ? O LEU A 84 N PHE A 84 ? N PHE A 64 AA2 7 8 O ASP A 85 ? O ASP A 65 N ASP A 78 ? N ASP A 58 AA2 8 9 O ILE A 75 ? O ILE A 55 N TRP A 56 ? N TRP A 36 AA2 9 10 N ILE A 61 ? N ILE A 41 O ILE A 186 ? O ILE A 166 # _pdbx_entry_details.entry_id 9XIJ _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 29 ? ? -156.66 45.83 2 1 LYS A 62 ? ? -131.19 -69.04 3 1 GLU A 99 ? ? -126.13 -52.93 4 1 SER A 101 ? ? 74.00 -0.39 5 1 TYR A 113 ? ? 68.70 -29.74 6 1 ASN A 115 ? ? -133.93 -44.06 7 1 ASN A 126 ? ? 58.28 -162.51 8 1 TYR A 127 ? ? 45.14 22.20 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -19 ? A MET 1 2 1 Y 1 A GLY -18 ? A GLY 2 3 1 Y 1 A SER -17 ? A SER 3 4 1 Y 1 A SER -16 ? A SER 4 5 1 Y 1 A HIS -15 ? A HIS 5 6 1 Y 1 A HIS -14 ? A HIS 6 7 1 Y 1 A HIS -13 ? A HIS 7 8 1 Y 1 A HIS -12 ? A HIS 8 9 1 Y 1 A HIS -11 ? A HIS 9 10 1 Y 1 A HIS -10 ? A HIS 10 11 1 Y 1 A SER -9 ? A SER 11 12 1 Y 1 A SER -8 ? A SER 12 13 1 Y 1 A GLY -7 ? A GLY 13 14 1 Y 1 A LEU -6 ? A LEU 14 15 1 Y 1 A VAL -5 ? A VAL 15 16 1 Y 1 A PRO -4 ? A PRO 16 17 1 Y 1 A ARG -3 ? A ARG 17 18 1 Y 1 A GLY -2 ? A GLY 18 19 1 Y 1 A SER -1 ? A SER 19 20 1 Y 1 A HIS 0 ? A HIS 20 21 1 Y 1 A MET 1 ? A MET 21 22 1 Y 1 A ASP 185 ? A ASP 205 23 1 Y 1 A GLU 186 ? A GLU 206 24 1 Y 1 A LEU 187 ? A LEU 207 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 45D O01 O N N 1 45D O02 O N N 2 45D C03 C N N 3 45D C04 C N N 4 45D C05 C N N 5 45D C06 C N N 6 45D C07 C N N 7 45D C08 C N N 8 45D C09 C N N 9 45D C10 C N N 10 45D C11 C N N 11 45D C12 C N N 12 45D C13 C N N 13 45D C14 C N N 14 45D C15 C N N 15 45D C16 C N N 16 45D C17 C N N 17 45D C18 C N N 18 45D C19 C N N 19 45D C20 C N N 20 45D C21 C N N 21 45D C22 C N N 22 45D C23 C N N 23 45D C24 C N N 24 45D C25 C N N 25 45D C26 C N N 26 45D C27 C N N 27 45D C28 C N N 28 45D C29 C N N 29 45D C30 C N N 30 45D C31 C N N 31 45D C32 C N N 32 45D C33 C N N 33 45D C34 C N N 34 45D C35 C N N 35 45D C36 C N N 36 45D C37 C N N 37 45D C38 C N N 38 45D C39 C N N 39 45D C40 C N N 40 45D C41 C N N 41 45D C42 C N N 42 45D H052 H N N 43 45D H051 H N N 44 45D H062 H N N 45 45D H061 H N N 46 45D H092 H N N 47 45D H091 H N N 48 45D H102 H N N 49 45D H101 H N N 50 45D H113 H N N 51 45D H111 H N N 52 45D H112 H N N 53 45D H122 H N N 54 45D H123 H N N 55 45D H121 H N N 56 45D H131 H N N 57 45D H132 H N N 58 45D H133 H N N 59 45D H141 H N N 60 45D H143 H N N 61 45D H142 H N N 62 45D H191 H N N 63 45D H201 H N N 64 45D H212 H N N 65 45D H213 H N N 66 45D H211 H N N 67 45D H223 H N N 68 45D H222 H N N 69 45D H221 H N N 70 45D H231 H N N 71 45D H241 H N N 72 45D H273 H N N 73 45D H272 H N N 74 45D H271 H N N 75 45D H281 H N N 76 45D H282 H N N 77 45D H283 H N N 78 45D H291 H N N 79 45D H301 H N N 80 45D H311 H N N 81 45D H321 H N N 82 45D H331 H N N 83 45D H341 H N N 84 45D H371 H N N 85 45D H381 H N N 86 45D H393 H N N 87 45D H392 H N N 88 45D H391 H N N 89 45D H401 H N N 90 45D H402 H N N 91 45D H403 H N N 92 45D H411 H N N 93 45D H421 H N N 94 ALA N N N N 95 ALA CA C N S 96 ALA C C N N 97 ALA O O N N 98 ALA CB C N N 99 ALA OXT O N N 100 ALA H H N N 101 ALA H2 H N N 102 ALA HA H N N 103 ALA HB1 H N N 104 ALA HB2 H N N 105 ALA HB3 H N N 106 ALA HXT H N N 107 ARG N N N N 108 ARG CA C N S 109 ARG C C N N 110 ARG O O N N 111 ARG CB C N N 112 ARG CG C N N 113 ARG CD C N N 114 ARG NE N N N 115 ARG CZ C N N 116 ARG NH1 N N N 117 ARG NH2 N N N 118 ARG OXT O N N 119 ARG H H N N 120 ARG H2 H N N 121 ARG HA H N N 122 ARG HB2 H N N 123 ARG HB3 H N N 124 ARG HG2 H N N 125 ARG HG3 H N N 126 ARG HD2 H N N 127 ARG HD3 H N N 128 ARG HE H N N 129 ARG HH11 H N N 130 ARG HH12 H N N 131 ARG HH21 H N N 132 ARG HH22 H N N 133 ARG HXT H N N 134 ASN N N N N 135 ASN CA C N S 136 ASN C C N N 137 ASN O O N N 138 ASN CB C N N 139 ASN CG C N N 140 ASN OD1 O N N 141 ASN ND2 N N N 142 ASN OXT O N N 143 ASN H H N N 144 ASN H2 H N N 145 ASN HA H N N 146 ASN HB2 H N N 147 ASN HB3 H N N 148 ASN HD21 H N N 149 ASN HD22 H N N 150 ASN HXT H N N 151 ASP N N N N 152 ASP CA C N S 153 ASP C C N N 154 ASP O O N N 155 ASP CB C N N 156 ASP CG C N N 157 ASP OD1 O N N 158 ASP OD2 O N N 159 ASP OXT O N N 160 ASP H H N N 161 ASP H2 H N N 162 ASP HA H N N 163 ASP HB2 H N N 164 ASP HB3 H N N 165 ASP HD2 H N N 166 ASP HXT H N N 167 CYS N N N N 168 CYS CA C N R 169 CYS C C N N 170 CYS O O N N 171 CYS CB C N N 172 CYS SG S N N 173 CYS OXT O N N 174 CYS H H N N 175 CYS H2 H N N 176 CYS HA H N N 177 CYS HB2 H N N 178 CYS HB3 H N N 179 CYS HG H N N 180 CYS HXT H N N 181 GLN N N N N 182 GLN CA C N S 183 GLN C C N N 184 GLN O O N N 185 GLN CB C N N 186 GLN CG C N N 187 GLN CD C N N 188 GLN OE1 O N N 189 GLN NE2 N N N 190 GLN OXT O N N 191 GLN H H N N 192 GLN H2 H N N 193 GLN HA H N N 194 GLN HB2 H N N 195 GLN HB3 H N N 196 GLN HG2 H N N 197 GLN HG3 H N N 198 GLN HE21 H N N 199 GLN HE22 H N N 200 GLN HXT H N N 201 GLU N N N N 202 GLU CA C N S 203 GLU C C N N 204 GLU O O N N 205 GLU CB C N N 206 GLU CG C N N 207 GLU CD C N N 208 GLU OE1 O N N 209 GLU OE2 O N N 210 GLU OXT O N N 211 GLU H H N N 212 GLU H2 H N N 213 GLU HA H N N 214 GLU HB2 H N N 215 GLU HB3 H N N 216 GLU HG2 H N N 217 GLU HG3 H N N 218 GLU HE2 H N N 219 GLU HXT H N N 220 GLY N N N N 221 GLY CA C N N 222 GLY C C N N 223 GLY O O N N 224 GLY OXT O N N 225 GLY H H N N 226 GLY H2 H N N 227 GLY HA2 H N N 228 GLY HA3 H N N 229 GLY HXT H N N 230 HIS N N N N 231 HIS CA C N S 232 HIS C C N N 233 HIS O O N N 234 HIS CB C N N 235 HIS CG C Y N 236 HIS ND1 N Y N 237 HIS CD2 C Y N 238 HIS CE1 C Y N 239 HIS NE2 N Y N 240 HIS OXT O N N 241 HIS H H N N 242 HIS H2 H N N 243 HIS HA H N N 244 HIS HB2 H N N 245 HIS HB3 H N N 246 HIS HD1 H N N 247 HIS HD2 H N N 248 HIS HE1 H N N 249 HIS HE2 H N N 250 HIS HXT H N N 251 HOH O O N N 252 HOH H1 H N N 253 HOH H2 H N N 254 ILE N N N N 255 ILE CA C N S 256 ILE C C N N 257 ILE O O N N 258 ILE CB C N S 259 ILE CG1 C N N 260 ILE CG2 C N N 261 ILE CD1 C N N 262 ILE OXT O N N 263 ILE H H N N 264 ILE H2 H N N 265 ILE HA H N N 266 ILE HB H N N 267 ILE HG12 H N N 268 ILE HG13 H N N 269 ILE HG21 H N N 270 ILE HG22 H N N 271 ILE HG23 H N N 272 ILE HD11 H N N 273 ILE HD12 H N N 274 ILE HD13 H N N 275 ILE HXT H N N 276 LEU N N N N 277 LEU CA C N S 278 LEU C C N N 279 LEU O O N N 280 LEU CB C N N 281 LEU CG C N N 282 LEU CD1 C N N 283 LEU CD2 C N N 284 LEU OXT O N N 285 LEU H H N N 286 LEU H2 H N N 287 LEU HA H N N 288 LEU HB2 H N N 289 LEU HB3 H N N 290 LEU HG H N N 291 LEU HD11 H N N 292 LEU HD12 H N N 293 LEU HD13 H N N 294 LEU HD21 H N N 295 LEU HD22 H N N 296 LEU HD23 H N N 297 LEU HXT H N N 298 LYS N N N N 299 LYS CA C N S 300 LYS C C N N 301 LYS O O N N 302 LYS CB C N N 303 LYS CG C N N 304 LYS CD C N N 305 LYS CE C N N 306 LYS NZ N N N 307 LYS OXT O N N 308 LYS H H N N 309 LYS H2 H N N 310 LYS HA H N N 311 LYS HB2 H N N 312 LYS HB3 H N N 313 LYS HG2 H N N 314 LYS HG3 H N N 315 LYS HD2 H N N 316 LYS HD3 H N N 317 LYS HE2 H N N 318 LYS HE3 H N N 319 LYS HZ1 H N N 320 LYS HZ2 H N N 321 LYS HZ3 H N N 322 LYS HXT H N N 323 MET N N N N 324 MET CA C N S 325 MET C C N N 326 MET O O N N 327 MET CB C N N 328 MET CG C N N 329 MET SD S N N 330 MET CE C N N 331 MET OXT O N N 332 MET H H N N 333 MET H2 H N N 334 MET HA H N N 335 MET HB2 H N N 336 MET HB3 H N N 337 MET HG2 H N N 338 MET HG3 H N N 339 MET HE1 H N N 340 MET HE2 H N N 341 MET HE3 H N N 342 MET HXT H N N 343 PHE N N N N 344 PHE CA C N S 345 PHE C C N N 346 PHE O O N N 347 PHE CB C N N 348 PHE CG C Y N 349 PHE CD1 C Y N 350 PHE CD2 C Y N 351 PHE CE1 C Y N 352 PHE CE2 C Y N 353 PHE CZ C Y N 354 PHE OXT O N N 355 PHE H H N N 356 PHE H2 H N N 357 PHE HA H N N 358 PHE HB2 H N N 359 PHE HB3 H N N 360 PHE HD1 H N N 361 PHE HD2 H N N 362 PHE HE1 H N N 363 PHE HE2 H N N 364 PHE HZ H N N 365 PHE HXT H N N 366 PRO N N N N 367 PRO CA C N S 368 PRO C C N N 369 PRO O O N N 370 PRO CB C N N 371 PRO CG C N N 372 PRO CD C N N 373 PRO OXT O N N 374 PRO H H N N 375 PRO HA H N N 376 PRO HB2 H N N 377 PRO HB3 H N N 378 PRO HG2 H N N 379 PRO HG3 H N N 380 PRO HD2 H N N 381 PRO HD3 H N N 382 PRO HXT H N N 383 SER N N N N 384 SER CA C N S 385 SER C C N N 386 SER O O N N 387 SER CB C N N 388 SER OG O N N 389 SER OXT O N N 390 SER H H N N 391 SER H2 H N N 392 SER HA H N N 393 SER HB2 H N N 394 SER HB3 H N N 395 SER HG H N N 396 SER HXT H N N 397 THR N N N N 398 THR CA C N S 399 THR C C N N 400 THR O O N N 401 THR CB C N R 402 THR OG1 O N N 403 THR CG2 C N N 404 THR OXT O N N 405 THR H H N N 406 THR H2 H N N 407 THR HA H N N 408 THR HB H N N 409 THR HG1 H N N 410 THR HG21 H N N 411 THR HG22 H N N 412 THR HG23 H N N 413 THR HXT H N N 414 TRP N N N N 415 TRP CA C N S 416 TRP C C N N 417 TRP O O N N 418 TRP CB C N N 419 TRP CG C Y N 420 TRP CD1 C Y N 421 TRP CD2 C Y N 422 TRP NE1 N Y N 423 TRP CE2 C Y N 424 TRP CE3 C Y N 425 TRP CZ2 C Y N 426 TRP CZ3 C Y N 427 TRP CH2 C Y N 428 TRP OXT O N N 429 TRP H H N N 430 TRP H2 H N N 431 TRP HA H N N 432 TRP HB2 H N N 433 TRP HB3 H N N 434 TRP HD1 H N N 435 TRP HE1 H N N 436 TRP HE3 H N N 437 TRP HZ2 H N N 438 TRP HZ3 H N N 439 TRP HH2 H N N 440 TRP HXT H N N 441 TYR N N N N 442 TYR CA C N S 443 TYR C C N N 444 TYR O O N N 445 TYR CB C N N 446 TYR CG C Y N 447 TYR CD1 C Y N 448 TYR CD2 C Y N 449 TYR CE1 C Y N 450 TYR CE2 C Y N 451 TYR CZ C Y N 452 TYR OH O N N 453 TYR OXT O N N 454 TYR H H N N 455 TYR H2 H N N 456 TYR HA H N N 457 TYR HB2 H N N 458 TYR HB3 H N N 459 TYR HD1 H N N 460 TYR HD2 H N N 461 TYR HE1 H N N 462 TYR HE2 H N N 463 TYR HH H N N 464 TYR HXT H N N 465 VAL N N N N 466 VAL CA C N S 467 VAL C C N N 468 VAL O O N N 469 VAL CB C N N 470 VAL CG1 C N N 471 VAL CG2 C N N 472 VAL OXT O N N 473 VAL H H N N 474 VAL H2 H N N 475 VAL HA H N N 476 VAL HB H N N 477 VAL HG11 H N N 478 VAL HG12 H N N 479 VAL HG13 H N N 480 VAL HG21 H N N 481 VAL HG22 H N N 482 VAL HG23 H N N 483 VAL HXT H N N 484 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 45D O01 C17 doub N N 1 45D C17 C09 sing N N 2 45D C17 C15 sing N N 3 45D C21 C15 sing N N 4 45D C09 C05 sing N N 5 45D C15 C07 doub N N 6 45D C05 C03 sing N N 7 45D C07 C03 sing N N 8 45D C07 C19 sing N N 9 45D C03 C12 sing N N 10 45D C03 C11 sing N N 11 45D C19 C23 doub N E 12 45D C23 C25 sing N N 13 45D C25 C27 sing N N 14 45D C25 C29 doub N E 15 45D C29 C31 sing N N 16 45D C31 C33 doub N E 17 45D C33 C35 sing N N 18 45D C35 C37 doub N E 19 45D C35 C39 sing N N 20 45D C37 C41 sing N N 21 45D C41 C42 doub N E 22 45D C42 C38 sing N N 23 45D C40 C36 sing N N 24 45D C38 C36 doub N E 25 45D C36 C34 sing N N 26 45D C34 C32 doub N E 27 45D C32 C30 sing N N 28 45D C28 C26 sing N N 29 45D C30 C26 doub N E 30 45D C26 C24 sing N N 31 45D C24 C20 doub N E 32 45D C20 C08 sing N N 33 45D C14 C04 sing N N 34 45D C08 C04 sing N N 35 45D C08 C16 doub N N 36 45D C22 C16 sing N N 37 45D C13 C04 sing N N 38 45D C04 C06 sing N N 39 45D C16 C18 sing N N 40 45D C06 C10 sing N N 41 45D C18 C10 sing N N 42 45D C18 O02 doub N N 43 45D C05 H052 sing N N 44 45D C05 H051 sing N N 45 45D C06 H062 sing N N 46 45D C06 H061 sing N N 47 45D C09 H092 sing N N 48 45D C09 H091 sing N N 49 45D C10 H102 sing N N 50 45D C10 H101 sing N N 51 45D C11 H113 sing N N 52 45D C11 H111 sing N N 53 45D C11 H112 sing N N 54 45D C12 H122 sing N N 55 45D C12 H123 sing N N 56 45D C12 H121 sing N N 57 45D C13 H131 sing N N 58 45D C13 H132 sing N N 59 45D C13 H133 sing N N 60 45D C14 H141 sing N N 61 45D C14 H143 sing N N 62 45D C14 H142 sing N N 63 45D C19 H191 sing N N 64 45D C20 H201 sing N N 65 45D C21 H212 sing N N 66 45D C21 H213 sing N N 67 45D C21 H211 sing N N 68 45D C22 H223 sing N N 69 45D C22 H222 sing N N 70 45D C22 H221 sing N N 71 45D C23 H231 sing N N 72 45D C24 H241 sing N N 73 45D C27 H273 sing N N 74 45D C27 H272 sing N N 75 45D C27 H271 sing N N 76 45D C28 H281 sing N N 77 45D C28 H282 sing N N 78 45D C28 H283 sing N N 79 45D C29 H291 sing N N 80 45D C30 H301 sing N N 81 45D C31 H311 sing N N 82 45D C32 H321 sing N N 83 45D C33 H331 sing N N 84 45D C34 H341 sing N N 85 45D C37 H371 sing N N 86 45D C38 H381 sing N N 87 45D C39 H393 sing N N 88 45D C39 H392 sing N N 89 45D C39 H391 sing N N 90 45D C40 H401 sing N N 91 45D C40 H402 sing N N 92 45D C40 H403 sing N N 93 45D C41 H411 sing N N 94 45D C42 H421 sing N N 95 ALA N CA sing N N 96 ALA N H sing N N 97 ALA N H2 sing N N 98 ALA CA C sing N N 99 ALA CA CB sing N N 100 ALA CA HA sing N N 101 ALA C O doub N N 102 ALA C OXT sing N N 103 ALA CB HB1 sing N N 104 ALA CB HB2 sing N N 105 ALA CB HB3 sing N N 106 ALA OXT HXT sing N N 107 ARG N CA sing N N 108 ARG N H sing N N 109 ARG N H2 sing N N 110 ARG CA C sing N N 111 ARG CA CB sing N N 112 ARG CA HA sing N N 113 ARG C O doub N N 114 ARG C OXT sing N N 115 ARG CB CG sing N N 116 ARG CB HB2 sing N N 117 ARG CB HB3 sing N N 118 ARG CG CD sing N N 119 ARG CG HG2 sing N N 120 ARG CG HG3 sing N N 121 ARG CD NE sing N N 122 ARG CD HD2 sing N N 123 ARG CD HD3 sing N N 124 ARG NE CZ sing N N 125 ARG NE HE sing N N 126 ARG CZ NH1 sing N N 127 ARG CZ NH2 doub N N 128 ARG NH1 HH11 sing N N 129 ARG NH1 HH12 sing N N 130 ARG NH2 HH21 sing N N 131 ARG NH2 HH22 sing N N 132 ARG OXT HXT sing N N 133 ASN N CA sing N N 134 ASN N H sing N N 135 ASN N H2 sing N N 136 ASN CA C sing N N 137 ASN CA CB sing N N 138 ASN CA HA sing N N 139 ASN C O doub N N 140 ASN C OXT sing N N 141 ASN CB CG sing N N 142 ASN CB HB2 sing N N 143 ASN CB HB3 sing N N 144 ASN CG OD1 doub N N 145 ASN CG ND2 sing N N 146 ASN ND2 HD21 sing N N 147 ASN ND2 HD22 sing N N 148 ASN OXT HXT sing N N 149 ASP N CA sing N N 150 ASP N H sing N N 151 ASP N H2 sing N N 152 ASP CA C sing N N 153 ASP CA CB sing N N 154 ASP CA HA sing N N 155 ASP C O doub N N 156 ASP C OXT sing N N 157 ASP CB CG sing N N 158 ASP CB HB2 sing N N 159 ASP CB HB3 sing N N 160 ASP CG OD1 doub N N 161 ASP CG OD2 sing N N 162 ASP OD2 HD2 sing N N 163 ASP OXT HXT sing N N 164 CYS N CA sing N N 165 CYS N H sing N N 166 CYS N H2 sing N N 167 CYS CA C sing N N 168 CYS CA CB sing N N 169 CYS CA HA sing N N 170 CYS C O doub N N 171 CYS C OXT sing N N 172 CYS CB SG sing N N 173 CYS CB HB2 sing N N 174 CYS CB HB3 sing N N 175 CYS SG HG sing N N 176 CYS OXT HXT sing N N 177 GLN N CA sing N N 178 GLN N H sing N N 179 GLN N H2 sing N N 180 GLN CA C sing N N 181 GLN CA CB sing N N 182 GLN CA HA sing N N 183 GLN C O doub N N 184 GLN C OXT sing N N 185 GLN CB CG sing N N 186 GLN CB HB2 sing N N 187 GLN CB HB3 sing N N 188 GLN CG CD sing N N 189 GLN CG HG2 sing N N 190 GLN CG HG3 sing N N 191 GLN CD OE1 doub N N 192 GLN CD NE2 sing N N 193 GLN NE2 HE21 sing N N 194 GLN NE2 HE22 sing N N 195 GLN OXT HXT sing N N 196 GLU N CA sing N N 197 GLU N H sing N N 198 GLU N H2 sing N N 199 GLU CA C sing N N 200 GLU CA CB sing N N 201 GLU CA HA sing N N 202 GLU C O doub N N 203 GLU C OXT sing N N 204 GLU CB CG sing N N 205 GLU CB HB2 sing N N 206 GLU CB HB3 sing N N 207 GLU CG CD sing N N 208 GLU CG HG2 sing N N 209 GLU CG HG3 sing N N 210 GLU CD OE1 doub N N 211 GLU CD OE2 sing N N 212 GLU OE2 HE2 sing N N 213 GLU OXT HXT sing N N 214 GLY N CA sing N N 215 GLY N H sing N N 216 GLY N H2 sing N N 217 GLY CA C sing N N 218 GLY CA HA2 sing N N 219 GLY CA HA3 sing N N 220 GLY C O doub N N 221 GLY C OXT sing N N 222 GLY OXT HXT sing N N 223 HIS N CA sing N N 224 HIS N H sing N N 225 HIS N H2 sing N N 226 HIS CA C sing N N 227 HIS CA CB sing N N 228 HIS CA HA sing N N 229 HIS C O doub N N 230 HIS C OXT sing N N 231 HIS CB CG sing N N 232 HIS CB HB2 sing N N 233 HIS CB HB3 sing N N 234 HIS CG ND1 sing Y N 235 HIS CG CD2 doub Y N 236 HIS ND1 CE1 doub Y N 237 HIS ND1 HD1 sing N N 238 HIS CD2 NE2 sing Y N 239 HIS CD2 HD2 sing N N 240 HIS CE1 NE2 sing Y N 241 HIS CE1 HE1 sing N N 242 HIS NE2 HE2 sing N N 243 HIS OXT HXT sing N N 244 HOH O H1 sing N N 245 HOH O H2 sing N N 246 ILE N CA sing N N 247 ILE N H sing N N 248 ILE N H2 sing N N 249 ILE CA C sing N N 250 ILE CA CB sing N N 251 ILE CA HA sing N N 252 ILE C O doub N N 253 ILE C OXT sing N N 254 ILE CB CG1 sing N N 255 ILE CB CG2 sing N N 256 ILE CB HB sing N N 257 ILE CG1 CD1 sing N N 258 ILE CG1 HG12 sing N N 259 ILE CG1 HG13 sing N N 260 ILE CG2 HG21 sing N N 261 ILE CG2 HG22 sing N N 262 ILE CG2 HG23 sing N N 263 ILE CD1 HD11 sing N N 264 ILE CD1 HD12 sing N N 265 ILE CD1 HD13 sing N N 266 ILE OXT HXT sing N N 267 LEU N CA sing N N 268 LEU N H sing N N 269 LEU N H2 sing N N 270 LEU CA C sing N N 271 LEU CA CB sing N N 272 LEU CA HA sing N N 273 LEU C O doub N N 274 LEU C OXT sing N N 275 LEU CB CG sing N N 276 LEU CB HB2 sing N N 277 LEU CB HB3 sing N N 278 LEU CG CD1 sing N N 279 LEU CG CD2 sing N N 280 LEU CG HG sing N N 281 LEU CD1 HD11 sing N N 282 LEU CD1 HD12 sing N N 283 LEU CD1 HD13 sing N N 284 LEU CD2 HD21 sing N N 285 LEU CD2 HD22 sing N N 286 LEU CD2 HD23 sing N N 287 LEU OXT HXT sing N N 288 LYS N CA sing N N 289 LYS N H sing N N 290 LYS N H2 sing N N 291 LYS CA C sing N N 292 LYS CA CB sing N N 293 LYS CA HA sing N N 294 LYS C O doub N N 295 LYS C OXT sing N N 296 LYS CB CG sing N N 297 LYS CB HB2 sing N N 298 LYS CB HB3 sing N N 299 LYS CG CD sing N N 300 LYS CG HG2 sing N N 301 LYS CG HG3 sing N N 302 LYS CD CE sing N N 303 LYS CD HD2 sing N N 304 LYS CD HD3 sing N N 305 LYS CE NZ sing N N 306 LYS CE HE2 sing N N 307 LYS CE HE3 sing N N 308 LYS NZ HZ1 sing N N 309 LYS NZ HZ2 sing N N 310 LYS NZ HZ3 sing N N 311 LYS OXT HXT sing N N 312 MET N CA sing N N 313 MET N H sing N N 314 MET N H2 sing N N 315 MET CA C sing N N 316 MET CA CB sing N N 317 MET CA HA sing N N 318 MET C O doub N N 319 MET C OXT sing N N 320 MET CB CG sing N N 321 MET CB HB2 sing N N 322 MET CB HB3 sing N N 323 MET CG SD sing N N 324 MET CG HG2 sing N N 325 MET CG HG3 sing N N 326 MET SD CE sing N N 327 MET CE HE1 sing N N 328 MET CE HE2 sing N N 329 MET CE HE3 sing N N 330 MET OXT HXT sing N N 331 PHE N CA sing N N 332 PHE N H sing N N 333 PHE N H2 sing N N 334 PHE CA C sing N N 335 PHE CA CB sing N N 336 PHE CA HA sing N N 337 PHE C O doub N N 338 PHE C OXT sing N N 339 PHE CB CG sing N N 340 PHE CB HB2 sing N N 341 PHE CB HB3 sing N N 342 PHE CG CD1 doub Y N 343 PHE CG CD2 sing Y N 344 PHE CD1 CE1 sing Y N 345 PHE CD1 HD1 sing N N 346 PHE CD2 CE2 doub Y N 347 PHE CD2 HD2 sing N N 348 PHE CE1 CZ doub Y N 349 PHE CE1 HE1 sing N N 350 PHE CE2 CZ sing Y N 351 PHE CE2 HE2 sing N N 352 PHE CZ HZ sing N N 353 PHE OXT HXT sing N N 354 PRO N CA sing N N 355 PRO N CD sing N N 356 PRO N H sing N N 357 PRO CA C sing N N 358 PRO CA CB sing N N 359 PRO CA HA sing N N 360 PRO C O doub N N 361 PRO C OXT sing N N 362 PRO CB CG sing N N 363 PRO CB HB2 sing N N 364 PRO CB HB3 sing N N 365 PRO CG CD sing N N 366 PRO CG HG2 sing N N 367 PRO CG HG3 sing N N 368 PRO CD HD2 sing N N 369 PRO CD HD3 sing N N 370 PRO OXT HXT sing N N 371 SER N CA sing N N 372 SER N H sing N N 373 SER N H2 sing N N 374 SER CA C sing N N 375 SER CA CB sing N N 376 SER CA HA sing N N 377 SER C O doub N N 378 SER C OXT sing N N 379 SER CB OG sing N N 380 SER CB HB2 sing N N 381 SER CB HB3 sing N N 382 SER OG HG sing N N 383 SER OXT HXT sing N N 384 THR N CA sing N N 385 THR N H sing N N 386 THR N H2 sing N N 387 THR CA C sing N N 388 THR CA CB sing N N 389 THR CA HA sing N N 390 THR C O doub N N 391 THR C OXT sing N N 392 THR CB OG1 sing N N 393 THR CB CG2 sing N N 394 THR CB HB sing N N 395 THR OG1 HG1 sing N N 396 THR CG2 HG21 sing N N 397 THR CG2 HG22 sing N N 398 THR CG2 HG23 sing N N 399 THR OXT HXT sing N N 400 TRP N CA sing N N 401 TRP N H sing N N 402 TRP N H2 sing N N 403 TRP CA C sing N N 404 TRP CA CB sing N N 405 TRP CA HA sing N N 406 TRP C O doub N N 407 TRP C OXT sing N N 408 TRP CB CG sing N N 409 TRP CB HB2 sing N N 410 TRP CB HB3 sing N N 411 TRP CG CD1 doub Y N 412 TRP CG CD2 sing Y N 413 TRP CD1 NE1 sing Y N 414 TRP CD1 HD1 sing N N 415 TRP CD2 CE2 doub Y N 416 TRP CD2 CE3 sing Y N 417 TRP NE1 CE2 sing Y N 418 TRP NE1 HE1 sing N N 419 TRP CE2 CZ2 sing Y N 420 TRP CE3 CZ3 doub Y N 421 TRP CE3 HE3 sing N N 422 TRP CZ2 CH2 doub Y N 423 TRP CZ2 HZ2 sing N N 424 TRP CZ3 CH2 sing Y N 425 TRP CZ3 HZ3 sing N N 426 TRP CH2 HH2 sing N N 427 TRP OXT HXT sing N N 428 TYR N CA sing N N 429 TYR N H sing N N 430 TYR N H2 sing N N 431 TYR CA C sing N N 432 TYR CA CB sing N N 433 TYR CA HA sing N N 434 TYR C O doub N N 435 TYR C OXT sing N N 436 TYR CB CG sing N N 437 TYR CB HB2 sing N N 438 TYR CB HB3 sing N N 439 TYR CG CD1 doub Y N 440 TYR CG CD2 sing Y N 441 TYR CD1 CE1 sing Y N 442 TYR CD1 HD1 sing N N 443 TYR CD2 CE2 doub Y N 444 TYR CD2 HD2 sing N N 445 TYR CE1 CZ doub Y N 446 TYR CE1 HE1 sing N N 447 TYR CE2 CZ sing Y N 448 TYR CE2 HE2 sing N N 449 TYR CZ OH sing N N 450 TYR OH HH sing N N 451 TYR OXT HXT sing N N 452 VAL N CA sing N N 453 VAL N H sing N N 454 VAL N H2 sing N N 455 VAL CA C sing N N 456 VAL CA CB sing N N 457 VAL CA HA sing N N 458 VAL C O doub N N 459 VAL C OXT sing N N 460 VAL CB CG1 sing N N 461 VAL CB CG2 sing N N 462 VAL CB HB sing N N 463 VAL CG1 HG11 sing N N 464 VAL CG1 HG12 sing N N 465 VAL CG1 HG13 sing N N 466 VAL CG2 HG21 sing N N 467 VAL CG2 HG22 sing N N 468 VAL CG2 HG23 sing N N 469 VAL OXT HXT sing N N 470 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list 1 _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ;Monomer of Macrobrachium rosenbergii lipocalin (rMrLC) from the previously solved rMrLC-AXT-PE complex structure was used as the search model for molecular replacement. ; # _atom_sites.entry_id 9XIJ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.018149 _atom_sites.fract_transf_matrix[1][2] 0.010478 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020956 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007290 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #