data_9Y5X # _entry.id 9Y5X # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.409 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9Y5X pdb_00009y5x 10.2210/pdb9y5x/pdb WWPDB D_1000299850 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-01-07 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9Y5X _pdbx_database_status.recvd_initial_deposition_date 2025-09-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email dkern@scripps.edu _pdbx_contact_author.name_first Dorothee _pdbx_contact_author.name_last Kern _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7631-8328 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Padua, R.A.P.' 1 0000-0001-9719-3440 'Sullivan, C.' 2 0000-0002-2175-4288 'Glaser, A.' 3 0000-0003-2394-3047 'Ojoawo, A.' 4 0000-0003-3961-8935 'Kern, D.' 5 0000-0002-7631-8328 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_patent _citation.unpublished_flag ? ? ? ? ? ? ? ? ? ? primary 'To Be Published' ? 0353 ? ? ? ? ? ? ? 'Crystal structure of ligand free N-SH2 domain of SHP2' ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 'Acta Crystallogr D Struct Biol' ? 0353 ? ? ? ? ? ? ? 'Macromolecular structure determination using X-rays, neutrons and electrons: recent developments in Phenix' 2019 ? 10.1107/S2059798319011471 31588918 ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Padua, R.A.P.' 1 ? primary 'Glaser, A.' 2 ? primary 'Ojoawo, A.' 3 ? primary 'Kern, D.' 4 ? 1 'Liebschner, D.' 5 0000-0003-3921-3209 1 'Afonine, P.V.' 6 0000-0002-5052-991X 1 'Baker, M.L.' 7 ? 1 'Bunkoczi, G.' 8 ? 1 'Chen, V.B.' 9 0000-0003-2492-979X 1 'Croll, T.I.' 10 ? 1 'Hintze, B.' 11 0000-0002-4871-2096 1 'Hung, L.W.' 12 0000-0001-6690-8458 1 'Jain, S.' 13 ? 1 'McCoy, A.J.' 14 ? 1 'Moriarty, N.W.' 15 0000-0001-8857-9464 1 'Oeffner, R.D.' 16 0000-0003-3107-2202 1 'Poon, B.K.' 17 0000-0001-9633-6067 1 'Prisant, M.G.' 18 ? 1 'Read, R.J.' 19 0000-0001-8273-0047 1 'Richardson, J.S.' 20 0000-0002-3311-2944 1 'Richardson, D.C.' 21 ? 1 'Sammito, M.D.' 22 0000-0002-8346-9247 1 'Sobolev, O.V.' 23 0000-0002-0623-3214 1 'Stockwell, D.H.' 24 ? 1 'Terwilliger, T.C.' 25 0000-0001-6384-0320 1 'Urzhumtsev, A.G.' 26 ? 1 'Videau, L.L.' 27 ? 1 'Williams, C.J.' 28 ? 1 'Adams, P.D.' 29 0000-0001-9333-8219 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Isoform 1 of Tyrosine-protein phosphatase non-receptor type 11' 11811.255 1 3.1.3.48 ? 'N-terminal SH2 domain' ? 2 non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' 195.237 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 4 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 5 water nat water 18.015 50 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Protein-tyrosine phosphatase 1D,PTP-1D,Protein-tyrosine phosphatase 2C,PTP-2C,SH-PTP2,SHP-2,Shp2,SH-PTP3' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQ YYMEHHGQLKEKNGDVIELKYPLN ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQ YYMEHHGQLKEKNGDVIELKYPLN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' MES 3 GLYCEROL GOL 4 'SULFATE ION' SO4 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ARG n 1 6 ARG n 1 7 TRP n 1 8 PHE n 1 9 HIS n 1 10 PRO n 1 11 ASN n 1 12 ILE n 1 13 THR n 1 14 GLY n 1 15 VAL n 1 16 GLU n 1 17 ALA n 1 18 GLU n 1 19 ASN n 1 20 LEU n 1 21 LEU n 1 22 LEU n 1 23 THR n 1 24 ARG n 1 25 GLY n 1 26 VAL n 1 27 ASP n 1 28 GLY n 1 29 SER n 1 30 PHE n 1 31 LEU n 1 32 ALA n 1 33 ARG n 1 34 PRO n 1 35 SER n 1 36 LYS n 1 37 SER n 1 38 ASN n 1 39 PRO n 1 40 GLY n 1 41 ASP n 1 42 PHE n 1 43 THR n 1 44 LEU n 1 45 SER n 1 46 VAL n 1 47 ARG n 1 48 ARG n 1 49 ASN n 1 50 GLY n 1 51 ALA n 1 52 VAL n 1 53 THR n 1 54 HIS n 1 55 ILE n 1 56 LYS n 1 57 ILE n 1 58 GLN n 1 59 ASN n 1 60 THR n 1 61 GLY n 1 62 ASP n 1 63 TYR n 1 64 TYR n 1 65 ASP n 1 66 LEU n 1 67 TYR n 1 68 GLY n 1 69 GLY n 1 70 GLU n 1 71 LYS n 1 72 PHE n 1 73 ALA n 1 74 THR n 1 75 LEU n 1 76 ALA n 1 77 GLU n 1 78 LEU n 1 79 VAL n 1 80 GLN n 1 81 TYR n 1 82 TYR n 1 83 MET n 1 84 GLU n 1 85 HIS n 1 86 HIS n 1 87 GLY n 1 88 GLN n 1 89 LEU n 1 90 LYS n 1 91 GLU n 1 92 LYS n 1 93 ASN n 1 94 GLY n 1 95 ASP n 1 96 VAL n 1 97 ILE n 1 98 GLU n 1 99 LEU n 1 100 LYS n 1 101 TYR n 1 102 PRO n 1 103 LEU n 1 104 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 104 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PTPN11, PTP2C, SHPTP2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MES non-polymer . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' ? 'C6 H13 N O4 S' 195.237 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 0 GLY GLY A . n A 1 2 SER 2 1 1 SER SER A . n A 1 3 HIS 3 2 2 HIS HIS A . n A 1 4 MET 4 3 3 MET MET A . n A 1 5 ARG 5 4 4 ARG ARG A . n A 1 6 ARG 6 5 5 ARG ARG A . n A 1 7 TRP 7 6 6 TRP TRP A . n A 1 8 PHE 8 7 7 PHE PHE A . n A 1 9 HIS 9 8 8 HIS HIS A . n A 1 10 PRO 10 9 9 PRO PRO A . n A 1 11 ASN 11 10 10 ASN ASN A . n A 1 12 ILE 12 11 11 ILE ILE A . n A 1 13 THR 13 12 12 THR THR A . n A 1 14 GLY 14 13 13 GLY GLY A . n A 1 15 VAL 15 14 14 VAL VAL A . n A 1 16 GLU 16 15 15 GLU GLU A . n A 1 17 ALA 17 16 16 ALA ALA A . n A 1 18 GLU 18 17 17 GLU GLU A . n A 1 19 ASN 19 18 18 ASN ASN A . n A 1 20 LEU 20 19 19 LEU LEU A . n A 1 21 LEU 21 20 20 LEU LEU A . n A 1 22 LEU 22 21 21 LEU LEU A . n A 1 23 THR 23 22 22 THR THR A . n A 1 24 ARG 24 23 23 ARG ARG A . n A 1 25 GLY 25 24 24 GLY GLY A . n A 1 26 VAL 26 25 25 VAL VAL A . n A 1 27 ASP 27 26 26 ASP ASP A . n A 1 28 GLY 28 27 27 GLY GLY A . n A 1 29 SER 29 28 28 SER SER A . n A 1 30 PHE 30 29 29 PHE PHE A . n A 1 31 LEU 31 30 30 LEU LEU A . n A 1 32 ALA 32 31 31 ALA ALA A . n A 1 33 ARG 33 32 32 ARG ARG A . n A 1 34 PRO 34 33 33 PRO PRO A . n A 1 35 SER 35 34 34 SER SER A . n A 1 36 LYS 36 35 35 LYS LYS A . n A 1 37 SER 37 36 36 SER SER A . n A 1 38 ASN 38 37 37 ASN ASN A . n A 1 39 PRO 39 38 38 PRO PRO A . n A 1 40 GLY 40 39 39 GLY GLY A . n A 1 41 ASP 41 40 40 ASP ASP A . n A 1 42 PHE 42 41 41 PHE PHE A . n A 1 43 THR 43 42 42 THR THR A . n A 1 44 LEU 44 43 43 LEU LEU A . n A 1 45 SER 45 44 44 SER SER A . n A 1 46 VAL 46 45 45 VAL VAL A . n A 1 47 ARG 47 46 46 ARG ARG A . n A 1 48 ARG 48 47 47 ARG ARG A . n A 1 49 ASN 49 48 48 ASN ASN A . n A 1 50 GLY 50 49 49 GLY GLY A . n A 1 51 ALA 51 50 50 ALA ALA A . n A 1 52 VAL 52 51 51 VAL VAL A . n A 1 53 THR 53 52 52 THR THR A . n A 1 54 HIS 54 53 53 HIS HIS A . n A 1 55 ILE 55 54 54 ILE ILE A . n A 1 56 LYS 56 55 55 LYS LYS A . n A 1 57 ILE 57 56 56 ILE ILE A . n A 1 58 GLN 58 57 57 GLN GLN A . n A 1 59 ASN 59 58 58 ASN ASN A . n A 1 60 THR 60 59 59 THR THR A . n A 1 61 GLY 61 60 60 GLY GLY A . n A 1 62 ASP 62 61 61 ASP ASP A . n A 1 63 TYR 63 62 62 TYR TYR A . n A 1 64 TYR 64 63 63 TYR TYR A . n A 1 65 ASP 65 64 64 ASP ASP A . n A 1 66 LEU 66 65 65 LEU LEU A . n A 1 67 TYR 67 66 66 TYR TYR A . n A 1 68 GLY 68 67 67 GLY GLY A . n A 1 69 GLY 69 68 68 GLY GLY A . n A 1 70 GLU 70 69 69 GLU GLU A . n A 1 71 LYS 71 70 70 LYS LYS A . n A 1 72 PHE 72 71 71 PHE PHE A . n A 1 73 ALA 73 72 72 ALA ALA A . n A 1 74 THR 74 73 73 THR THR A . n A 1 75 LEU 75 74 74 LEU LEU A . n A 1 76 ALA 76 75 75 ALA ALA A . n A 1 77 GLU 77 76 76 GLU GLU A . n A 1 78 LEU 78 77 77 LEU LEU A . n A 1 79 VAL 79 78 78 VAL VAL A . n A 1 80 GLN 80 79 79 GLN GLN A . n A 1 81 TYR 81 80 80 TYR TYR A . n A 1 82 TYR 82 81 81 TYR TYR A . n A 1 83 MET 83 82 82 MET MET A . n A 1 84 GLU 84 83 83 GLU GLU A . n A 1 85 HIS 85 84 84 HIS HIS A . n A 1 86 HIS 86 85 85 HIS HIS A . n A 1 87 GLY 87 86 86 GLY GLY A . n A 1 88 GLN 88 87 87 GLN GLN A . n A 1 89 LEU 89 88 88 LEU LEU A . n A 1 90 LYS 90 89 89 LYS LYS A . n A 1 91 GLU 91 90 90 GLU GLU A . n A 1 92 LYS 92 91 91 LYS LYS A . n A 1 93 ASN 93 92 92 ASN ASN A . n A 1 94 GLY 94 93 93 GLY GLY A . n A 1 95 ASP 95 94 94 ASP ASP A . n A 1 96 VAL 96 95 95 VAL VAL A . n A 1 97 ILE 97 96 96 ILE ILE A . n A 1 98 GLU 98 97 97 GLU GLU A . n A 1 99 LEU 99 98 98 LEU LEU A . n A 1 100 LYS 100 99 99 LYS LYS A . n A 1 101 TYR 101 100 100 TYR TYR A . n A 1 102 PRO 102 101 101 PRO PRO A . n A 1 103 LEU 103 102 102 LEU LEU A . n A 1 104 ASN 104 103 103 ASN ASN A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MES 1 201 201 MES MES A . C 3 GOL 1 202 202 GOL GOL A . D 4 SO4 1 203 1 SO4 SO4 A . E 4 SO4 1 204 2 SO4 SO4 A . F 5 HOH 1 301 31 HOH HOH A . F 5 HOH 2 302 55 HOH HOH A . F 5 HOH 3 303 72 HOH HOH A . F 5 HOH 4 304 87 HOH HOH A . F 5 HOH 5 305 2 HOH HOH A . F 5 HOH 6 306 20 HOH HOH A . F 5 HOH 7 307 233 HOH HOH A . F 5 HOH 8 308 21 HOH HOH A . F 5 HOH 9 309 13 HOH HOH A . F 5 HOH 10 310 227 HOH HOH A . F 5 HOH 11 311 10 HOH HOH A . F 5 HOH 12 312 33 HOH HOH A . F 5 HOH 13 313 8 HOH HOH A . F 5 HOH 14 314 12 HOH HOH A . F 5 HOH 15 315 231 HOH HOH A . F 5 HOH 16 316 47 HOH HOH A . F 5 HOH 17 317 18 HOH HOH A . F 5 HOH 18 318 30 HOH HOH A . F 5 HOH 19 319 11 HOH HOH A . F 5 HOH 20 320 29 HOH HOH A . F 5 HOH 21 321 3 HOH HOH A . F 5 HOH 22 322 7 HOH HOH A . F 5 HOH 23 323 41 HOH HOH A . F 5 HOH 24 324 9 HOH HOH A . F 5 HOH 25 325 80 HOH HOH A . F 5 HOH 26 326 229 HOH HOH A . F 5 HOH 27 327 23 HOH HOH A . F 5 HOH 28 328 25 HOH HOH A . F 5 HOH 29 329 74 HOH HOH A . F 5 HOH 30 330 6 HOH HOH A . F 5 HOH 31 331 17 HOH HOH A . F 5 HOH 32 332 1 HOH HOH A . F 5 HOH 33 333 226 HOH HOH A . F 5 HOH 34 334 232 HOH HOH A . F 5 HOH 35 335 143 HOH HOH A . F 5 HOH 36 336 24 HOH HOH A . F 5 HOH 37 337 39 HOH HOH A . F 5 HOH 38 338 22 HOH HOH A . F 5 HOH 39 339 26 HOH HOH A . F 5 HOH 40 340 15 HOH HOH A . F 5 HOH 41 341 50 HOH HOH A . F 5 HOH 42 342 224 HOH HOH A . F 5 HOH 43 343 93 HOH HOH A . F 5 HOH 44 344 130 HOH HOH A . F 5 HOH 45 345 228 HOH HOH A . F 5 HOH 46 346 123 HOH HOH A . F 5 HOH 47 347 83 HOH HOH A . F 5 HOH 48 348 46 HOH HOH A . F 5 HOH 49 349 195 HOH HOH A . F 5 HOH 50 350 203 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21.2_5419 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9Y5X _cell.details ? _cell.formula_units_Z ? _cell.length_a 63.271 _cell.length_a_esd ? _cell.length_b 63.271 _cell.length_b_esd ? _cell.length_c 76.284 _cell.length_c_esd ? _cell.volume 305381.592 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9Y5X _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall 'P 4nw 2abw' _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9Y5X _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.23 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 61.94 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M MES pH 6.0, 2.05 M ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 298 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2025-08-01 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.919716 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS-II BEAMLINE 17-ID-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.919716 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID-1 _diffrn_source.pdbx_synchrotron_site NSLS-II # _reflns.B_iso_Wilson_estimate 37.54 _reflns.entry_id 9Y5X _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.795 _reflns.d_resolution_low 31.64 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15043 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.98 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 26.3 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 20.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.795 _reflns_shell.d_res_low 1.93 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2930 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.352 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 57.88 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9Y5X _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.80 _refine.ls_d_res_low 31.64 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15043 _refine.ls_number_reflns_R_free 763 _refine.ls_number_reflns_R_work 14280 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.98 _refine.ls_percent_reflns_R_free 5.07 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2133 _refine.ls_R_factor_R_free 0.2500 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2114 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.6927 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3048 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.80 _refine_hist.d_res_low 31.64 _refine_hist.number_atoms_solvent 50 _refine_hist.number_atoms_total 912 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 834 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0165 ? 946 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 1.7793 ? 1283 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0672 ? 127 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0167 ? 169 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 16.6393 ? 361 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.80 1.93 . . 150 2780 99.97 . . . . 0.3654 . . . . . . . . . . . . . . . 0.4050 'X-RAY DIFFRACTION' 1.93 2.13 . . 167 2794 100.00 . . . . 0.2665 . . . . . . . . . . . . . . . 0.2707 'X-RAY DIFFRACTION' 2.13 2.44 . . 138 2833 100.00 . . . . 0.2522 . . . . . . . . . . . . . . . 0.2947 'X-RAY DIFFRACTION' 2.44 3.07 . . 160 2841 100.00 . . . . 0.2402 . . . . . . . . . . . . . . . 0.2713 'X-RAY DIFFRACTION' 3.07 31.64 . . 148 3032 99.94 . . . . 0.1787 . . . . . . . . . . . . . . . 0.2181 # _struct.entry_id 9Y5X _struct.title 'Crystal structure of shorter construct of SHP2 unbound N-SH2 domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9Y5X _struct_keywords.text 'SHP2, phosphatase, SH2, allostery, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PTN11_HUMAN _struct_ref.pdbx_db_accession Q06124 _struct_ref.pdbx_db_isoform Q06124-2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;RRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYYME HHGQLKEKNGDVIELKYPLN ; _struct_ref.pdbx_align_begin 4 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9Y5X _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 104 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q06124 _struct_ref_seq.db_align_beg 4 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 103 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 103 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9Y5X GLY A 1 ? UNP Q06124 ? ? 'expression tag' 0 1 1 9Y5X SER A 2 ? UNP Q06124 ? ? 'expression tag' 1 2 1 9Y5X HIS A 3 ? UNP Q06124 ? ? 'expression tag' 2 3 1 9Y5X MET A 4 ? UNP Q06124 ? ? 'expression tag' 3 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 13 ? GLY A 25 ? THR A 12 GLY A 24 1 ? 13 HELX_P HELX_P2 AA2 THR A 74 ? HIS A 85 ? THR A 73 HIS A 84 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 64 ? ASP A 65 ? TYR A 63 ASP A 64 AA1 2 ALA A 51 ? ASN A 59 ? ALA A 50 ASN A 58 AA1 3 PHE A 42 ? ARG A 48 ? PHE A 41 ARG A 47 AA1 4 SER A 29 ? PRO A 34 ? SER A 28 PRO A 33 AA1 5 TYR A 101 ? PRO A 102 ? TYR A 100 PRO A 101 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ASP A 65 ? O ASP A 64 N GLN A 58 ? N GLN A 57 AA1 2 3 O ILE A 57 ? O ILE A 56 N PHE A 42 ? N PHE A 41 AA1 3 4 O SER A 45 ? O SER A 44 N LEU A 31 ? N LEU A 30 AA1 4 5 N PHE A 30 ? N PHE A 29 O TYR A 101 ? O TYR A 100 # _pdbx_entry_details.entry_id 9Y5X _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 1 ? ? 85.48 -91.11 2 1 HIS A 2 ? ? -138.89 -137.38 3 1 ARG A 47 ? B -137.23 -48.35 4 1 ASN A 48 ? A 33.46 53.54 5 1 GLU A 90 ? ? -56.44 175.58 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 306 ? F HOH . 2 1 A HOH 319 ? F HOH . 3 1 A HOH 324 ? F HOH . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+3/4 3 y+1/2,-x+1/2,z+1/4 4 x+1/2,-y+1/2,-z+1/4 5 -x+1/2,y+1/2,-z+3/4 6 -x,-y,z+1/2 7 y,x,-z 8 -y,-x,-z+1/2 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -26.0707856634 -3.79294266927 -8.06224048323 0.485759348319 ? -0.0151898366989 ? 0.0593062683258 ? 0.532150627902 ? 0.0834091874255 ? 0.677565850755 ? 8.89003693534 ? -0.0802091150763 ? 4.16065403931 ? 3.44190223337 ? -2.72131846607 ? 6.40671707363 ? -0.293450149709 ? -0.608616543009 ? 0.496402814869 ? -0.244360361745 ? 1.15925996779 ? 0.223696123043 ? -1.77273392324 ? -1.33804406383 ? -0.690944104636 ? 2 'X-RAY DIFFRACTION' ? refined -23.2238813986 -0.0835907741209 -22.8046980966 1.03105717373 ? -0.377673961366 ? -0.0519328221898 ? 0.662217258124 ? 0.155516039879 ? 0.393258229999 ? 8.73382389526 ? 2.48443928258 ? 2.56444861126 ? 1.40520728383 ? 1.41009984469 ? 1.50825224263 ? -0.131233611287 ? 0.297333255147 ? 0.664167856742 ? -1.31581574847 ? 0.57179266724 ? 0.966122866641 ? 1.54149064038 ? -1.84816310988 ? 0.130969822421 ? 3 'X-RAY DIFFRACTION' ? refined -20.2614672891 -8.42473473455 -17.5745887521 0.849981044068 ? -0.234027687972 ? 0.115287696592 ? 0.475870497163 ? -0.0559005046552 ? 0.436517808422 ? 0.833482423061 ? -1.62259239468 ? 0.355296771695 ? 3.28683765809 ? -0.67730615243 ? 0.783325674008 ? -0.790380717679 ? 1.11947850488 ? -0.25989097534 ? -1.73756962916 ? 0.68896962748 ? 0.36327872372 ? 1.07783180274 ? -1.05617510729 ? -0.0441762583119 ? 4 'X-RAY DIFFRACTION' ? refined -15.2502658531 -8.86388868197 -21.3062711449 1.16339400716 ? -0.432659459528 ? 0.331472628255 ? 0.505053687105 ? -0.123752091221 ? 0.451993309226 ? 0.431816673829 ? -0.285836856461 ? -0.400137157243 ? 0.148427514132 ? 0.28482497484 ? 2.2856216283 ? -0.219565411648 ? 0.338779807785 ? -0.186217560462 ? -1.34424898484 ? 0.575234823443 ? -0.796134364212 ? -0.0102738194728 ? 0.522849126074 ? 0.846569247312 ? 5 'X-RAY DIFFRACTION' ? refined -15.2667038387 -14.6722831984 -6.9244442844 0.408016926404 ? -0.0610221232812 ? 0.147608093945 ? 0.34928891717 ? -0.0805494969698 ? 0.540754638714 ? 1.42359347096 ? -0.798547622453 ? 0.0839805114869 ? 3.82817284634 ? -1.54502964344 ? 3.14282115153 ? -0.298217707661 ? -0.0458336802444 ? -0.172513733614 ? -0.251999059312 ? 0.0124142562717 ? -1.26119891231 ? 0.224789881658 ? 0.441120428526 ? 0.266917011854 ? 6 'X-RAY DIFFRACTION' ? refined -7.83240137669 -15.4394121019 -20.3226326995 1.39762881192 ? -0.0751161726548 ? 0.238499534672 ? 1.46636446885 ? -0.283428033683 ? 0.964675727805 ? 4.78979019007 ? -3.94673692189 ? 5.19151740224 ? 3.62577500654 ? -4.679986408 ? 7.04075628862 ? 0.40463544349 ? 3.12647013669 ? -1.09455313068 ? -1.02522577211 ? -1.74846255963 ? -0.285210616156 ? 0.738105520973 ? -1.12258603365 ? 1.21014725405 ? 7 'X-RAY DIFFRACTION' ? refined -8.06452007966 -8.26259734802 -16.2640428665 0.85026552249 ? 0.0867114063114 ? 0.493851650607 ? 0.535953155455 ? -0.00971229717278 ? 0.927222852878 ? 3.33270027251 ? -2.49159071641 ? -0.734120924037 ? 4.83054719465 ? 3.93521366322 ? 4.06035330495 ? -0.514934547357 ? 0.934337499798 ? -0.528368352837 ? -1.17386161046 ? -0.386001135283 ? -0.877197626916 ? 0.500648530343 ? 0.302807595466 ? -1.03118093257 ? 8 'X-RAY DIFFRACTION' ? refined -16.6344582348 1.14929579507 -12.3599514474 0.509182304139 ? 0.0628503612439 ? 0.0691011754033 ? 0.41929952881 ? 0.0625615493564 ? 0.413755918905 ? 3.46551982383 ? 4.25134011009 ? 1.04980946179 ? 7.94784256627 ? -1.55515906922 ? 3.24336865012 ? -0.0788042462792 ? 0.616997607781 ? -0.230825641398 ? -0.492136033816 ? -0.128046879715 ? 0.00432306534015 ? -0.222715425147 ? -0.385163578753 ? 0.301404150825 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 1 A 0 ? A 13 A 12 ? ? ;chain 'A' and (resid 0 through 12 ) ; 2 'X-RAY DIFFRACTION' 2 A 14 A 13 ? A 24 A 23 ? ? ;chain 'A' and (resid 13 through 23 ) ; 3 'X-RAY DIFFRACTION' 3 A 25 A 24 ? A 48 A 47 ? ? ;chain 'A' and (resid 24 through 47 ) ; 4 'X-RAY DIFFRACTION' 4 A 49 A 48 ? A 57 A 56 ? ? ;chain 'A' and (resid 48 through 56 ) ; 5 'X-RAY DIFFRACTION' 5 A 58 A 57 ? A 89 A 88 ? ? ;chain 'A' and (resid 57 through 88 ) ; 6 'X-RAY DIFFRACTION' 6 A 90 A 89 ? A 94 A 93 ? ? ;chain 'A' and (resid 89 through 93 ) ; 7 'X-RAY DIFFRACTION' 7 A 95 A 94 ? A 99 A 98 ? ? ;chain 'A' and (resid 94 through 98 ) ; 8 'X-RAY DIFFRACTION' 8 A 100 A 99 ? A 104 A 103 ? ? ;chain 'A' and (resid 99 through 103 ) ; # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 GOL C1 C N N 123 GOL O1 O N N 124 GOL C2 C N N 125 GOL O2 O N N 126 GOL C3 C N N 127 GOL O3 O N N 128 GOL H11 H N N 129 GOL H12 H N N 130 GOL HO1 H N N 131 GOL H2 H N N 132 GOL HO2 H N N 133 GOL H31 H N N 134 GOL H32 H N N 135 GOL HO3 H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MES O1 O N N 230 MES C2 C N N 231 MES C3 C N N 232 MES N4 N N N 233 MES C5 C N N 234 MES C6 C N N 235 MES C7 C N N 236 MES C8 C N N 237 MES S S N N 238 MES O1S O N N 239 MES O2S O N N 240 MES O3S O N N 241 MES H21 H N N 242 MES H22 H N N 243 MES H31 H N N 244 MES H32 H N N 245 MES HN4 H N N 246 MES H51 H N N 247 MES H52 H N N 248 MES H61 H N N 249 MES H62 H N N 250 MES H71 H N N 251 MES H72 H N N 252 MES H81 H N N 253 MES H82 H N N 254 MET N N N N 255 MET CA C N S 256 MET C C N N 257 MET O O N N 258 MET CB C N N 259 MET CG C N N 260 MET SD S N N 261 MET CE C N N 262 MET OXT O N N 263 MET H H N N 264 MET H2 H N N 265 MET HA H N N 266 MET HB2 H N N 267 MET HB3 H N N 268 MET HG2 H N N 269 MET HG3 H N N 270 MET HE1 H N N 271 MET HE2 H N N 272 MET HE3 H N N 273 MET HXT H N N 274 PHE N N N N 275 PHE CA C N S 276 PHE C C N N 277 PHE O O N N 278 PHE CB C N N 279 PHE CG C Y N 280 PHE CD1 C Y N 281 PHE CD2 C Y N 282 PHE CE1 C Y N 283 PHE CE2 C Y N 284 PHE CZ C Y N 285 PHE OXT O N N 286 PHE H H N N 287 PHE H2 H N N 288 PHE HA H N N 289 PHE HB2 H N N 290 PHE HB3 H N N 291 PHE HD1 H N N 292 PHE HD2 H N N 293 PHE HE1 H N N 294 PHE HE2 H N N 295 PHE HZ H N N 296 PHE HXT H N N 297 PRO N N N N 298 PRO CA C N S 299 PRO C C N N 300 PRO O O N N 301 PRO CB C N N 302 PRO CG C N N 303 PRO CD C N N 304 PRO OXT O N N 305 PRO H H N N 306 PRO HA H N N 307 PRO HB2 H N N 308 PRO HB3 H N N 309 PRO HG2 H N N 310 PRO HG3 H N N 311 PRO HD2 H N N 312 PRO HD3 H N N 313 PRO HXT H N N 314 SER N N N N 315 SER CA C N S 316 SER C C N N 317 SER O O N N 318 SER CB C N N 319 SER OG O N N 320 SER OXT O N N 321 SER H H N N 322 SER H2 H N N 323 SER HA H N N 324 SER HB2 H N N 325 SER HB3 H N N 326 SER HG H N N 327 SER HXT H N N 328 SO4 S S N N 329 SO4 O1 O N N 330 SO4 O2 O N N 331 SO4 O3 O N N 332 SO4 O4 O N N 333 THR N N N N 334 THR CA C N S 335 THR C C N N 336 THR O O N N 337 THR CB C N R 338 THR OG1 O N N 339 THR CG2 C N N 340 THR OXT O N N 341 THR H H N N 342 THR H2 H N N 343 THR HA H N N 344 THR HB H N N 345 THR HG1 H N N 346 THR HG21 H N N 347 THR HG22 H N N 348 THR HG23 H N N 349 THR HXT H N N 350 TRP N N N N 351 TRP CA C N S 352 TRP C C N N 353 TRP O O N N 354 TRP CB C N N 355 TRP CG C Y N 356 TRP CD1 C Y N 357 TRP CD2 C Y N 358 TRP NE1 N Y N 359 TRP CE2 C Y N 360 TRP CE3 C Y N 361 TRP CZ2 C Y N 362 TRP CZ3 C Y N 363 TRP CH2 C Y N 364 TRP OXT O N N 365 TRP H H N N 366 TRP H2 H N N 367 TRP HA H N N 368 TRP HB2 H N N 369 TRP HB3 H N N 370 TRP HD1 H N N 371 TRP HE1 H N N 372 TRP HE3 H N N 373 TRP HZ2 H N N 374 TRP HZ3 H N N 375 TRP HH2 H N N 376 TRP HXT H N N 377 TYR N N N N 378 TYR CA C N S 379 TYR C C N N 380 TYR O O N N 381 TYR CB C N N 382 TYR CG C Y N 383 TYR CD1 C Y N 384 TYR CD2 C Y N 385 TYR CE1 C Y N 386 TYR CE2 C Y N 387 TYR CZ C Y N 388 TYR OH O N N 389 TYR OXT O N N 390 TYR H H N N 391 TYR H2 H N N 392 TYR HA H N N 393 TYR HB2 H N N 394 TYR HB3 H N N 395 TYR HD1 H N N 396 TYR HD2 H N N 397 TYR HE1 H N N 398 TYR HE2 H N N 399 TYR HH H N N 400 TYR HXT H N N 401 VAL N N N N 402 VAL CA C N S 403 VAL C C N N 404 VAL O O N N 405 VAL CB C N N 406 VAL CG1 C N N 407 VAL CG2 C N N 408 VAL OXT O N N 409 VAL H H N N 410 VAL H2 H N N 411 VAL HA H N N 412 VAL HB H N N 413 VAL HG11 H N N 414 VAL HG12 H N N 415 VAL HG13 H N N 416 VAL HG21 H N N 417 VAL HG22 H N N 418 VAL HG23 H N N 419 VAL HXT H N N 420 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 GOL C1 O1 sing N N 116 GOL C1 C2 sing N N 117 GOL C1 H11 sing N N 118 GOL C1 H12 sing N N 119 GOL O1 HO1 sing N N 120 GOL C2 O2 sing N N 121 GOL C2 C3 sing N N 122 GOL C2 H2 sing N N 123 GOL O2 HO2 sing N N 124 GOL C3 O3 sing N N 125 GOL C3 H31 sing N N 126 GOL C3 H32 sing N N 127 GOL O3 HO3 sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MES O1 C2 sing N N 218 MES O1 C6 sing N N 219 MES C2 C3 sing N N 220 MES C2 H21 sing N N 221 MES C2 H22 sing N N 222 MES C3 N4 sing N N 223 MES C3 H31 sing N N 224 MES C3 H32 sing N N 225 MES N4 C5 sing N N 226 MES N4 C7 sing N N 227 MES N4 HN4 sing N N 228 MES C5 C6 sing N N 229 MES C5 H51 sing N N 230 MES C5 H52 sing N N 231 MES C6 H61 sing N N 232 MES C6 H62 sing N N 233 MES C7 C8 sing N N 234 MES C7 H71 sing N N 235 MES C7 H72 sing N N 236 MES C8 S sing N N 237 MES C8 H81 sing N N 238 MES C8 H82 sing N N 239 MES S O1S doub N N 240 MES S O2S doub N N 241 MES S O3S sing N N 242 MET N CA sing N N 243 MET N H sing N N 244 MET N H2 sing N N 245 MET CA C sing N N 246 MET CA CB sing N N 247 MET CA HA sing N N 248 MET C O doub N N 249 MET C OXT sing N N 250 MET CB CG sing N N 251 MET CB HB2 sing N N 252 MET CB HB3 sing N N 253 MET CG SD sing N N 254 MET CG HG2 sing N N 255 MET CG HG3 sing N N 256 MET SD CE sing N N 257 MET CE HE1 sing N N 258 MET CE HE2 sing N N 259 MET CE HE3 sing N N 260 MET OXT HXT sing N N 261 PHE N CA sing N N 262 PHE N H sing N N 263 PHE N H2 sing N N 264 PHE CA C sing N N 265 PHE CA CB sing N N 266 PHE CA HA sing N N 267 PHE C O doub N N 268 PHE C OXT sing N N 269 PHE CB CG sing N N 270 PHE CB HB2 sing N N 271 PHE CB HB3 sing N N 272 PHE CG CD1 doub Y N 273 PHE CG CD2 sing Y N 274 PHE CD1 CE1 sing Y N 275 PHE CD1 HD1 sing N N 276 PHE CD2 CE2 doub Y N 277 PHE CD2 HD2 sing N N 278 PHE CE1 CZ doub Y N 279 PHE CE1 HE1 sing N N 280 PHE CE2 CZ sing Y N 281 PHE CE2 HE2 sing N N 282 PHE CZ HZ sing N N 283 PHE OXT HXT sing N N 284 PRO N CA sing N N 285 PRO N CD sing N N 286 PRO N H sing N N 287 PRO CA C sing N N 288 PRO CA CB sing N N 289 PRO CA HA sing N N 290 PRO C O doub N N 291 PRO C OXT sing N N 292 PRO CB CG sing N N 293 PRO CB HB2 sing N N 294 PRO CB HB3 sing N N 295 PRO CG CD sing N N 296 PRO CG HG2 sing N N 297 PRO CG HG3 sing N N 298 PRO CD HD2 sing N N 299 PRO CD HD3 sing N N 300 PRO OXT HXT sing N N 301 SER N CA sing N N 302 SER N H sing N N 303 SER N H2 sing N N 304 SER CA C sing N N 305 SER CA CB sing N N 306 SER CA HA sing N N 307 SER C O doub N N 308 SER C OXT sing N N 309 SER CB OG sing N N 310 SER CB HB2 sing N N 311 SER CB HB3 sing N N 312 SER OG HG sing N N 313 SER OXT HXT sing N N 314 SO4 S O1 doub N N 315 SO4 S O2 doub N N 316 SO4 S O3 sing N N 317 SO4 S O4 sing N N 318 THR N CA sing N N 319 THR N H sing N N 320 THR N H2 sing N N 321 THR CA C sing N N 322 THR CA CB sing N N 323 THR CA HA sing N N 324 THR C O doub N N 325 THR C OXT sing N N 326 THR CB OG1 sing N N 327 THR CB CG2 sing N N 328 THR CB HB sing N N 329 THR OG1 HG1 sing N N 330 THR CG2 HG21 sing N N 331 THR CG2 HG22 sing N N 332 THR CG2 HG23 sing N N 333 THR OXT HXT sing N N 334 TRP N CA sing N N 335 TRP N H sing N N 336 TRP N H2 sing N N 337 TRP CA C sing N N 338 TRP CA CB sing N N 339 TRP CA HA sing N N 340 TRP C O doub N N 341 TRP C OXT sing N N 342 TRP CB CG sing N N 343 TRP CB HB2 sing N N 344 TRP CB HB3 sing N N 345 TRP CG CD1 doub Y N 346 TRP CG CD2 sing Y N 347 TRP CD1 NE1 sing Y N 348 TRP CD1 HD1 sing N N 349 TRP CD2 CE2 doub Y N 350 TRP CD2 CE3 sing Y N 351 TRP NE1 CE2 sing Y N 352 TRP NE1 HE1 sing N N 353 TRP CE2 CZ2 sing Y N 354 TRP CE3 CZ3 doub Y N 355 TRP CE3 HE3 sing N N 356 TRP CZ2 CH2 doub Y N 357 TRP CZ2 HZ2 sing N N 358 TRP CZ3 CH2 sing Y N 359 TRP CZ3 HZ3 sing N N 360 TRP CH2 HH2 sing N N 361 TRP OXT HXT sing N N 362 TYR N CA sing N N 363 TYR N H sing N N 364 TYR N H2 sing N N 365 TYR CA C sing N N 366 TYR CA CB sing N N 367 TYR CA HA sing N N 368 TYR C O doub N N 369 TYR C OXT sing N N 370 TYR CB CG sing N N 371 TYR CB HB2 sing N N 372 TYR CB HB3 sing N N 373 TYR CG CD1 doub Y N 374 TYR CG CD2 sing Y N 375 TYR CD1 CE1 sing Y N 376 TYR CD1 HD1 sing N N 377 TYR CD2 CE2 doub Y N 378 TYR CD2 HD2 sing N N 379 TYR CE1 CZ doub Y N 380 TYR CE1 HE1 sing N N 381 TYR CE2 CZ sing Y N 382 TYR CE2 HE2 sing N N 383 TYR CZ OH sing N N 384 TYR OH HH sing N N 385 TYR OXT HXT sing N N 386 VAL N CA sing N N 387 VAL N H sing N N 388 VAL N H2 sing N N 389 VAL CA C sing N N 390 VAL CA CB sing N N 391 VAL CA HA sing N N 392 VAL C O doub N N 393 VAL C OXT sing N N 394 VAL CB CG1 sing N N 395 VAL CB CG2 sing N N 396 VAL CB HB sing N N 397 VAL CG1 HG11 sing N N 398 VAL CG1 HG12 sing N N 399 VAL CG1 HG13 sing N N 400 VAL CG2 HG21 sing N N 401 VAL CG2 HG22 sing N N 402 VAL CG2 HG23 sing N N 403 VAL OXT HXT sing N N 404 # _pdbx_audit_support.funding_organization 'Howard Hughes Medical Institute (HHMI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1ayd _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 43 21 2' _space_group.name_Hall 'P 4nw 2abw' _space_group.IT_number 96 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 9Y5X _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.015805 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015805 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013109 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #