data_9Y2G # _entry.id 9Y2G # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.413 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9Y2G pdb_00009y2g 10.2210/pdb9y2g/pdb WWPDB D_1000299736 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-04-29 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9Y2G _pdbx_database_status.recvd_initial_deposition_date 2025-09-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB '100K Alanine N-terminus' 9XZU unspecified PDB '140K Alanine N-terminus' 9Y00 unspecified PDB '180K Alanine N-terminus' 9Y0Y unspecified PDB '200K Alanine N-terminus' 9Y0Z unspecified PDB '220K Alanine N-terminus' 9Y11 unspecified PDB '240K Alanine N-terminus' 9Y1U unspecified PDB '260K Alanine N-terminus' 9Y28 unspecified PDB '280K Alanine N-terminus' 9Y29 unspecified PDB '100K formyl Methionine N-terminus' 9Y2E unspecified # _pdbx_contact_author.id 5 _pdbx_contact_author.email spjcramer@mac.com _pdbx_contact_author.name_first Stephen _pdbx_contact_author.name_last Cramer _pdbx_contact_author.name_mi P _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-3751-7623 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Doukov, T.' 1 0000-0001-8625-2572 'Cramer, S.P.J.' 2 0000-0002-3751-7623 'George, D.' 3 0009-0002-6548-2779 'Jenney, F.E.' 4 0000-0002-1667-6924 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country GE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Angew.Chem.Int.Ed.Engl. _citation.journal_id_ASTM ACIEAY _citation.journal_id_CSD 0179 _citation.journal_id_ISSN 1521-3773 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 65 _citation.language ? _citation.page_first e20302 _citation.page_last e20302 _citation.title 'Some Like It Hot -Structural Changes in Extremophile Rubredoxin at 120 °C.' _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/anie.202520302 _citation.pdbx_database_id_PubMed 41287388 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Doukov, T.' 1 0000-0001-8625-2572 primary 'Leontyev, I.' 2 0009-0005-7468-4569 primary 'Jenney Jr., F.E.' 3 ? primary 'George, D.' 4 0009-0002-6548-2779 primary 'Cramer, S.P.' 5 0000-0002-3751-7623 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Rubredoxin 6059.738 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 water nat water 18.015 51 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Rd # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code '(FME)AKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED' _entity_poly.pdbx_seq_one_letter_code_can MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 FME n 1 2 ALA n 1 3 LYS n 1 4 TRP n 1 5 VAL n 1 6 CYS n 1 7 LYS n 1 8 ILE n 1 9 CYS n 1 10 GLY n 1 11 TYR n 1 12 ILE n 1 13 TYR n 1 14 ASP n 1 15 GLU n 1 16 ASP n 1 17 ALA n 1 18 GLY n 1 19 ASP n 1 20 PRO n 1 21 ASP n 1 22 ASN n 1 23 GLY n 1 24 ILE n 1 25 SER n 1 26 PRO n 1 27 GLY n 1 28 THR n 1 29 LYS n 1 30 PHE n 1 31 GLU n 1 32 GLU n 1 33 LEU n 1 34 PRO n 1 35 ASP n 1 36 ASP n 1 37 TRP n 1 38 VAL n 1 39 CYS n 1 40 PRO n 1 41 ILE n 1 42 CYS n 1 43 GLY n 1 44 ALA n 1 45 PRO n 1 46 LYS n 1 47 SER n 1 48 GLU n 1 49 PHE n 1 50 GLU n 1 51 LYS n 1 52 LEU n 1 53 GLU n 1 54 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 54 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'rub, PF1282' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrococcus furiosus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2261 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia phage E20' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 3003230 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FME 'L-peptide linking' n N-FORMYLMETHIONINE ? 'C6 H11 N O3 S' 177.221 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 FME 1 1 1 FME FME A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 TRP 4 4 4 TRP TRP A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 CYS 9 9 9 CYS CYS A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 ASP 54 54 54 ASP ASP A . n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 FME ? ? FME ? ? 'SUBJECT OF INVESTIGATION' ? 2 ZN ? ? ZN ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 101 55 ZN ZN A . C 3 HOH 1 201 2 HOH HOH A . C 3 HOH 2 202 14 HOH HOH A . C 3 HOH 3 203 35 HOH HOH A . C 3 HOH 4 204 13 HOH HOH A . C 3 HOH 5 205 4 HOH HOH A . C 3 HOH 6 206 16 HOH HOH A . C 3 HOH 7 207 45 HOH HOH A . C 3 HOH 8 208 31 HOH HOH A . C 3 HOH 9 209 42 HOH HOH A . C 3 HOH 10 210 5 HOH HOH A . C 3 HOH 11 211 17 HOH HOH A . C 3 HOH 12 212 29 HOH HOH A . C 3 HOH 13 213 34 HOH HOH A . C 3 HOH 14 214 39 HOH HOH A . C 3 HOH 15 215 1 HOH HOH A . C 3 HOH 16 216 24 HOH HOH A . C 3 HOH 17 217 9 HOH HOH A . C 3 HOH 18 218 43 HOH HOH A . C 3 HOH 19 219 8 HOH HOH A . C 3 HOH 20 220 51 HOH HOH A . C 3 HOH 21 221 38 HOH HOH A . C 3 HOH 22 222 15 HOH HOH A . C 3 HOH 23 223 41 HOH HOH A . C 3 HOH 24 224 20 HOH HOH A . C 3 HOH 25 225 36 HOH HOH A . C 3 HOH 26 226 19 HOH HOH A . C 3 HOH 27 227 7 HOH HOH A . C 3 HOH 28 228 22 HOH HOH A . C 3 HOH 29 229 25 HOH HOH A . C 3 HOH 30 230 26 HOH HOH A . C 3 HOH 31 231 10 HOH HOH A . C 3 HOH 32 232 6 HOH HOH A . C 3 HOH 33 233 49 HOH HOH A . C 3 HOH 34 234 28 HOH HOH A . C 3 HOH 35 235 23 HOH HOH A . C 3 HOH 36 236 48 HOH HOH A . C 3 HOH 37 237 33 HOH HOH A . C 3 HOH 38 238 3 HOH HOH A . C 3 HOH 39 239 46 HOH HOH A . C 3 HOH 40 240 44 HOH HOH A . C 3 HOH 41 241 32 HOH HOH A . C 3 HOH 42 242 12 HOH HOH A . C 3 HOH 43 243 27 HOH HOH A . C 3 HOH 44 244 50 HOH HOH A . C 3 HOH 45 245 18 HOH HOH A . C 3 HOH 46 246 21 HOH HOH A . C 3 HOH 47 247 30 HOH HOH A . C 3 HOH 48 248 11 HOH HOH A . C 3 HOH 49 249 37 HOH HOH A . C 3 HOH 50 250 40 HOH HOH A . C 3 HOH 51 251 47 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0430 ? 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? . ? 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . ? 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . ? 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9Y2G _cell.details ? _cell.formula_units_Z ? _cell.length_a 34.133 _cell.length_a_esd ? _cell.length_b 34.687 _cell.length_b_esd ? _cell.length_c 43.725 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9Y2G _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9Y2G _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.21 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.41 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'VAPOR DIFFUSION AGAINST 3.1 M NaCl with 3.6M Na,K PHOSPHATE, pH 8.0' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 293 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2025-01-31 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97946 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL9-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97946 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL9-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate 21.67 _reflns.entry_id 9Y2G _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.140 _reflns.d_resolution_low 27.17 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14424 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 91.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.3 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.042 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.993 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.134 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.140 _reflns_shell.d_res_low 1.263 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.6 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 721 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.750 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.502 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 2.238 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -0.49 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.37 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] 0.12 _refine.B_iso_max ? _refine.B_iso_mean 18.782 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.977 _refine.correlation_coeff_Fo_to_Fc_free 0.969 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9Y2G _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.14 _refine.ls_d_res_low 27.17 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13728 _refine.ls_number_reflns_R_free 695 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 73.87 _refine.ls_percent_reflns_R_free 4.8 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.13789 _refine.ls_R_factor_R_free 0.15784 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.13687 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.039 _refine.pdbx_overall_ESU_R_Free 0.038 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 1.485 _refine.overall_SU_ML 0.029 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 1.14 _refine_hist.d_res_low 27.17 _refine_hist.number_atoms_solvent 51 _refine_hist.number_atoms_total 475 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 423 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 0.012 435 ? r_bond_refined_d ? ? ? 'X-RAY DIFFRACTION' ? 0.001 0.016 380 ? r_bond_other_d ? ? ? 'X-RAY DIFFRACTION' ? 1.845 1.806 587 ? r_angle_refined_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.631 1.785 897 ? r_angle_other_deg ? ? ? 'X-RAY DIFFRACTION' ? 6.225 5.000 52 ? r_dihedral_angle_1_deg ? ? ? 'X-RAY DIFFRACTION' ? 4.516 5.000 1 ? r_dihedral_angle_2_deg ? ? ? 'X-RAY DIFFRACTION' ? 10.083 10.000 67 ? r_dihedral_angle_3_deg ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_dihedral_angle_4_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.084 0.200 58 ? r_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.010 0.020 499 ? r_gen_planes_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 81 ? r_gen_planes_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? ? 'X-RAY DIFFRACTION' ? 6.041 1.956 215 ? r_mcbond_it ? ? ? 'X-RAY DIFFRACTION' ? 5.883 1.951 215 ? r_mcbond_other ? ? ? 'X-RAY DIFFRACTION' ? 8.330 4.364 264 ? r_mcangle_it ? ? ? 'X-RAY DIFFRACTION' ? 8.358 4.394 265 ? r_mcangle_other ? ? ? 'X-RAY DIFFRACTION' ? 12.357 2.966 220 ? r_scbond_it ? ? ? 'X-RAY DIFFRACTION' ? 11.847 2.916 219 ? r_scbond_other ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? ? 'X-RAY DIFFRACTION' ? 16.756 6.255 324 ? r_scangle_other ? ? ? 'X-RAY DIFFRACTION' ? 19.728 17.03 480 ? r_long_range_B_refined ? ? ? 'X-RAY DIFFRACTION' ? 19.534 16.35 475 ? r_long_range_B_other ? ? ? 'X-RAY DIFFRACTION' ? 4.471 3.000 815 ? r_rigid_bond_restr ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.140 _refine_ls_shell.d_res_low 1.170 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 1 _refine_ls_shell.number_reflns_R_work 23 _refine_ls_shell.percent_reflns_obs 1.71 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.346 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.correlation_coeff_Fo_to_Fc ? _refine_ls_shell.correlation_coeff_Fo_to_Fc_free ? _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work ? _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.076 # _struct.entry_id 9Y2G _struct.title 'Rubredoxin from Pyrococcus Furiosus at 293K, formyl-Methionine N-terminus' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9Y2G _struct_keywords.text 'IRON-SULFUR PROTEIN, ELECTRON TRANSPORT' _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RUBR_PYRFU _struct_ref.pdbx_db_accession P24297 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9Y2G _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 54 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P24297 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 54 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 54 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support homology _pdbx_struct_assembly_auth_evidence.details 'Many structures in the same space group' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 19 ? GLY A 23 ? ASP A 19 GLY A 23 5 ? 5 HELX_P HELX_P2 AA2 LYS A 29 ? LEU A 33 ? LYS A 29 LEU A 33 5 ? 5 HELX_P HELX_P3 AA3 PRO A 45 ? SER A 47 ? PRO A 45 SER A 47 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A FME 1 C ? ? ? 1_555 A ALA 2 N ? ? A FME 1 A ALA 2 1_555 ? ? ? ? ? ? ? 1.400 ? ? metalc1 metalc ? ? A CYS 6 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 6 A ZN 101 1_555 ? ? ? ? ? ? ? 2.349 ? ? metalc2 metalc ? ? A CYS 9 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 9 A ZN 101 1_555 ? ? ? ? ? ? ? 2.323 ? ? metalc3 metalc ? ? A CYS 39 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 39 A ZN 101 1_555 ? ? ? ? ? ? ? 2.347 ? ? metalc4 metalc ? ? A CYS 42 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 42 A ZN 101 1_555 ? ? ? ? ? ? ? 2.335 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 6 ? A CYS 6 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 9 ? A CYS 9 ? 1_555 112.4 ? 2 SG ? A CYS 6 ? A CYS 6 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 39 ? A CYS 39 ? 1_555 114.0 ? 3 SG ? A CYS 9 ? A CYS 9 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 39 ? A CYS 39 ? 1_555 101.9 ? 4 SG ? A CYS 6 ? A CYS 6 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 102.3 ? 5 SG ? A CYS 9 ? A CYS 9 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 115.0 ? 6 SG ? A CYS 39 ? A CYS 39 ? 1_555 ZN ? B ZN . ? A ZN 101 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 111.6 ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id FME _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 1 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id FME _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 1 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id MET _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id FME _pdbx_modification_feature.type Formylation _pdbx_modification_feature.category 'Named protein modification' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 12 ? ASP A 14 ? ILE A 12 ASP A 14 AA1 2 LYS A 3 ? CYS A 6 ? LYS A 3 CYS A 6 AA1 3 PHE A 49 ? LYS A 51 ? PHE A 49 LYS A 51 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O TYR A 13 ? O TYR A 13 N TRP A 4 ? N TRP A 4 AA1 2 3 N VAL A 5 ? N VAL A 5 O GLU A 50 ? O GLU A 50 # _pdbx_entry_details.entry_id 9Y2G _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id FME _pdbx_struct_mod_residue.label_seq_id 1 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id FME _pdbx_struct_mod_residue.auth_seq_id 1 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id MET _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 13.287 _pdbx_refine_tls.origin_y -1.927 _pdbx_refine_tls.origin_z -4.422 _pdbx_refine_tls.T[1][1] 0.0217 _pdbx_refine_tls.T[2][2] 0.0043 _pdbx_refine_tls.T[3][3] 0.0239 _pdbx_refine_tls.T[1][2] -0.0056 _pdbx_refine_tls.T[1][3] -0.0074 _pdbx_refine_tls.T[2][3] 0.0052 _pdbx_refine_tls.L[1][1] 3.8213 _pdbx_refine_tls.L[2][2] 4.9458 _pdbx_refine_tls.L[3][3] 2.5164 _pdbx_refine_tls.L[1][2] 1.8380 _pdbx_refine_tls.L[1][3] -0.7511 _pdbx_refine_tls.L[2][3] -1.2603 _pdbx_refine_tls.S[1][1] 0.0340 _pdbx_refine_tls.S[2][2] -0.1008 _pdbx_refine_tls.S[3][3] 0.0667 _pdbx_refine_tls.S[1][2] -0.0120 _pdbx_refine_tls.S[1][3] 0.2416 _pdbx_refine_tls.S[2][3] -0.0169 _pdbx_refine_tls.S[2][1] 0.1096 _pdbx_refine_tls.S[3][1] -0.2245 _pdbx_refine_tls.S[3][2] 0.0726 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 1 A 54 ? ? ? ? ? ? 'X-RAY DIFFRACTION' 2 1 A 101 A 101 ? ? ? ? ? ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 FME N N N N 61 FME CN C N N 62 FME O1 O N N 63 FME CA C N S 64 FME CB C N N 65 FME CG C N N 66 FME SD S N N 67 FME CE C N N 68 FME C C N N 69 FME O O N N 70 FME OXT O N N 71 FME H H N N 72 FME HCN H N N 73 FME HA H N N 74 FME HB2 H N N 75 FME HB3 H N N 76 FME HG2 H N N 77 FME HG3 H N N 78 FME HE1 H N N 79 FME HE2 H N N 80 FME HE3 H N N 81 FME HXT H N N 82 GLU N N N N 83 GLU CA C N S 84 GLU C C N N 85 GLU O O N N 86 GLU CB C N N 87 GLU CG C N N 88 GLU CD C N N 89 GLU OE1 O N N 90 GLU OE2 O N N 91 GLU OXT O N N 92 GLU H H N N 93 GLU H2 H N N 94 GLU HA H N N 95 GLU HB2 H N N 96 GLU HB3 H N N 97 GLU HG2 H N N 98 GLU HG3 H N N 99 GLU HE2 H N N 100 GLU HXT H N N 101 GLY N N N N 102 GLY CA C N N 103 GLY C C N N 104 GLY O O N N 105 GLY OXT O N N 106 GLY H H N N 107 GLY H2 H N N 108 GLY HA2 H N N 109 GLY HA3 H N N 110 GLY HXT H N N 111 HOH O O N N 112 HOH H1 H N N 113 HOH H2 H N N 114 ILE N N N N 115 ILE CA C N S 116 ILE C C N N 117 ILE O O N N 118 ILE CB C N S 119 ILE CG1 C N N 120 ILE CG2 C N N 121 ILE CD1 C N N 122 ILE OXT O N N 123 ILE H H N N 124 ILE H2 H N N 125 ILE HA H N N 126 ILE HB H N N 127 ILE HG12 H N N 128 ILE HG13 H N N 129 ILE HG21 H N N 130 ILE HG22 H N N 131 ILE HG23 H N N 132 ILE HD11 H N N 133 ILE HD12 H N N 134 ILE HD13 H N N 135 ILE HXT H N N 136 LEU N N N N 137 LEU CA C N S 138 LEU C C N N 139 LEU O O N N 140 LEU CB C N N 141 LEU CG C N N 142 LEU CD1 C N N 143 LEU CD2 C N N 144 LEU OXT O N N 145 LEU H H N N 146 LEU H2 H N N 147 LEU HA H N N 148 LEU HB2 H N N 149 LEU HB3 H N N 150 LEU HG H N N 151 LEU HD11 H N N 152 LEU HD12 H N N 153 LEU HD13 H N N 154 LEU HD21 H N N 155 LEU HD22 H N N 156 LEU HD23 H N N 157 LEU HXT H N N 158 LYS N N N N 159 LYS CA C N S 160 LYS C C N N 161 LYS O O N N 162 LYS CB C N N 163 LYS CG C N N 164 LYS CD C N N 165 LYS CE C N N 166 LYS NZ N N N 167 LYS OXT O N N 168 LYS H H N N 169 LYS H2 H N N 170 LYS HA H N N 171 LYS HB2 H N N 172 LYS HB3 H N N 173 LYS HG2 H N N 174 LYS HG3 H N N 175 LYS HD2 H N N 176 LYS HD3 H N N 177 LYS HE2 H N N 178 LYS HE3 H N N 179 LYS HZ1 H N N 180 LYS HZ2 H N N 181 LYS HZ3 H N N 182 LYS HXT H N N 183 PHE N N N N 184 PHE CA C N S 185 PHE C C N N 186 PHE O O N N 187 PHE CB C N N 188 PHE CG C Y N 189 PHE CD1 C Y N 190 PHE CD2 C Y N 191 PHE CE1 C Y N 192 PHE CE2 C Y N 193 PHE CZ C Y N 194 PHE OXT O N N 195 PHE H H N N 196 PHE H2 H N N 197 PHE HA H N N 198 PHE HB2 H N N 199 PHE HB3 H N N 200 PHE HD1 H N N 201 PHE HD2 H N N 202 PHE HE1 H N N 203 PHE HE2 H N N 204 PHE HZ H N N 205 PHE HXT H N N 206 PRO N N N N 207 PRO CA C N S 208 PRO C C N N 209 PRO O O N N 210 PRO CB C N N 211 PRO CG C N N 212 PRO CD C N N 213 PRO OXT O N N 214 PRO H H N N 215 PRO HA H N N 216 PRO HB2 H N N 217 PRO HB3 H N N 218 PRO HG2 H N N 219 PRO HG3 H N N 220 PRO HD2 H N N 221 PRO HD3 H N N 222 PRO HXT H N N 223 SER N N N N 224 SER CA C N S 225 SER C C N N 226 SER O O N N 227 SER CB C N N 228 SER OG O N N 229 SER OXT O N N 230 SER H H N N 231 SER H2 H N N 232 SER HA H N N 233 SER HB2 H N N 234 SER HB3 H N N 235 SER HG H N N 236 SER HXT H N N 237 THR N N N N 238 THR CA C N S 239 THR C C N N 240 THR O O N N 241 THR CB C N R 242 THR OG1 O N N 243 THR CG2 C N N 244 THR OXT O N N 245 THR H H N N 246 THR H2 H N N 247 THR HA H N N 248 THR HB H N N 249 THR HG1 H N N 250 THR HG21 H N N 251 THR HG22 H N N 252 THR HG23 H N N 253 THR HXT H N N 254 TRP N N N N 255 TRP CA C N S 256 TRP C C N N 257 TRP O O N N 258 TRP CB C N N 259 TRP CG C Y N 260 TRP CD1 C Y N 261 TRP CD2 C Y N 262 TRP NE1 N Y N 263 TRP CE2 C Y N 264 TRP CE3 C Y N 265 TRP CZ2 C Y N 266 TRP CZ3 C Y N 267 TRP CH2 C Y N 268 TRP OXT O N N 269 TRP H H N N 270 TRP H2 H N N 271 TRP HA H N N 272 TRP HB2 H N N 273 TRP HB3 H N N 274 TRP HD1 H N N 275 TRP HE1 H N N 276 TRP HE3 H N N 277 TRP HZ2 H N N 278 TRP HZ3 H N N 279 TRP HH2 H N N 280 TRP HXT H N N 281 TYR N N N N 282 TYR CA C N S 283 TYR C C N N 284 TYR O O N N 285 TYR CB C N N 286 TYR CG C Y N 287 TYR CD1 C Y N 288 TYR CD2 C Y N 289 TYR CE1 C Y N 290 TYR CE2 C Y N 291 TYR CZ C Y N 292 TYR OH O N N 293 TYR OXT O N N 294 TYR H H N N 295 TYR H2 H N N 296 TYR HA H N N 297 TYR HB2 H N N 298 TYR HB3 H N N 299 TYR HD1 H N N 300 TYR HD2 H N N 301 TYR HE1 H N N 302 TYR HE2 H N N 303 TYR HH H N N 304 TYR HXT H N N 305 VAL N N N N 306 VAL CA C N S 307 VAL C C N N 308 VAL O O N N 309 VAL CB C N N 310 VAL CG1 C N N 311 VAL CG2 C N N 312 VAL OXT O N N 313 VAL H H N N 314 VAL H2 H N N 315 VAL HA H N N 316 VAL HB H N N 317 VAL HG11 H N N 318 VAL HG12 H N N 319 VAL HG13 H N N 320 VAL HG21 H N N 321 VAL HG22 H N N 322 VAL HG23 H N N 323 VAL HXT H N N 324 ZN ZN ZN N N 325 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 FME N CN sing N N 57 FME N CA sing N N 58 FME N H sing N N 59 FME CN O1 doub N N 60 FME CN HCN sing N N 61 FME CA CB sing N N 62 FME CA C sing N N 63 FME CA HA sing N N 64 FME CB CG sing N N 65 FME CB HB2 sing N N 66 FME CB HB3 sing N N 67 FME CG SD sing N N 68 FME CG HG2 sing N N 69 FME CG HG3 sing N N 70 FME SD CE sing N N 71 FME CE HE1 sing N N 72 FME CE HE2 sing N N 73 FME CE HE3 sing N N 74 FME C O doub N N 75 FME C OXT sing N N 76 FME OXT HXT sing N N 77 GLU N CA sing N N 78 GLU N H sing N N 79 GLU N H2 sing N N 80 GLU CA C sing N N 81 GLU CA CB sing N N 82 GLU CA HA sing N N 83 GLU C O doub N N 84 GLU C OXT sing N N 85 GLU CB CG sing N N 86 GLU CB HB2 sing N N 87 GLU CB HB3 sing N N 88 GLU CG CD sing N N 89 GLU CG HG2 sing N N 90 GLU CG HG3 sing N N 91 GLU CD OE1 doub N N 92 GLU CD OE2 sing N N 93 GLU OE2 HE2 sing N N 94 GLU OXT HXT sing N N 95 GLY N CA sing N N 96 GLY N H sing N N 97 GLY N H2 sing N N 98 GLY CA C sing N N 99 GLY CA HA2 sing N N 100 GLY CA HA3 sing N N 101 GLY C O doub N N 102 GLY C OXT sing N N 103 GLY OXT HXT sing N N 104 HOH O H1 sing N N 105 HOH O H2 sing N N 106 ILE N CA sing N N 107 ILE N H sing N N 108 ILE N H2 sing N N 109 ILE CA C sing N N 110 ILE CA CB sing N N 111 ILE CA HA sing N N 112 ILE C O doub N N 113 ILE C OXT sing N N 114 ILE CB CG1 sing N N 115 ILE CB CG2 sing N N 116 ILE CB HB sing N N 117 ILE CG1 CD1 sing N N 118 ILE CG1 HG12 sing N N 119 ILE CG1 HG13 sing N N 120 ILE CG2 HG21 sing N N 121 ILE CG2 HG22 sing N N 122 ILE CG2 HG23 sing N N 123 ILE CD1 HD11 sing N N 124 ILE CD1 HD12 sing N N 125 ILE CD1 HD13 sing N N 126 ILE OXT HXT sing N N 127 LEU N CA sing N N 128 LEU N H sing N N 129 LEU N H2 sing N N 130 LEU CA C sing N N 131 LEU CA CB sing N N 132 LEU CA HA sing N N 133 LEU C O doub N N 134 LEU C OXT sing N N 135 LEU CB CG sing N N 136 LEU CB HB2 sing N N 137 LEU CB HB3 sing N N 138 LEU CG CD1 sing N N 139 LEU CG CD2 sing N N 140 LEU CG HG sing N N 141 LEU CD1 HD11 sing N N 142 LEU CD1 HD12 sing N N 143 LEU CD1 HD13 sing N N 144 LEU CD2 HD21 sing N N 145 LEU CD2 HD22 sing N N 146 LEU CD2 HD23 sing N N 147 LEU OXT HXT sing N N 148 LYS N CA sing N N 149 LYS N H sing N N 150 LYS N H2 sing N N 151 LYS CA C sing N N 152 LYS CA CB sing N N 153 LYS CA HA sing N N 154 LYS C O doub N N 155 LYS C OXT sing N N 156 LYS CB CG sing N N 157 LYS CB HB2 sing N N 158 LYS CB HB3 sing N N 159 LYS CG CD sing N N 160 LYS CG HG2 sing N N 161 LYS CG HG3 sing N N 162 LYS CD CE sing N N 163 LYS CD HD2 sing N N 164 LYS CD HD3 sing N N 165 LYS CE NZ sing N N 166 LYS CE HE2 sing N N 167 LYS CE HE3 sing N N 168 LYS NZ HZ1 sing N N 169 LYS NZ HZ2 sing N N 170 LYS NZ HZ3 sing N N 171 LYS OXT HXT sing N N 172 PHE N CA sing N N 173 PHE N H sing N N 174 PHE N H2 sing N N 175 PHE CA C sing N N 176 PHE CA CB sing N N 177 PHE CA HA sing N N 178 PHE C O doub N N 179 PHE C OXT sing N N 180 PHE CB CG sing N N 181 PHE CB HB2 sing N N 182 PHE CB HB3 sing N N 183 PHE CG CD1 doub Y N 184 PHE CG CD2 sing Y N 185 PHE CD1 CE1 sing Y N 186 PHE CD1 HD1 sing N N 187 PHE CD2 CE2 doub Y N 188 PHE CD2 HD2 sing N N 189 PHE CE1 CZ doub Y N 190 PHE CE1 HE1 sing N N 191 PHE CE2 CZ sing Y N 192 PHE CE2 HE2 sing N N 193 PHE CZ HZ sing N N 194 PHE OXT HXT sing N N 195 PRO N CA sing N N 196 PRO N CD sing N N 197 PRO N H sing N N 198 PRO CA C sing N N 199 PRO CA CB sing N N 200 PRO CA HA sing N N 201 PRO C O doub N N 202 PRO C OXT sing N N 203 PRO CB CG sing N N 204 PRO CB HB2 sing N N 205 PRO CB HB3 sing N N 206 PRO CG CD sing N N 207 PRO CG HG2 sing N N 208 PRO CG HG3 sing N N 209 PRO CD HD2 sing N N 210 PRO CD HD3 sing N N 211 PRO OXT HXT sing N N 212 SER N CA sing N N 213 SER N H sing N N 214 SER N H2 sing N N 215 SER CA C sing N N 216 SER CA CB sing N N 217 SER CA HA sing N N 218 SER C O doub N N 219 SER C OXT sing N N 220 SER CB OG sing N N 221 SER CB HB2 sing N N 222 SER CB HB3 sing N N 223 SER OG HG sing N N 224 SER OXT HXT sing N N 225 THR N CA sing N N 226 THR N H sing N N 227 THR N H2 sing N N 228 THR CA C sing N N 229 THR CA CB sing N N 230 THR CA HA sing N N 231 THR C O doub N N 232 THR C OXT sing N N 233 THR CB OG1 sing N N 234 THR CB CG2 sing N N 235 THR CB HB sing N N 236 THR OG1 HG1 sing N N 237 THR CG2 HG21 sing N N 238 THR CG2 HG22 sing N N 239 THR CG2 HG23 sing N N 240 THR OXT HXT sing N N 241 TRP N CA sing N N 242 TRP N H sing N N 243 TRP N H2 sing N N 244 TRP CA C sing N N 245 TRP CA CB sing N N 246 TRP CA HA sing N N 247 TRP C O doub N N 248 TRP C OXT sing N N 249 TRP CB CG sing N N 250 TRP CB HB2 sing N N 251 TRP CB HB3 sing N N 252 TRP CG CD1 doub Y N 253 TRP CG CD2 sing Y N 254 TRP CD1 NE1 sing Y N 255 TRP CD1 HD1 sing N N 256 TRP CD2 CE2 doub Y N 257 TRP CD2 CE3 sing Y N 258 TRP NE1 CE2 sing Y N 259 TRP NE1 HE1 sing N N 260 TRP CE2 CZ2 sing Y N 261 TRP CE3 CZ3 doub Y N 262 TRP CE3 HE3 sing N N 263 TRP CZ2 CH2 doub Y N 264 TRP CZ2 HZ2 sing N N 265 TRP CZ3 CH2 sing Y N 266 TRP CZ3 HZ3 sing N N 267 TRP CH2 HH2 sing N N 268 TRP OXT HXT sing N N 269 TYR N CA sing N N 270 TYR N H sing N N 271 TYR N H2 sing N N 272 TYR CA C sing N N 273 TYR CA CB sing N N 274 TYR CA HA sing N N 275 TYR C O doub N N 276 TYR C OXT sing N N 277 TYR CB CG sing N N 278 TYR CB HB2 sing N N 279 TYR CB HB3 sing N N 280 TYR CG CD1 doub Y N 281 TYR CG CD2 sing Y N 282 TYR CD1 CE1 sing Y N 283 TYR CD1 HD1 sing N N 284 TYR CD2 CE2 doub Y N 285 TYR CD2 HD2 sing N N 286 TYR CE1 CZ doub Y N 287 TYR CE1 HE1 sing N N 288 TYR CE2 CZ sing Y N 289 TYR CE2 HE2 sing N N 290 TYR CZ OH sing N N 291 TYR OH HH sing N N 292 TYR OXT HXT sing N N 293 VAL N CA sing N N 294 VAL N H sing N N 295 VAL N H2 sing N N 296 VAL CA C sing N N 297 VAL CA CB sing N N 298 VAL CA HA sing N N 299 VAL C O doub N N 300 VAL C OXT sing N N 301 VAL CB CG1 sing N N 302 VAL CB CG2 sing N N 303 VAL CB HB sing N N 304 VAL CG1 HG11 sing N N 305 VAL CG1 HG12 sing N N 306 VAL CG1 HG13 sing N N 307 VAL CG2 HG21 sing N N 308 VAL CG2 HG22 sing N N 309 VAL CG2 HG23 sing N N 310 VAL OXT HXT sing N N 311 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Science Foundation (NSF, United States)' 'United States' MCB-2149122 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM-65440 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 9Y2E _pdbx_initial_refinement_model.details '100K formyl methionine N-terminus' # _atom_sites.entry_id 9Y2G _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.029297 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.028829 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.022870 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S ZN # loop_ # loop_ #