data_9Y5F # _entry.id 9Y5F # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.414 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9Y5F pdb_00009y5f 10.2210/pdb9y5f/pdb WWPDB D_1000299571 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-05-13 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9Y5F _pdbx_database_status.recvd_initial_deposition_date 2025-09-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email neilking@uw.edu _pdbx_contact_author.name_first Neil _pdbx_contact_author.name_last King _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-2978-4692 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bera, A.K.' 1 ? 'Somiya, M.' 2 ? 'King, N.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Computational design of two-component membrane fusion proteins' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Somiya, M.' 1 ? primary 'Bera, A.K.' 2 ? primary 'King, N.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man rv-SNARE/sc-t 8671.671 1 ? ? ? ? 2 polymer man sc-t-SNARE-5.s.8 28983.945 1 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no MSSSSNEKLRETLREVEDVKNIMEDNRRLVERQGRQIDRLEEKADDLERSAERLSDNSEKLKRKYWWKNSK MSSSSNEKLRETLREVEDVKNIMEDNRRLVERQGRQIDRLEEKADDLERSAERLSDNSEKLKRKYWWKNSK A ? 2 'polypeptide(L)' no no ;SGGSSSEREKEIDEGLDRVSEIVKELKKMAEEMRRMIEEQGRRIERIEEKAEEAKEKIEEANERAEKLLKDPGGSGGSEE LKKLEKEGEKLKELVEELDREIKELKEGMERLREMFEEAAKLSEEALEIMRRTRKLSEEELEEAKQKAKEQEKEKALKEK GGSGGSGGSEKVKRELAQIEERHQQILELEEKIKELLEMFKELSEKIEEQGQKIDRIEDKVSKAKEHVEKGVEDTKKAVK YQSKARRKK ; ;SGGSSSEREKEIDEGLDRVSEIVKELKKMAEEMRRMIEEQGRRIERIEEKAEEAKEKIEEANERAEKLLKDPGGSGGSEE LKKLEKEGEKLKELVEELDREIKELKEGMERLREMFEEAAKLSEEALEIMRRTRKLSEEELEEAKQKAKEQEKEKALKEK GGSGGSGGSEKVKRELAQIEERHQQILELEEKIKELLEMFKELSEKIEEQGQKIDRIEDKVSKAKEHVEKGVEDTKKAVK YQSKARRKK ; B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 SER n 1 4 SER n 1 5 SER n 1 6 ASN n 1 7 GLU n 1 8 LYS n 1 9 LEU n 1 10 ARG n 1 11 GLU n 1 12 THR n 1 13 LEU n 1 14 ARG n 1 15 GLU n 1 16 VAL n 1 17 GLU n 1 18 ASP n 1 19 VAL n 1 20 LYS n 1 21 ASN n 1 22 ILE n 1 23 MET n 1 24 GLU n 1 25 ASP n 1 26 ASN n 1 27 ARG n 1 28 ARG n 1 29 LEU n 1 30 VAL n 1 31 GLU n 1 32 ARG n 1 33 GLN n 1 34 GLY n 1 35 ARG n 1 36 GLN n 1 37 ILE n 1 38 ASP n 1 39 ARG n 1 40 LEU n 1 41 GLU n 1 42 GLU n 1 43 LYS n 1 44 ALA n 1 45 ASP n 1 46 ASP n 1 47 LEU n 1 48 GLU n 1 49 ARG n 1 50 SER n 1 51 ALA n 1 52 GLU n 1 53 ARG n 1 54 LEU n 1 55 SER n 1 56 ASP n 1 57 ASN n 1 58 SER n 1 59 GLU n 1 60 LYS n 1 61 LEU n 1 62 LYS n 1 63 ARG n 1 64 LYS n 1 65 TYR n 1 66 TRP n 1 67 TRP n 1 68 LYS n 1 69 ASN n 1 70 SER n 1 71 LYS n 2 1 SER n 2 2 GLY n 2 3 GLY n 2 4 SER n 2 5 SER n 2 6 SER n 2 7 GLU n 2 8 ARG n 2 9 GLU n 2 10 LYS n 2 11 GLU n 2 12 ILE n 2 13 ASP n 2 14 GLU n 2 15 GLY n 2 16 LEU n 2 17 ASP n 2 18 ARG n 2 19 VAL n 2 20 SER n 2 21 GLU n 2 22 ILE n 2 23 VAL n 2 24 LYS n 2 25 GLU n 2 26 LEU n 2 27 LYS n 2 28 LYS n 2 29 MET n 2 30 ALA n 2 31 GLU n 2 32 GLU n 2 33 MET n 2 34 ARG n 2 35 ARG n 2 36 MET n 2 37 ILE n 2 38 GLU n 2 39 GLU n 2 40 GLN n 2 41 GLY n 2 42 ARG n 2 43 ARG n 2 44 ILE n 2 45 GLU n 2 46 ARG n 2 47 ILE n 2 48 GLU n 2 49 GLU n 2 50 LYS n 2 51 ALA n 2 52 GLU n 2 53 GLU n 2 54 ALA n 2 55 LYS n 2 56 GLU n 2 57 LYS n 2 58 ILE n 2 59 GLU n 2 60 GLU n 2 61 ALA n 2 62 ASN n 2 63 GLU n 2 64 ARG n 2 65 ALA n 2 66 GLU n 2 67 LYS n 2 68 LEU n 2 69 LEU n 2 70 LYS n 2 71 ASP n 2 72 PRO n 2 73 GLY n 2 74 GLY n 2 75 SER n 2 76 GLY n 2 77 GLY n 2 78 SER n 2 79 GLU n 2 80 GLU n 2 81 LEU n 2 82 LYS n 2 83 LYS n 2 84 LEU n 2 85 GLU n 2 86 LYS n 2 87 GLU n 2 88 GLY n 2 89 GLU n 2 90 LYS n 2 91 LEU n 2 92 LYS n 2 93 GLU n 2 94 LEU n 2 95 VAL n 2 96 GLU n 2 97 GLU n 2 98 LEU n 2 99 ASP n 2 100 ARG n 2 101 GLU n 2 102 ILE n 2 103 LYS n 2 104 GLU n 2 105 LEU n 2 106 LYS n 2 107 GLU n 2 108 GLY n 2 109 MET n 2 110 GLU n 2 111 ARG n 2 112 LEU n 2 113 ARG n 2 114 GLU n 2 115 MET n 2 116 PHE n 2 117 GLU n 2 118 GLU n 2 119 ALA n 2 120 ALA n 2 121 LYS n 2 122 LEU n 2 123 SER n 2 124 GLU n 2 125 GLU n 2 126 ALA n 2 127 LEU n 2 128 GLU n 2 129 ILE n 2 130 MET n 2 131 ARG n 2 132 ARG n 2 133 THR n 2 134 ARG n 2 135 LYS n 2 136 LEU n 2 137 SER n 2 138 GLU n 2 139 GLU n 2 140 GLU n 2 141 LEU n 2 142 GLU n 2 143 GLU n 2 144 ALA n 2 145 LYS n 2 146 GLN n 2 147 LYS n 2 148 ALA n 2 149 LYS n 2 150 GLU n 2 151 GLN n 2 152 GLU n 2 153 LYS n 2 154 GLU n 2 155 LYS n 2 156 ALA n 2 157 LEU n 2 158 LYS n 2 159 GLU n 2 160 LYS n 2 161 GLY n 2 162 GLY n 2 163 SER n 2 164 GLY n 2 165 GLY n 2 166 SER n 2 167 GLY n 2 168 GLY n 2 169 SER n 2 170 GLU n 2 171 LYS n 2 172 VAL n 2 173 LYS n 2 174 ARG n 2 175 GLU n 2 176 LEU n 2 177 ALA n 2 178 GLN n 2 179 ILE n 2 180 GLU n 2 181 GLU n 2 182 ARG n 2 183 HIS n 2 184 GLN n 2 185 GLN n 2 186 ILE n 2 187 LEU n 2 188 GLU n 2 189 LEU n 2 190 GLU n 2 191 GLU n 2 192 LYS n 2 193 ILE n 2 194 LYS n 2 195 GLU n 2 196 LEU n 2 197 LEU n 2 198 GLU n 2 199 MET n 2 200 PHE n 2 201 LYS n 2 202 GLU n 2 203 LEU n 2 204 SER n 2 205 GLU n 2 206 LYS n 2 207 ILE n 2 208 GLU n 2 209 GLU n 2 210 GLN n 2 211 GLY n 2 212 GLN n 2 213 LYS n 2 214 ILE n 2 215 ASP n 2 216 ARG n 2 217 ILE n 2 218 GLU n 2 219 ASP n 2 220 LYS n 2 221 VAL n 2 222 SER n 2 223 LYS n 2 224 ALA n 2 225 LYS n 2 226 GLU n 2 227 HIS n 2 228 VAL n 2 229 GLU n 2 230 LYS n 2 231 GLY n 2 232 VAL n 2 233 GLU n 2 234 ASP n 2 235 THR n 2 236 LYS n 2 237 LYS n 2 238 ALA n 2 239 VAL n 2 240 LYS n 2 241 TYR n 2 242 GLN n 2 243 SER n 2 244 LYS n 2 245 ALA n 2 246 ARG n 2 247 ARG n 2 248 LYS n 2 249 LYS n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 71 ? ? ? ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 249 ? ? ? ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 0 MET MET A . n A 1 2 SER 2 1 1 SER SER A . n A 1 3 SER 3 2 2 SER SER A . n A 1 4 SER 4 3 3 SER SER A . n A 1 5 SER 5 4 4 SER SER A . n A 1 6 ASN 6 5 5 ASN ASN A . n A 1 7 GLU 7 6 6 GLU GLU A . n A 1 8 LYS 8 7 7 LYS LYS A . n A 1 9 LEU 9 8 8 LEU LEU A . n A 1 10 ARG 10 9 9 ARG ARG A . n A 1 11 GLU 11 10 10 GLU GLU A . n A 1 12 THR 12 11 11 THR THR A . n A 1 13 LEU 13 12 12 LEU LEU A . n A 1 14 ARG 14 13 13 ARG ARG A . n A 1 15 GLU 15 14 14 GLU GLU A . n A 1 16 VAL 16 15 15 VAL VAL A . n A 1 17 GLU 17 16 16 GLU GLU A . n A 1 18 ASP 18 17 17 ASP ASP A . n A 1 19 VAL 19 18 18 VAL VAL A . n A 1 20 LYS 20 19 19 LYS LYS A . n A 1 21 ASN 21 20 20 ASN ASN A . n A 1 22 ILE 22 21 21 ILE ILE A . n A 1 23 MET 23 22 22 MET MET A . n A 1 24 GLU 24 23 23 GLU GLU A . n A 1 25 ASP 25 24 24 ASP ASP A . n A 1 26 ASN 26 25 25 ASN ASN A . n A 1 27 ARG 27 26 26 ARG ARG A . n A 1 28 ARG 28 27 27 ARG ARG A . n A 1 29 LEU 29 28 28 LEU LEU A . n A 1 30 VAL 30 29 29 VAL VAL A . n A 1 31 GLU 31 30 30 GLU GLU A . n A 1 32 ARG 32 31 31 ARG ARG A . n A 1 33 GLN 33 32 32 GLN GLN A . n A 1 34 GLY 34 33 33 GLY GLY A . n A 1 35 ARG 35 34 34 ARG ARG A . n A 1 36 GLN 36 35 35 GLN GLN A . n A 1 37 ILE 37 36 36 ILE ILE A . n A 1 38 ASP 38 37 37 ASP ASP A . n A 1 39 ARG 39 38 38 ARG ARG A . n A 1 40 LEU 40 39 39 LEU LEU A . n A 1 41 GLU 41 40 40 GLU GLU A . n A 1 42 GLU 42 41 41 GLU GLU A . n A 1 43 LYS 43 42 42 LYS LYS A . n A 1 44 ALA 44 43 43 ALA ALA A . n A 1 45 ASP 45 44 44 ASP ASP A . n A 1 46 ASP 46 45 45 ASP ASP A . n A 1 47 LEU 47 46 46 LEU LEU A . n A 1 48 GLU 48 47 47 GLU GLU A . n A 1 49 ARG 49 48 48 ARG ARG A . n A 1 50 SER 50 49 49 SER SER A . n A 1 51 ALA 51 50 50 ALA ALA A . n A 1 52 GLU 52 51 51 GLU GLU A . n A 1 53 ARG 53 52 52 ARG ARG A . n A 1 54 LEU 54 53 53 LEU LEU A . n A 1 55 SER 55 54 54 SER SER A . n A 1 56 ASP 56 55 55 ASP ASP A . n A 1 57 ASN 57 56 56 ASN ASN A . n A 1 58 SER 58 57 57 SER SER A . n A 1 59 GLU 59 58 58 GLU GLU A . n A 1 60 LYS 60 59 59 LYS LYS A . n A 1 61 LEU 61 60 60 LEU LEU A . n A 1 62 LYS 62 61 61 LYS LYS A . n A 1 63 ARG 63 62 62 ARG ARG A . n A 1 64 LYS 64 63 63 LYS LYS A . n A 1 65 TYR 65 64 64 TYR TYR A . n A 1 66 TRP 66 65 65 TRP TRP A . n A 1 67 TRP 67 66 66 TRP TRP A . n A 1 68 LYS 68 67 67 LYS LYS A . n A 1 69 ASN 69 68 68 ASN ASN A . n A 1 70 SER 70 69 69 SER SER A . n A 1 71 LYS 71 70 70 LYS LYS A . n B 2 1 SER 1 -4 ? ? ? B . n B 2 2 GLY 2 -3 ? ? ? B . n B 2 3 GLY 3 -2 ? ? ? B . n B 2 4 SER 4 -1 -1 SER SER B . n B 2 5 SER 5 0 0 SER SER B . n B 2 6 SER 6 1 1 SER SER B . n B 2 7 GLU 7 2 2 GLU GLU B . n B 2 8 ARG 8 3 3 ARG ARG B . n B 2 9 GLU 9 4 4 GLU GLU B . n B 2 10 LYS 10 5 5 LYS LYS B . n B 2 11 GLU 11 6 6 GLU GLU B . n B 2 12 ILE 12 7 7 ILE ILE B . n B 2 13 ASP 13 8 8 ASP ASP B . n B 2 14 GLU 14 9 9 GLU GLU B . n B 2 15 GLY 15 10 10 GLY GLY B . n B 2 16 LEU 16 11 11 LEU LEU B . n B 2 17 ASP 17 12 12 ASP ASP B . n B 2 18 ARG 18 13 13 ARG ARG B . n B 2 19 VAL 19 14 14 VAL VAL B . n B 2 20 SER 20 15 15 SER SER B . n B 2 21 GLU 21 16 16 GLU GLU B . n B 2 22 ILE 22 17 17 ILE ILE B . n B 2 23 VAL 23 18 18 VAL VAL B . n B 2 24 LYS 24 19 19 LYS LYS B . n B 2 25 GLU 25 20 20 GLU GLU B . n B 2 26 LEU 26 21 21 LEU LEU B . n B 2 27 LYS 27 22 22 LYS LYS B . n B 2 28 LYS 28 23 23 LYS LYS B . n B 2 29 MET 29 24 24 MET MET B . n B 2 30 ALA 30 25 25 ALA ALA B . n B 2 31 GLU 31 26 26 GLU GLU B . n B 2 32 GLU 32 27 27 GLU GLU B . n B 2 33 MET 33 28 28 MET MET B . n B 2 34 ARG 34 29 29 ARG ARG B . n B 2 35 ARG 35 30 30 ARG ARG B . n B 2 36 MET 36 31 31 MET MET B . n B 2 37 ILE 37 32 32 ILE ILE B . n B 2 38 GLU 38 33 33 GLU GLU B . n B 2 39 GLU 39 34 34 GLU GLU B . n B 2 40 GLN 40 35 35 GLN GLN B . n B 2 41 GLY 41 36 36 GLY GLY B . n B 2 42 ARG 42 37 37 ARG ARG B . n B 2 43 ARG 43 38 38 ARG ARG B . n B 2 44 ILE 44 39 39 ILE ILE B . n B 2 45 GLU 45 40 40 GLU GLU B . n B 2 46 ARG 46 41 41 ARG ARG B . n B 2 47 ILE 47 42 42 ILE ILE B . n B 2 48 GLU 48 43 43 GLU GLU B . n B 2 49 GLU 49 44 44 GLU GLU B . n B 2 50 LYS 50 45 45 LYS LYS B . n B 2 51 ALA 51 46 46 ALA ALA B . n B 2 52 GLU 52 47 47 GLU GLU B . n B 2 53 GLU 53 48 48 GLU GLU B . n B 2 54 ALA 54 49 49 ALA ALA B . n B 2 55 LYS 55 50 50 LYS LYS B . n B 2 56 GLU 56 51 51 GLU GLU B . n B 2 57 LYS 57 52 52 LYS LYS B . n B 2 58 ILE 58 53 53 ILE ILE B . n B 2 59 GLU 59 54 54 GLU GLU B . n B 2 60 GLU 60 55 55 GLU GLU B . n B 2 61 ALA 61 56 56 ALA ALA B . n B 2 62 ASN 62 57 57 ASN ASN B . n B 2 63 GLU 63 58 58 GLU GLU B . n B 2 64 ARG 64 59 59 ARG ARG B . n B 2 65 ALA 65 60 60 ALA ALA B . n B 2 66 GLU 66 61 61 GLU GLU B . n B 2 67 LYS 67 62 62 LYS LYS B . n B 2 68 LEU 68 63 63 LEU LEU B . n B 2 69 LEU 69 64 64 LEU LEU B . n B 2 70 LYS 70 65 65 LYS LYS B . n B 2 71 ASP 71 66 66 ASP ASP B . n B 2 72 PRO 72 67 67 PRO PRO B . n B 2 73 GLY 73 68 ? ? ? B . n B 2 74 GLY 74 69 ? ? ? B . n B 2 75 SER 75 70 ? ? ? B . n B 2 76 GLY 76 71 ? ? ? B . n B 2 77 GLY 77 72 72 GLY GLY B . n B 2 78 SER 78 73 73 SER SER B . n B 2 79 GLU 79 74 74 GLU GLU B . n B 2 80 GLU 80 75 75 GLU GLU B . n B 2 81 LEU 81 76 76 LEU LEU B . n B 2 82 LYS 82 77 77 LYS LYS B . n B 2 83 LYS 83 78 78 LYS LYS B . n B 2 84 LEU 84 79 79 LEU LEU B . n B 2 85 GLU 85 80 80 GLU GLU B . n B 2 86 LYS 86 81 81 LYS LYS B . n B 2 87 GLU 87 82 82 GLU GLU B . n B 2 88 GLY 88 83 83 GLY GLY B . n B 2 89 GLU 89 84 84 GLU GLU B . n B 2 90 LYS 90 85 85 LYS LYS B . n B 2 91 LEU 91 86 86 LEU LEU B . n B 2 92 LYS 92 87 87 LYS LYS B . n B 2 93 GLU 93 88 88 GLU GLU B . n B 2 94 LEU 94 89 89 LEU LEU B . n B 2 95 VAL 95 90 90 VAL VAL B . n B 2 96 GLU 96 91 91 GLU GLU B . n B 2 97 GLU 97 92 92 GLU GLU B . n B 2 98 LEU 98 93 93 LEU LEU B . n B 2 99 ASP 99 94 94 ASP ASP B . n B 2 100 ARG 100 95 95 ARG ARG B . n B 2 101 GLU 101 96 96 GLU GLU B . n B 2 102 ILE 102 97 97 ILE ILE B . n B 2 103 LYS 103 98 98 LYS LYS B . n B 2 104 GLU 104 99 99 GLU GLU B . n B 2 105 LEU 105 100 100 LEU LEU B . n B 2 106 LYS 106 101 101 LYS LYS B . n B 2 107 GLU 107 102 102 GLU GLU B . n B 2 108 GLY 108 103 103 GLY GLY B . n B 2 109 MET 109 104 104 MET MET B . n B 2 110 GLU 110 105 105 GLU GLU B . n B 2 111 ARG 111 106 106 ARG ARG B . n B 2 112 LEU 112 107 107 LEU LEU B . n B 2 113 ARG 113 108 108 ARG ARG B . n B 2 114 GLU 114 109 109 GLU GLU B . n B 2 115 MET 115 110 110 MET MET B . n B 2 116 PHE 116 111 111 PHE PHE B . n B 2 117 GLU 117 112 112 GLU GLU B . n B 2 118 GLU 118 113 113 GLU GLU B . n B 2 119 ALA 119 114 114 ALA ALA B . n B 2 120 ALA 120 115 115 ALA ALA B . n B 2 121 LYS 121 116 116 LYS LYS B . n B 2 122 LEU 122 117 117 LEU LEU B . n B 2 123 SER 123 118 118 SER SER B . n B 2 124 GLU 124 119 119 GLU GLU B . n B 2 125 GLU 125 120 120 GLU GLU B . n B 2 126 ALA 126 121 121 ALA ALA B . n B 2 127 LEU 127 122 122 LEU LEU B . n B 2 128 GLU 128 123 123 GLU GLU B . n B 2 129 ILE 129 124 124 ILE ILE B . n B 2 130 MET 130 125 125 MET MET B . n B 2 131 ARG 131 126 126 ARG ARG B . n B 2 132 ARG 132 127 127 ARG ARG B . n B 2 133 THR 133 128 128 THR THR B . n B 2 134 ARG 134 129 129 ARG ARG B . n B 2 135 LYS 135 130 130 LYS LYS B . n B 2 136 LEU 136 131 131 LEU LEU B . n B 2 137 SER 137 132 132 SER SER B . n B 2 138 GLU 138 133 133 GLU GLU B . n B 2 139 GLU 139 134 134 GLU GLU B . n B 2 140 GLU 140 135 135 GLU GLU B . n B 2 141 LEU 141 136 136 LEU LEU B . n B 2 142 GLU 142 137 137 GLU GLU B . n B 2 143 GLU 143 138 138 GLU GLU B . n B 2 144 ALA 144 139 139 ALA ALA B . n B 2 145 LYS 145 140 140 LYS LYS B . n B 2 146 GLN 146 141 141 GLN GLN B . n B 2 147 LYS 147 142 142 LYS LYS B . n B 2 148 ALA 148 143 143 ALA ALA B . n B 2 149 LYS 149 144 144 LYS LYS B . n B 2 150 GLU 150 145 145 GLU GLU B . n B 2 151 GLN 151 146 146 GLN GLN B . n B 2 152 GLU 152 147 147 GLU GLU B . n B 2 153 LYS 153 148 148 LYS LYS B . n B 2 154 GLU 154 149 149 GLU GLU B . n B 2 155 LYS 155 150 150 LYS LYS B . n B 2 156 ALA 156 151 151 ALA ALA B . n B 2 157 LEU 157 152 152 LEU LEU B . n B 2 158 LYS 158 153 ? ? ? B . n B 2 159 GLU 159 154 ? ? ? B . n B 2 160 LYS 160 155 ? ? ? B . n B 2 161 GLY 161 156 ? ? ? B . n B 2 162 GLY 162 157 ? ? ? B . n B 2 163 SER 163 158 ? ? ? B . n B 2 164 GLY 164 159 ? ? ? B . n B 2 165 GLY 165 160 ? ? ? B . n B 2 166 SER 166 161 ? ? ? B . n B 2 167 GLY 167 162 ? ? ? B . n B 2 168 GLY 168 163 163 GLY GLY B . n B 2 169 SER 169 164 164 SER SER B . n B 2 170 GLU 170 165 165 GLU GLU B . n B 2 171 LYS 171 166 166 LYS LYS B . n B 2 172 VAL 172 167 167 VAL VAL B . n B 2 173 LYS 173 168 168 LYS LYS B . n B 2 174 ARG 174 169 169 ARG ARG B . n B 2 175 GLU 175 170 170 GLU GLU B . n B 2 176 LEU 176 171 171 LEU LEU B . n B 2 177 ALA 177 172 172 ALA ALA B . n B 2 178 GLN 178 173 173 GLN GLN B . n B 2 179 ILE 179 174 174 ILE ILE B . n B 2 180 GLU 180 175 175 GLU GLU B . n B 2 181 GLU 181 176 176 GLU GLU B . n B 2 182 ARG 182 177 177 ARG ARG B . n B 2 183 HIS 183 178 178 HIS HIS B . n B 2 184 GLN 184 179 179 GLN GLN B . n B 2 185 GLN 185 180 180 GLN GLN B . n B 2 186 ILE 186 181 181 ILE ILE B . n B 2 187 LEU 187 182 182 LEU LEU B . n B 2 188 GLU 188 183 183 GLU GLU B . n B 2 189 LEU 189 184 184 LEU LEU B . n B 2 190 GLU 190 185 185 GLU GLU B . n B 2 191 GLU 191 186 186 GLU GLU B . n B 2 192 LYS 192 187 187 LYS LYS B . n B 2 193 ILE 193 188 188 ILE ILE B . n B 2 194 LYS 194 189 189 LYS LYS B . n B 2 195 GLU 195 190 190 GLU GLU B . n B 2 196 LEU 196 191 191 LEU LEU B . n B 2 197 LEU 197 192 192 LEU LEU B . n B 2 198 GLU 198 193 193 GLU GLU B . n B 2 199 MET 199 194 194 MET MET B . n B 2 200 PHE 200 195 195 PHE PHE B . n B 2 201 LYS 201 196 196 LYS LYS B . n B 2 202 GLU 202 197 197 GLU GLU B . n B 2 203 LEU 203 198 198 LEU LEU B . n B 2 204 SER 204 199 199 SER SER B . n B 2 205 GLU 205 200 200 GLU GLU B . n B 2 206 LYS 206 201 201 LYS LYS B . n B 2 207 ILE 207 202 202 ILE ILE B . n B 2 208 GLU 208 203 203 GLU GLU B . n B 2 209 GLU 209 204 204 GLU GLU B . n B 2 210 GLN 210 205 205 GLN GLN B . n B 2 211 GLY 211 206 206 GLY GLY B . n B 2 212 GLN 212 207 207 GLN GLN B . n B 2 213 LYS 213 208 208 LYS LYS B . n B 2 214 ILE 214 209 209 ILE ILE B . n B 2 215 ASP 215 210 210 ASP ASP B . n B 2 216 ARG 216 211 211 ARG ARG B . n B 2 217 ILE 217 212 212 ILE ILE B . n B 2 218 GLU 218 213 213 GLU GLU B . n B 2 219 ASP 219 214 214 ASP ASP B . n B 2 220 LYS 220 215 215 LYS LYS B . n B 2 221 VAL 221 216 216 VAL VAL B . n B 2 222 SER 222 217 217 SER SER B . n B 2 223 LYS 223 218 218 LYS LYS B . n B 2 224 ALA 224 219 219 ALA ALA B . n B 2 225 LYS 225 220 220 LYS LYS B . n B 2 226 GLU 226 221 221 GLU GLU B . n B 2 227 HIS 227 222 222 HIS HIS B . n B 2 228 VAL 228 223 223 VAL VAL B . n B 2 229 GLU 229 224 224 GLU GLU B . n B 2 230 LYS 230 225 225 LYS LYS B . n B 2 231 GLY 231 226 226 GLY GLY B . n B 2 232 VAL 232 227 227 VAL VAL B . n B 2 233 GLU 233 228 228 GLU GLU B . n B 2 234 ASP 234 229 229 ASP ASP B . n B 2 235 THR 235 230 230 THR THR B . n B 2 236 LYS 236 231 231 LYS LYS B . n B 2 237 LYS 237 232 232 LYS LYS B . n B 2 238 ALA 238 233 233 ALA ALA B . n B 2 239 VAL 239 234 234 VAL VAL B . n B 2 240 LYS 240 235 235 LYS LYS B . n B 2 241 TYR 241 236 236 TYR TYR B . n B 2 242 GLN 242 237 237 GLN GLN B . n B 2 243 SER 243 238 238 SER SER B . n B 2 244 LYS 244 239 239 LYS LYS B . n B 2 245 ALA 245 240 240 ALA ALA B . n B 2 246 ARG 246 241 241 ARG ARG B . n B 2 247 ARG 247 242 242 ARG ARG B . n B 2 248 LYS 248 243 243 LYS LYS B . n B 2 249 LYS 249 244 244 LYS LYS B . n # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? dev_4761 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9Y5F _cell.details ? _cell.formula_units_Z ? _cell.length_a 47.094 _cell.length_a_esd ? _cell.length_b 47.094 _cell.length_b_esd ? _cell.length_c 334.302 _cell.length_c_esd ? _cell.volume 741429.964 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9Y5F _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall 'P 4abw 2nw' _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9Y5F _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.46 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.02 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.1 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Ammonium acetate pH 7.1 and 20% w/v Polyethylene glycol 3,350' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 S 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-03-02 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97934 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS-II BEAMLINE 17-ID-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97934 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID-2 _diffrn_source.pdbx_synchrotron_site NSLS-II # _reflns.B_iso_Wilson_estimate 84.53 _reflns.entry_id 9Y5F _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.45 _reflns.d_resolution_low 331.4 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5679 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 23.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.037 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.174 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 3.45 _reflns_shell.d_res_low 3.78 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1293 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 26.1 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 8.6 _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.107 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.977 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.531 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 74.12 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9Y5F _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.45 _refine.ls_d_res_low 33.30 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5481 _refine.ls_number_reflns_R_free 549 _refine.ls_number_reflns_R_work 4932 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.63 _refine.ls_percent_reflns_R_free 10.02 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2331 _refine.ls_R_factor_R_free 0.2880 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2267 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.04 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.9830 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2773 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.45 _refine_hist.d_res_low 33.30 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2534 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2534 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0013 ? 2541 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.3180 ? 3348 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0258 ? 353 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0021 ? 441 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 3.7369 ? 330 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 3.45 3.80 . . 131 1169 97.38 . . . . 0.2196 . . . . . . . . . . . . . . . 0.2998 'X-RAY DIFFRACTION' 3.80 4.35 . . 136 1213 98.32 . . . . 0.2170 . . . . . . . . . . . . . . . 0.2824 'X-RAY DIFFRACTION' 4.35 5.47 . . 137 1214 97.69 . . . . 0.2365 . . . . . . . . . . . . . . . 0.3007 'X-RAY DIFFRACTION' 5.47 33.30 . . 145 1336 97.18 . . . . 0.2295 . . . . . . . . . . . . . . . 0.2774 # _struct.entry_id 9Y5F _struct.title 'Crystal structure of rv-SNARE/sc-t-SNARE-5.s.8 complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9Y5F _struct_keywords.text 'membrane fusion proteins, synthetic fusogens, SNARE, protein design, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 PDB 9Y5F 9Y5F ? 1 ? 1 2 PDB 9Y5F 9Y5F ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9Y5F A 1 ? 71 ? 9Y5F 0 ? 70 ? 0 70 2 2 9Y5F B 1 ? 249 ? 9Y5F -4 ? 244 ? -4 244 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6220 ? 1 MORE -43 ? 1 'SSA (A^2)' 16810 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 2 ? TRP A 67 ? SER A 1 TRP A 66 1 ? 66 HELX_P HELX_P2 AA2 SER B 5 ? ASP B 71 ? SER B 0 ASP B 66 1 ? 67 HELX_P HELX_P3 AA3 SER B 78 ? LYS B 153 ? SER B 73 LYS B 148 1 ? 76 HELX_P HELX_P4 AA4 GLU B 170 ? LYS B 248 ? GLU B 165 LYS B 243 1 ? 79 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_entry_details.entry_id 9Y5F _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 OG _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 SER _pdbx_validate_symm_contact.auth_seq_id_1 3 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OE2 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 GLU _pdbx_validate_symm_contact.auth_seq_id_2 41 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 7_655 _pdbx_validate_symm_contact.dist 2.16 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+1/4 3 y+1/2,-x+1/2,z+3/4 4 x+1/2,-y+1/2,-z+3/4 5 -x+1/2,y+1/2,-z+1/4 6 -x,-y,z+1/2 7 y,x,-z 8 -y,-x,-z+1/2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 B SER -4 ? B SER 1 2 1 Y 1 B GLY -3 ? B GLY 2 3 1 Y 1 B GLY -2 ? B GLY 3 4 1 Y 1 B GLY 68 ? B GLY 73 5 1 Y 1 B GLY 69 ? B GLY 74 6 1 Y 1 B SER 70 ? B SER 75 7 1 Y 1 B GLY 71 ? B GLY 76 8 1 Y 1 B LYS 153 ? B LYS 158 9 1 Y 1 B GLU 154 ? B GLU 159 10 1 Y 1 B LYS 155 ? B LYS 160 11 1 Y 1 B GLY 156 ? B GLY 161 12 1 Y 1 B GLY 157 ? B GLY 162 13 1 Y 1 B SER 158 ? B SER 163 14 1 Y 1 B GLY 159 ? B GLY 164 15 1 Y 1 B GLY 160 ? B GLY 165 16 1 Y 1 B SER 161 ? B SER 166 17 1 Y 1 B GLY 162 ? B GLY 167 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # _pdbx_audit_support.funding_organization 'Bill & Melinda Gates Foundation' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'designed model' # _space_group.name_H-M_alt 'P 41 21 2' _space_group.name_Hall 'P 4abw 2nw' _space_group.IT_number 92 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 9Y5F _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.021234 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021234 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.002991 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 5.96793 ? ? ? 14.89577 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? ? ? 11.43723 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 15.91112 ? ? ? 10.84690 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #