data_9Y8H # _entry.id 9Y8H # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.406 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9Y8H pdb_00009y8h 10.2210/pdb9y8h/pdb WWPDB D_1000300061 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-09-24 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9Y8H _pdbx_database_status.recvd_initial_deposition_date 2025-09-11 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 swlovell@ku.edu Scott Lovell ? 'principal investigator/group leader' 0000-0002-3215-4472 3 isabelle.phan@seattlechildrens.org Isabelle Phan ? 'principal investigator/group leader' 0000-0001-6873-3401 4 julie.early@seattlechildrens.org Julie Early ? 'principal investigator/group leader' 0000-0003-1224-2747 5 peter.myler@seattlechildrens.org Peter Myler ? 'principal investigator/group leader' 0000-0002-0056-0513 # _audit_author.name 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of Ornithine carbamoyltransferase from Burkholderia xenovorans in complex with phosphono carbamate' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, L.' 1 0000-0003-0514-281X primary 'Lovell, S.' 2 0000-0002-3215-4472 primary 'Battaile, K.P.' 3 0000-0003-0833-3259 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ornithine carbamoyltransferase' 38211.285 1 2.1.3.3 ? ? ? 2 non-polymer syn 'PHOSPHORIC ACID MONO(FORMAMIDE)ESTER' 141.020 1 ? ? ? ? 3 non-polymer syn 'PHOSPHATE ION' 94.971 4 ? ? ? ? 4 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 5 water nat water 18.015 11 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name OTCase # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MAHHHHHHFNVHNRSYLTLIEYTPRQIRYLLDLSRDLKRAKYAGTETPRLNGKNIALIFEKTSTRTRCAFEVAAHDQGAH VTYIDPNGSQIGHKESMKDTARVLGRMYDAIEYRGFGQEIVEELAKYAGVPVYNGLTDEFHPTQMLADVLTMHEFSDRPI HDIAYCYIGDAHNNTGNSLMIVGAKLGMDVRLCAPRCLWPHDELIEQCRAIAATTGARLTLTEKPEEAVKGVDFIYTDVW VSMGEPFEKWGARIEELLPYRVNAALLAASGNPRVKFMHCLPAFHDSNTHVGKQIADQYGLPNGVEVTDDVFESDASIVF EQAENRLHTIKAILVATLT ; _entity_poly.pdbx_seq_one_letter_code_can ;MAHHHHHHFNVHNRSYLTLIEYTPRQIRYLLDLSRDLKRAKYAGTETPRLNGKNIALIFEKTSTRTRCAFEVAAHDQGAH VTYIDPNGSQIGHKESMKDTARVLGRMYDAIEYRGFGQEIVEELAKYAGVPVYNGLTDEFHPTQMLADVLTMHEFSDRPI HDIAYCYIGDAHNNTGNSLMIVGAKLGMDVRLCAPRCLWPHDELIEQCRAIAATTGARLTLTEKPEEAVKGVDFIYTDVW VSMGEPFEKWGARIEELLPYRVNAALLAASGNPRVKFMHCLPAFHDSNTHVGKQIADQYGLPNGVEVTDDVFESDASIVF EQAENRLHTIKAILVATLT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PHOSPHORIC ACID MONO(FORMAMIDE)ESTER' CP 3 'PHOSPHATE ION' PO4 4 'CHLORIDE ION' CL 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 PHE n 1 10 ASN n 1 11 VAL n 1 12 HIS n 1 13 ASN n 1 14 ARG n 1 15 SER n 1 16 TYR n 1 17 LEU n 1 18 THR n 1 19 LEU n 1 20 ILE n 1 21 GLU n 1 22 TYR n 1 23 THR n 1 24 PRO n 1 25 ARG n 1 26 GLN n 1 27 ILE n 1 28 ARG n 1 29 TYR n 1 30 LEU n 1 31 LEU n 1 32 ASP n 1 33 LEU n 1 34 SER n 1 35 ARG n 1 36 ASP n 1 37 LEU n 1 38 LYS n 1 39 ARG n 1 40 ALA n 1 41 LYS n 1 42 TYR n 1 43 ALA n 1 44 GLY n 1 45 THR n 1 46 GLU n 1 47 THR n 1 48 PRO n 1 49 ARG n 1 50 LEU n 1 51 ASN n 1 52 GLY n 1 53 LYS n 1 54 ASN n 1 55 ILE n 1 56 ALA n 1 57 LEU n 1 58 ILE n 1 59 PHE n 1 60 GLU n 1 61 LYS n 1 62 THR n 1 63 SER n 1 64 THR n 1 65 ARG n 1 66 THR n 1 67 ARG n 1 68 CYS n 1 69 ALA n 1 70 PHE n 1 71 GLU n 1 72 VAL n 1 73 ALA n 1 74 ALA n 1 75 HIS n 1 76 ASP n 1 77 GLN n 1 78 GLY n 1 79 ALA n 1 80 HIS n 1 81 VAL n 1 82 THR n 1 83 TYR n 1 84 ILE n 1 85 ASP n 1 86 PRO n 1 87 ASN n 1 88 GLY n 1 89 SER n 1 90 GLN n 1 91 ILE n 1 92 GLY n 1 93 HIS n 1 94 LYS n 1 95 GLU n 1 96 SER n 1 97 MET n 1 98 LYS n 1 99 ASP n 1 100 THR n 1 101 ALA n 1 102 ARG n 1 103 VAL n 1 104 LEU n 1 105 GLY n 1 106 ARG n 1 107 MET n 1 108 TYR n 1 109 ASP n 1 110 ALA n 1 111 ILE n 1 112 GLU n 1 113 TYR n 1 114 ARG n 1 115 GLY n 1 116 PHE n 1 117 GLY n 1 118 GLN n 1 119 GLU n 1 120 ILE n 1 121 VAL n 1 122 GLU n 1 123 GLU n 1 124 LEU n 1 125 ALA n 1 126 LYS n 1 127 TYR n 1 128 ALA n 1 129 GLY n 1 130 VAL n 1 131 PRO n 1 132 VAL n 1 133 TYR n 1 134 ASN n 1 135 GLY n 1 136 LEU n 1 137 THR n 1 138 ASP n 1 139 GLU n 1 140 PHE n 1 141 HIS n 1 142 PRO n 1 143 THR n 1 144 GLN n 1 145 MET n 1 146 LEU n 1 147 ALA n 1 148 ASP n 1 149 VAL n 1 150 LEU n 1 151 THR n 1 152 MET n 1 153 HIS n 1 154 GLU n 1 155 PHE n 1 156 SER n 1 157 ASP n 1 158 ARG n 1 159 PRO n 1 160 ILE n 1 161 HIS n 1 162 ASP n 1 163 ILE n 1 164 ALA n 1 165 TYR n 1 166 CYS n 1 167 TYR n 1 168 ILE n 1 169 GLY n 1 170 ASP n 1 171 ALA n 1 172 HIS n 1 173 ASN n 1 174 ASN n 1 175 THR n 1 176 GLY n 1 177 ASN n 1 178 SER n 1 179 LEU n 1 180 MET n 1 181 ILE n 1 182 VAL n 1 183 GLY n 1 184 ALA n 1 185 LYS n 1 186 LEU n 1 187 GLY n 1 188 MET n 1 189 ASP n 1 190 VAL n 1 191 ARG n 1 192 LEU n 1 193 CYS n 1 194 ALA n 1 195 PRO n 1 196 ARG n 1 197 CYS n 1 198 LEU n 1 199 TRP n 1 200 PRO n 1 201 HIS n 1 202 ASP n 1 203 GLU n 1 204 LEU n 1 205 ILE n 1 206 GLU n 1 207 GLN n 1 208 CYS n 1 209 ARG n 1 210 ALA n 1 211 ILE n 1 212 ALA n 1 213 ALA n 1 214 THR n 1 215 THR n 1 216 GLY n 1 217 ALA n 1 218 ARG n 1 219 LEU n 1 220 THR n 1 221 LEU n 1 222 THR n 1 223 GLU n 1 224 LYS n 1 225 PRO n 1 226 GLU n 1 227 GLU n 1 228 ALA n 1 229 VAL n 1 230 LYS n 1 231 GLY n 1 232 VAL n 1 233 ASP n 1 234 PHE n 1 235 ILE n 1 236 TYR n 1 237 THR n 1 238 ASP n 1 239 VAL n 1 240 TRP n 1 241 VAL n 1 242 SER n 1 243 MET n 1 244 GLY n 1 245 GLU n 1 246 PRO n 1 247 PHE n 1 248 GLU n 1 249 LYS n 1 250 TRP n 1 251 GLY n 1 252 ALA n 1 253 ARG n 1 254 ILE n 1 255 GLU n 1 256 GLU n 1 257 LEU n 1 258 LEU n 1 259 PRO n 1 260 TYR n 1 261 ARG n 1 262 VAL n 1 263 ASN n 1 264 ALA n 1 265 ALA n 1 266 LEU n 1 267 LEU n 1 268 ALA n 1 269 ALA n 1 270 SER n 1 271 GLY n 1 272 ASN n 1 273 PRO n 1 274 ARG n 1 275 VAL n 1 276 LYS n 1 277 PHE n 1 278 MET n 1 279 HIS n 1 280 CYS n 1 281 LEU n 1 282 PRO n 1 283 ALA n 1 284 PHE n 1 285 HIS n 1 286 ASP n 1 287 SER n 1 288 ASN n 1 289 THR n 1 290 HIS n 1 291 VAL n 1 292 GLY n 1 293 LYS n 1 294 GLN n 1 295 ILE n 1 296 ALA n 1 297 ASP n 1 298 GLN n 1 299 TYR n 1 300 GLY n 1 301 LEU n 1 302 PRO n 1 303 ASN n 1 304 GLY n 1 305 VAL n 1 306 GLU n 1 307 VAL n 1 308 THR n 1 309 ASP n 1 310 ASP n 1 311 VAL n 1 312 PHE n 1 313 GLU n 1 314 SER n 1 315 ASP n 1 316 ALA n 1 317 SER n 1 318 ILE n 1 319 VAL n 1 320 PHE n 1 321 GLU n 1 322 GLN n 1 323 ALA n 1 324 GLU n 1 325 ASN n 1 326 ARG n 1 327 LEU n 1 328 HIS n 1 329 THR n 1 330 ILE n 1 331 LYS n 1 332 ALA n 1 333 ILE n 1 334 LEU n 1 335 VAL n 1 336 ALA n 1 337 THR n 1 338 LEU n 1 339 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 339 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'argF, Bxe_C0747' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Paraburkholderia xenovorans LB400' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 266265 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name BuxeA.00088.a.B2 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CP non-polymer . 'PHOSPHORIC ACID MONO(FORMAMIDE)ESTER' ? 'C H4 N O5 P' 141.020 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -6 ? ? ? A . n A 1 2 ALA 2 -5 ? ? ? A . n A 1 3 HIS 3 -4 ? ? ? A . n A 1 4 HIS 4 -3 ? ? ? A . n A 1 5 HIS 5 -2 ? ? ? A . n A 1 6 HIS 6 -1 ? ? ? A . n A 1 7 HIS 7 0 ? ? ? A . n A 1 8 HIS 8 1 ? ? ? A . n A 1 9 PHE 9 2 2 PHE PHE A . n A 1 10 ASN 10 3 3 ASN ASN A . n A 1 11 VAL 11 4 4 VAL VAL A . n A 1 12 HIS 12 5 5 HIS HIS A . n A 1 13 ASN 13 6 6 ASN ASN A . n A 1 14 ARG 14 7 7 ARG ARG A . n A 1 15 SER 15 8 8 SER SER A . n A 1 16 TYR 16 9 9 TYR TYR A . n A 1 17 LEU 17 10 10 LEU LEU A . n A 1 18 THR 18 11 11 THR THR A . n A 1 19 LEU 19 12 12 LEU LEU A . n A 1 20 ILE 20 13 13 ILE ILE A . n A 1 21 GLU 21 14 14 GLU GLU A . n A 1 22 TYR 22 15 15 TYR TYR A . n A 1 23 THR 23 16 16 THR THR A . n A 1 24 PRO 24 17 17 PRO PRO A . n A 1 25 ARG 25 18 18 ARG ARG A . n A 1 26 GLN 26 19 19 GLN GLN A . n A 1 27 ILE 27 20 20 ILE ILE A . n A 1 28 ARG 28 21 21 ARG ARG A . n A 1 29 TYR 29 22 22 TYR TYR A . n A 1 30 LEU 30 23 23 LEU LEU A . n A 1 31 LEU 31 24 24 LEU LEU A . n A 1 32 ASP 32 25 25 ASP ASP A . n A 1 33 LEU 33 26 26 LEU LEU A . n A 1 34 SER 34 27 27 SER SER A . n A 1 35 ARG 35 28 28 ARG ARG A . n A 1 36 ASP 36 29 29 ASP ASP A . n A 1 37 LEU 37 30 30 LEU LEU A . n A 1 38 LYS 38 31 31 LYS LYS A . n A 1 39 ARG 39 32 32 ARG ARG A . n A 1 40 ALA 40 33 33 ALA ALA A . n A 1 41 LYS 41 34 34 LYS LYS A . n A 1 42 TYR 42 35 35 TYR TYR A . n A 1 43 ALA 43 36 36 ALA ALA A . n A 1 44 GLY 44 37 37 GLY GLY A . n A 1 45 THR 45 38 38 THR THR A . n A 1 46 GLU 46 39 39 GLU GLU A . n A 1 47 THR 47 40 40 THR THR A . n A 1 48 PRO 48 41 41 PRO PRO A . n A 1 49 ARG 49 42 42 ARG ARG A . n A 1 50 LEU 50 43 43 LEU LEU A . n A 1 51 ASN 51 44 44 ASN ASN A . n A 1 52 GLY 52 45 45 GLY GLY A . n A 1 53 LYS 53 46 46 LYS LYS A . n A 1 54 ASN 54 47 47 ASN ASN A . n A 1 55 ILE 55 48 48 ILE ILE A . n A 1 56 ALA 56 49 49 ALA ALA A . n A 1 57 LEU 57 50 50 LEU LEU A . n A 1 58 ILE 58 51 51 ILE ILE A . n A 1 59 PHE 59 52 52 PHE PHE A . n A 1 60 GLU 60 53 53 GLU GLU A . n A 1 61 LYS 61 54 54 LYS LYS A . n A 1 62 THR 62 55 55 THR THR A . n A 1 63 SER 63 56 56 SER SER A . n A 1 64 THR 64 57 57 THR THR A . n A 1 65 ARG 65 58 58 ARG ARG A . n A 1 66 THR 66 59 59 THR THR A . n A 1 67 ARG 67 60 60 ARG ARG A . n A 1 68 CYS 68 61 61 CYS CYS A . n A 1 69 ALA 69 62 62 ALA ALA A . n A 1 70 PHE 70 63 63 PHE PHE A . n A 1 71 GLU 71 64 64 GLU GLU A . n A 1 72 VAL 72 65 65 VAL VAL A . n A 1 73 ALA 73 66 66 ALA ALA A . n A 1 74 ALA 74 67 67 ALA ALA A . n A 1 75 HIS 75 68 68 HIS HIS A . n A 1 76 ASP 76 69 69 ASP ASP A . n A 1 77 GLN 77 70 70 GLN GLN A . n A 1 78 GLY 78 71 71 GLY GLY A . n A 1 79 ALA 79 72 72 ALA ALA A . n A 1 80 HIS 80 73 73 HIS HIS A . n A 1 81 VAL 81 74 74 VAL VAL A . n A 1 82 THR 82 75 75 THR THR A . n A 1 83 TYR 83 76 76 TYR TYR A . n A 1 84 ILE 84 77 77 ILE ILE A . n A 1 85 ASP 85 78 78 ASP ASP A . n A 1 86 PRO 86 79 79 PRO PRO A . n A 1 87 ASN 87 80 80 ASN ASN A . n A 1 88 GLY 88 81 ? ? ? A . n A 1 89 SER 89 82 ? ? ? A . n A 1 90 GLN 90 83 83 GLN GLN A . n A 1 91 ILE 91 84 84 ILE ILE A . n A 1 92 GLY 92 85 85 GLY GLY A . n A 1 93 HIS 93 86 86 HIS HIS A . n A 1 94 LYS 94 87 87 LYS LYS A . n A 1 95 GLU 95 88 88 GLU GLU A . n A 1 96 SER 96 89 89 SER SER A . n A 1 97 MET 97 90 90 MET MET A . n A 1 98 LYS 98 91 91 LYS LYS A . n A 1 99 ASP 99 92 92 ASP ASP A . n A 1 100 THR 100 93 93 THR THR A . n A 1 101 ALA 101 94 94 ALA ALA A . n A 1 102 ARG 102 95 95 ARG ARG A . n A 1 103 VAL 103 96 96 VAL VAL A . n A 1 104 LEU 104 97 97 LEU LEU A . n A 1 105 GLY 105 98 98 GLY GLY A . n A 1 106 ARG 106 99 99 ARG ARG A . n A 1 107 MET 107 100 100 MET MET A . n A 1 108 TYR 108 101 101 TYR TYR A . n A 1 109 ASP 109 102 102 ASP ASP A . n A 1 110 ALA 110 103 103 ALA ALA A . n A 1 111 ILE 111 104 104 ILE ILE A . n A 1 112 GLU 112 105 105 GLU GLU A . n A 1 113 TYR 113 106 106 TYR TYR A . n A 1 114 ARG 114 107 107 ARG ARG A . n A 1 115 GLY 115 108 108 GLY GLY A . n A 1 116 PHE 116 109 109 PHE PHE A . n A 1 117 GLY 117 110 110 GLY GLY A . n A 1 118 GLN 118 111 111 GLN GLN A . n A 1 119 GLU 119 112 112 GLU GLU A . n A 1 120 ILE 120 113 113 ILE ILE A . n A 1 121 VAL 121 114 114 VAL VAL A . n A 1 122 GLU 122 115 115 GLU GLU A . n A 1 123 GLU 123 116 116 GLU GLU A . n A 1 124 LEU 124 117 117 LEU LEU A . n A 1 125 ALA 125 118 118 ALA ALA A . n A 1 126 LYS 126 119 119 LYS LYS A . n A 1 127 TYR 127 120 120 TYR TYR A . n A 1 128 ALA 128 121 121 ALA ALA A . n A 1 129 GLY 129 122 122 GLY GLY A . n A 1 130 VAL 130 123 123 VAL VAL A . n A 1 131 PRO 131 124 124 PRO PRO A . n A 1 132 VAL 132 125 125 VAL VAL A . n A 1 133 TYR 133 126 126 TYR TYR A . n A 1 134 ASN 134 127 127 ASN ASN A . n A 1 135 GLY 135 128 128 GLY GLY A . n A 1 136 LEU 136 129 129 LEU LEU A . n A 1 137 THR 137 130 130 THR THR A . n A 1 138 ASP 138 131 131 ASP ASP A . n A 1 139 GLU 139 132 132 GLU GLU A . n A 1 140 PHE 140 133 133 PHE PHE A . n A 1 141 HIS 141 134 134 HIS HIS A . n A 1 142 PRO 142 135 135 PRO PRO A . n A 1 143 THR 143 136 136 THR THR A . n A 1 144 GLN 144 137 137 GLN GLN A . n A 1 145 MET 145 138 138 MET MET A . n A 1 146 LEU 146 139 139 LEU LEU A . n A 1 147 ALA 147 140 140 ALA ALA A . n A 1 148 ASP 148 141 141 ASP ASP A . n A 1 149 VAL 149 142 142 VAL VAL A . n A 1 150 LEU 150 143 143 LEU LEU A . n A 1 151 THR 151 144 144 THR THR A . n A 1 152 MET 152 145 145 MET MET A . n A 1 153 HIS 153 146 146 HIS HIS A . n A 1 154 GLU 154 147 147 GLU GLU A . n A 1 155 PHE 155 148 148 PHE PHE A . n A 1 156 SER 156 149 149 SER SER A . n A 1 157 ASP 157 150 150 ASP ASP A . n A 1 158 ARG 158 151 151 ARG ARG A . n A 1 159 PRO 159 152 152 PRO PRO A . n A 1 160 ILE 160 153 153 ILE ILE A . n A 1 161 HIS 161 154 154 HIS HIS A . n A 1 162 ASP 162 155 155 ASP ASP A . n A 1 163 ILE 163 156 156 ILE ILE A . n A 1 164 ALA 164 157 157 ALA ALA A . n A 1 165 TYR 165 158 158 TYR TYR A . n A 1 166 CYS 166 159 159 CYS CYS A . n A 1 167 TYR 167 160 160 TYR TYR A . n A 1 168 ILE 168 161 161 ILE ILE A . n A 1 169 GLY 169 162 162 GLY GLY A . n A 1 170 ASP 170 163 163 ASP ASP A . n A 1 171 ALA 171 164 164 ALA ALA A . n A 1 172 HIS 172 165 165 HIS HIS A . n A 1 173 ASN 173 166 166 ASN ASN A . n A 1 174 ASN 174 167 167 ASN ASN A . n A 1 175 THR 175 168 168 THR THR A . n A 1 176 GLY 176 169 169 GLY GLY A . n A 1 177 ASN 177 170 170 ASN ASN A . n A 1 178 SER 178 171 171 SER SER A . n A 1 179 LEU 179 172 172 LEU LEU A . n A 1 180 MET 180 173 173 MET MET A . n A 1 181 ILE 181 174 174 ILE ILE A . n A 1 182 VAL 182 175 175 VAL VAL A . n A 1 183 GLY 183 176 176 GLY GLY A . n A 1 184 ALA 184 177 177 ALA ALA A . n A 1 185 LYS 185 178 178 LYS LYS A . n A 1 186 LEU 186 179 179 LEU LEU A . n A 1 187 GLY 187 180 180 GLY GLY A . n A 1 188 MET 188 181 181 MET MET A . n A 1 189 ASP 189 182 182 ASP ASP A . n A 1 190 VAL 190 183 183 VAL VAL A . n A 1 191 ARG 191 184 184 ARG ARG A . n A 1 192 LEU 192 185 185 LEU LEU A . n A 1 193 CYS 193 186 186 CYS CYS A . n A 1 194 ALA 194 187 187 ALA ALA A . n A 1 195 PRO 195 188 188 PRO PRO A . n A 1 196 ARG 196 189 189 ARG ARG A . n A 1 197 CYS 197 190 190 CYS CYS A . n A 1 198 LEU 198 191 191 LEU LEU A . n A 1 199 TRP 199 192 192 TRP TRP A . n A 1 200 PRO 200 193 193 PRO PRO A . n A 1 201 HIS 201 194 194 HIS HIS A . n A 1 202 ASP 202 195 195 ASP ASP A . n A 1 203 GLU 203 196 196 GLU GLU A . n A 1 204 LEU 204 197 197 LEU LEU A . n A 1 205 ILE 205 198 198 ILE ILE A . n A 1 206 GLU 206 199 199 GLU GLU A . n A 1 207 GLN 207 200 200 GLN GLN A . n A 1 208 CYS 208 201 201 CYS CYS A . n A 1 209 ARG 209 202 202 ARG ARG A . n A 1 210 ALA 210 203 203 ALA ALA A . n A 1 211 ILE 211 204 204 ILE ILE A . n A 1 212 ALA 212 205 205 ALA ALA A . n A 1 213 ALA 213 206 206 ALA ALA A . n A 1 214 THR 214 207 207 THR THR A . n A 1 215 THR 215 208 208 THR THR A . n A 1 216 GLY 216 209 209 GLY GLY A . n A 1 217 ALA 217 210 210 ALA ALA A . n A 1 218 ARG 218 211 211 ARG ARG A . n A 1 219 LEU 219 212 212 LEU LEU A . n A 1 220 THR 220 213 213 THR THR A . n A 1 221 LEU 221 214 214 LEU LEU A . n A 1 222 THR 222 215 215 THR THR A . n A 1 223 GLU 223 216 216 GLU GLU A . n A 1 224 LYS 224 217 217 LYS LYS A . n A 1 225 PRO 225 218 218 PRO PRO A . n A 1 226 GLU 226 219 219 GLU GLU A . n A 1 227 GLU 227 220 220 GLU GLU A . n A 1 228 ALA 228 221 221 ALA ALA A . n A 1 229 VAL 229 222 222 VAL VAL A . n A 1 230 LYS 230 223 223 LYS LYS A . n A 1 231 GLY 231 224 224 GLY GLY A . n A 1 232 VAL 232 225 225 VAL VAL A . n A 1 233 ASP 233 226 226 ASP ASP A . n A 1 234 PHE 234 227 227 PHE PHE A . n A 1 235 ILE 235 228 228 ILE ILE A . n A 1 236 TYR 236 229 229 TYR TYR A . n A 1 237 THR 237 230 230 THR THR A . n A 1 238 ASP 238 231 231 ASP ASP A . n A 1 239 VAL 239 232 232 VAL VAL A . n A 1 240 TRP 240 233 233 TRP TRP A . n A 1 241 VAL 241 234 234 VAL VAL A . n A 1 242 SER 242 235 235 SER SER A . n A 1 243 MET 243 236 ? ? ? A . n A 1 244 GLY 244 237 ? ? ? A . n A 1 245 GLU 245 238 238 GLU GLU A . n A 1 246 PRO 246 239 239 PRO PRO A . n A 1 247 PHE 247 240 240 PHE PHE A . n A 1 248 GLU 248 241 241 GLU GLU A . n A 1 249 LYS 249 242 242 LYS LYS A . n A 1 250 TRP 250 243 243 TRP TRP A . n A 1 251 GLY 251 244 244 GLY GLY A . n A 1 252 ALA 252 245 245 ALA ALA A . n A 1 253 ARG 253 246 246 ARG ARG A . n A 1 254 ILE 254 247 247 ILE ILE A . n A 1 255 GLU 255 248 248 GLU GLU A . n A 1 256 GLU 256 249 249 GLU GLU A . n A 1 257 LEU 257 250 250 LEU LEU A . n A 1 258 LEU 258 251 251 LEU LEU A . n A 1 259 PRO 259 252 252 PRO PRO A . n A 1 260 TYR 260 253 253 TYR TYR A . n A 1 261 ARG 261 254 254 ARG ARG A . n A 1 262 VAL 262 255 255 VAL VAL A . n A 1 263 ASN 263 256 256 ASN ASN A . n A 1 264 ALA 264 257 257 ALA ALA A . n A 1 265 ALA 265 258 258 ALA ALA A . n A 1 266 LEU 266 259 259 LEU LEU A . n A 1 267 LEU 267 260 260 LEU LEU A . n A 1 268 ALA 268 261 261 ALA ALA A . n A 1 269 ALA 269 262 262 ALA ALA A . n A 1 270 SER 270 263 263 SER SER A . n A 1 271 GLY 271 264 264 GLY GLY A . n A 1 272 ASN 272 265 265 ASN ASN A . n A 1 273 PRO 273 266 266 PRO PRO A . n A 1 274 ARG 274 267 267 ARG ARG A . n A 1 275 VAL 275 268 268 VAL VAL A . n A 1 276 LYS 276 269 269 LYS LYS A . n A 1 277 PHE 277 270 270 PHE PHE A . n A 1 278 MET 278 271 271 MET MET A . n A 1 279 HIS 279 272 272 HIS HIS A . n A 1 280 CYS 280 273 273 CYS CYS A . n A 1 281 LEU 281 274 274 LEU LEU A . n A 1 282 PRO 282 275 275 PRO PRO A . n A 1 283 ALA 283 276 276 ALA ALA A . n A 1 284 PHE 284 277 277 PHE PHE A . n A 1 285 HIS 285 278 278 HIS HIS A . n A 1 286 ASP 286 279 279 ASP ASP A . n A 1 287 SER 287 280 280 SER SER A . n A 1 288 ASN 288 281 281 ASN ASN A . n A 1 289 THR 289 282 282 THR THR A . n A 1 290 HIS 290 283 283 HIS HIS A . n A 1 291 VAL 291 284 284 VAL VAL A . n A 1 292 GLY 292 285 285 GLY GLY A . n A 1 293 LYS 293 286 286 LYS LYS A . n A 1 294 GLN 294 287 287 GLN GLN A . n A 1 295 ILE 295 288 288 ILE ILE A . n A 1 296 ALA 296 289 289 ALA ALA A . n A 1 297 ASP 297 290 290 ASP ASP A . n A 1 298 GLN 298 291 291 GLN GLN A . n A 1 299 TYR 299 292 292 TYR TYR A . n A 1 300 GLY 300 293 293 GLY GLY A . n A 1 301 LEU 301 294 294 LEU LEU A . n A 1 302 PRO 302 295 295 PRO PRO A . n A 1 303 ASN 303 296 296 ASN ASN A . n A 1 304 GLY 304 297 297 GLY GLY A . n A 1 305 VAL 305 298 298 VAL VAL A . n A 1 306 GLU 306 299 299 GLU GLU A . n A 1 307 VAL 307 300 300 VAL VAL A . n A 1 308 THR 308 301 301 THR THR A . n A 1 309 ASP 309 302 302 ASP ASP A . n A 1 310 ASP 310 303 303 ASP ASP A . n A 1 311 VAL 311 304 304 VAL VAL A . n A 1 312 PHE 312 305 305 PHE PHE A . n A 1 313 GLU 313 306 306 GLU GLU A . n A 1 314 SER 314 307 307 SER SER A . n A 1 315 ASP 315 308 308 ASP ASP A . n A 1 316 ALA 316 309 309 ALA ALA A . n A 1 317 SER 317 310 310 SER SER A . n A 1 318 ILE 318 311 311 ILE ILE A . n A 1 319 VAL 319 312 312 VAL VAL A . n A 1 320 PHE 320 313 313 PHE PHE A . n A 1 321 GLU 321 314 314 GLU GLU A . n A 1 322 GLN 322 315 315 GLN GLN A . n A 1 323 ALA 323 316 316 ALA ALA A . n A 1 324 GLU 324 317 317 GLU GLU A . n A 1 325 ASN 325 318 318 ASN ASN A . n A 1 326 ARG 326 319 319 ARG ARG A . n A 1 327 LEU 327 320 320 LEU LEU A . n A 1 328 HIS 328 321 321 HIS HIS A . n A 1 329 THR 329 322 322 THR THR A . n A 1 330 ILE 330 323 323 ILE ILE A . n A 1 331 LYS 331 324 324 LYS LYS A . n A 1 332 ALA 332 325 325 ALA ALA A . n A 1 333 ILE 333 326 326 ILE ILE A . n A 1 334 LEU 334 327 327 LEU LEU A . n A 1 335 VAL 335 328 328 VAL VAL A . n A 1 336 ALA 336 329 329 ALA ALA A . n A 1 337 THR 337 330 330 THR THR A . n A 1 338 LEU 338 331 331 LEU LEU A . n A 1 339 THR 339 332 332 THR THR A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id CP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id CP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CP 1 401 101 CP CP A . C 3 PO4 1 402 201 PO4 PO4 A . D 3 PO4 1 403 202 PO4 PO4 A . E 3 PO4 1 404 203 PO4 PO4 A . F 3 PO4 1 405 204 PO4 PO4 A . G 4 CL 1 406 301 CL CL A . H 5 HOH 1 501 10 HOH HOH A . H 5 HOH 2 502 7 HOH HOH A . H 5 HOH 3 503 4 HOH HOH A . H 5 HOH 4 504 8 HOH HOH A . H 5 HOH 5 505 11 HOH HOH A . H 5 HOH 6 506 5 HOH HOH A . H 5 HOH 7 507 9 HOH HOH A . H 5 HOH 8 508 1 HOH HOH A . H 5 HOH 9 509 2 HOH HOH A . H 5 HOH 10 510 3 HOH HOH A . H 5 HOH 11 511 12 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A PHE 2 ? CG ? A PHE 9 CG 2 1 Y 1 A PHE 2 ? CD1 ? A PHE 9 CD1 3 1 Y 1 A PHE 2 ? CD2 ? A PHE 9 CD2 4 1 Y 1 A PHE 2 ? CE1 ? A PHE 9 CE1 5 1 Y 1 A PHE 2 ? CE2 ? A PHE 9 CE2 6 1 Y 1 A PHE 2 ? CZ ? A PHE 9 CZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(2.0_5806: ???)' ? 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . ? 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? . ? 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9Y8H _cell.details ? _cell.formula_units_Z ? _cell.length_a 131.498 _cell.length_a_esd ? _cell.length_b 131.498 _cell.length_b_esd ? _cell.length_c 131.498 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9Y8H _symmetry.cell_setting ? _symmetry.Int_Tables_number 197 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9Y8H _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.48 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.39 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.9 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Index G6 : 1.4 M Sodium phosphate monobasic / Potassium phosphate dibasic pH 6.9. BuxeA.00088.a.B2.PW39423 at 24.5 mg/mL. plate 20257 B6 drop 3 , Puck: PSL-0315, Cryo: 4.0 M Sodium phosphate monobasic / Potassium phosphate dibasic pH 6.9 ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 XE 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2025-08-09 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Double Crystal Si 111' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9786 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS-II BEAMLINE 19-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9786 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 19-ID _diffrn_source.pdbx_synchrotron_site NSLS-II # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9Y8H _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.67 _reflns.d_resolution_low 46.49 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10905 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20.0 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 19.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.09 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.186 _reflns.pdbx_Rpim_I_all 0.041 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 217846 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.181 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.67 _reflns_shell.d_res_low 2.74 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all 16451 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 801 _reflns_shell.percent_possible_obs 100.0 _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 20.5 _reflns_shell.pdbx_chi_squared 0.96 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 1.7 _reflns_shell.pdbx_Rrim_I_all 2.245 _reflns_shell.pdbx_Rpim_I_all 0.493 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.664 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 2.190 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9Y8H _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.67 _refine.ls_d_res_low 46.49 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10903 _refine.ls_number_reflns_R_free 531 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.98 _refine.ls_percent_reflns_R_free 4.87 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1965 _refine.ls_R_factor_R_free 0.2515 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1935 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.23 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.36 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.67 _refine_hist.d_res_low 46.49 _refine_hist.number_atoms_solvent 11 _refine_hist.number_atoms_total 2625 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2585 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 29 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 2663 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.518 ? 3617 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 17.219 ? 972 ? f_dihedral_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.039 ? 401 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 468 ? f_plane_restr ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.67 2.94 . . 129 2557 100.00 . . . . 0.2829 . . . . . . . . . . . . . . . 0.3483 'X-RAY DIFFRACTION' 2.94 3.36 . . 113 2585 100.00 . . . . 0.2277 . . . . . . . . . . . . . . . 0.3427 'X-RAY DIFFRACTION' 3.37 4.24 . . 134 2587 100.00 . . . . 0.1940 . . . . . . . . . . . . . . . 0.2440 'X-RAY DIFFRACTION' 4.24 46.49 . . 155 2643 100.00 . . . . 0.1638 . . . . . . . . . . . . . . . 0.2158 # _struct.entry_id 9Y8H _struct.title 'Crystal structure of Ornithine carbamoyltransferase from Burkholderia xenovorans in complex with phosphono carbamate' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9Y8H _struct_keywords.text 'SSGCID, STRUCTURAL GENOMICS, SEATTLE STRUCTURAL GENOMICS CENTER FOR INFECTIOUS DISEASE, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 4 ? H N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q13H08_PARXL _struct_ref.pdbx_db_accession Q13H08 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;FNVHNRSYLTLIEYTPRQIRYLLDLSRDLKRAKYAGTETPRLNGKNIALIFEKTSTRTRCAFEVAAHDQGAHVTYIDPNG SQIGHKESMKDTARVLGRMYDAIEYRGFGQEIVEELAKYAGVPVYNGLTDEFHPTQMLADVLTMHEFSDRPIHDIAYCYI GDAHNNTGNSLMIVGAKLGMDVRLCAPRCLWPHDELIEQCRAIAATTGARLTLTEKPEEAVKGVDFIYTDVWVSMGEPFE KWGARIEELLPYRVNAALLAASGNPRVKFMHCLPAFHDSNTHVGKQIADQYGLPNGVEVTDDVFESDASIVFEQAENRLH TIKAILVATLT ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9Y8H _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 9 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 339 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q13H08 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 332 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 332 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9Y8H MET A 1 ? UNP Q13H08 ? ? 'initiating methionine' -6 1 1 9Y8H ALA A 2 ? UNP Q13H08 ? ? 'expression tag' -5 2 1 9Y8H HIS A 3 ? UNP Q13H08 ? ? 'expression tag' -4 3 1 9Y8H HIS A 4 ? UNP Q13H08 ? ? 'expression tag' -3 4 1 9Y8H HIS A 5 ? UNP Q13H08 ? ? 'expression tag' -2 5 1 9Y8H HIS A 6 ? UNP Q13H08 ? ? 'expression tag' -1 6 1 9Y8H HIS A 7 ? UNP Q13H08 ? ? 'expression tag' 0 7 1 9Y8H HIS A 8 ? UNP Q13H08 ? ? 'expression tag' 1 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dodecameric _pdbx_struct_assembly.oligomeric_count 12 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 56770 ? 1 MORE -435 ? 1 'SSA (A^2)' 124960 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4,5,6,7,8,9,10,11,12 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 5 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 6 'crystal symmetry operation' 6_555 z,-x,-y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 7 'crystal symmetry operation' 7_555 -z,-x,y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 8 'crystal symmetry operation' 8_555 -z,x,-y 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 9 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 10 'crystal symmetry operation' 10_555 -y,z,-x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 11 'crystal symmetry operation' 11_555 y,-z,-x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 12 'crystal symmetry operation' 12_555 -y,-z,x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 18 ? TYR A 22 ? THR A 11 TYR A 15 5 ? 5 HELX_P HELX_P2 AA2 THR A 23 ? GLY A 44 ? THR A 16 GLY A 37 1 ? 22 HELX_P HELX_P3 AA3 THR A 64 ? GLN A 77 ? THR A 57 GLN A 70 1 ? 14 HELX_P HELX_P4 AA4 SER A 96 ? TYR A 108 ? SER A 89 TYR A 101 1 ? 13 HELX_P HELX_P5 AA5 GLY A 117 ? GLY A 129 ? GLY A 110 GLY A 122 1 ? 13 HELX_P HELX_P6 AA6 HIS A 141 ? PHE A 155 ? HIS A 134 PHE A 148 1 ? 15 HELX_P HELX_P7 AA7 PRO A 159 ? ASP A 162 ? PRO A 152 ASP A 155 5 ? 4 HELX_P HELX_P8 AA8 ASN A 173 ? GLY A 187 ? ASN A 166 GLY A 180 1 ? 15 HELX_P HELX_P9 AA9 PRO A 195 ? TRP A 199 ? PRO A 188 TRP A 192 5 ? 5 HELX_P HELX_P10 AB1 HIS A 201 ? GLY A 216 ? HIS A 194 GLY A 209 1 ? 16 HELX_P HELX_P11 AB2 LYS A 224 ? VAL A 229 ? LYS A 217 VAL A 222 1 ? 6 HELX_P HELX_P12 AB3 GLU A 248 ? LEU A 258 ? GLU A 241 LEU A 251 1 ? 11 HELX_P HELX_P13 AB4 PRO A 259 ? ARG A 261 ? PRO A 252 ARG A 254 5 ? 3 HELX_P HELX_P14 AB5 ASN A 263 ? SER A 270 ? ASN A 256 SER A 263 1 ? 8 HELX_P HELX_P15 AB6 THR A 289 ? GLY A 300 ? THR A 282 GLY A 293 1 ? 12 HELX_P HELX_P16 AB7 THR A 308 ? SER A 314 ? THR A 301 SER A 307 1 ? 7 HELX_P HELX_P17 AB8 ILE A 318 ? THR A 339 ? ILE A 311 THR A 332 1 ? 22 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 281 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 274 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 282 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 275 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.99 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? parallel AA2 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 HIS A 80 ? ILE A 84 ? HIS A 73 ILE A 77 AA1 2 ASN A 54 ? PHE A 59 ? ASN A 47 PHE A 52 AA1 3 ALA A 110 ? ARG A 114 ? ALA A 103 ARG A 107 AA1 4 VAL A 132 ? LEU A 136 ? VAL A 125 LEU A 129 AA2 1 ARG A 218 ? THR A 222 ? ARG A 211 THR A 215 AA2 2 ASP A 189 ? CYS A 193 ? ASP A 182 CYS A 186 AA2 3 ALA A 164 ? ILE A 168 ? ALA A 157 ILE A 161 AA2 4 PHE A 234 ? THR A 237 ? PHE A 227 THR A 230 AA2 5 LYS A 276 ? HIS A 279 ? LYS A 269 HIS A 272 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O THR A 82 ? O THR A 75 N LEU A 57 ? N LEU A 50 AA1 2 3 N ILE A 58 ? N ILE A 51 O GLU A 112 ? O GLU A 105 AA1 3 4 N ILE A 111 ? N ILE A 104 O TYR A 133 ? O TYR A 126 AA2 1 2 O THR A 222 ? O THR A 215 N LEU A 192 ? N LEU A 185 AA2 2 3 O CYS A 193 ? O CYS A 186 N TYR A 167 ? N TYR A 160 AA2 3 4 N CYS A 166 ? N CYS A 159 O TYR A 236 ? O TYR A 229 AA2 4 5 N ILE A 235 ? N ILE A 228 O MET A 278 ? O MET A 271 # _pdbx_entry_details.entry_id 9Y8H _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 129 ? ? -172.03 137.35 2 1 HIS A 134 ? ? -155.76 64.61 3 1 LEU A 274 ? ? 75.52 151.82 4 1 VAL A 298 ? ? -101.34 -62.20 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NIAID, National Institute of Allergy and Infectious Diseases' _pdbx_SG_project.full_name_of_center 'Seattle Structural Genomics Center for Infectious Disease' _pdbx_SG_project.initial_of_center SSGCID # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A PO4 402 ? C PO4 . 2 1 A PO4 402 ? C PO4 . 3 1 A PO4 403 ? D PO4 . 4 1 A PO4 403 ? D PO4 . # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -25.3258 _pdbx_refine_tls.origin_y 0.4391 _pdbx_refine_tls.origin_z -32.5172 _pdbx_refine_tls.T[1][1] 0.3328 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0022 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0571 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.3357 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0011 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.3119 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 1.1458 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.2058 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.2155 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 1.0208 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.3161 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 1.1075 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.1632 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.2384 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.0099 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.2354 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.0489 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.2131 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.0972 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.1208 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.0951 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -6 ? A MET 1 2 1 Y 1 A ALA -5 ? A ALA 2 3 1 Y 1 A HIS -4 ? A HIS 3 4 1 Y 1 A HIS -3 ? A HIS 4 5 1 Y 1 A HIS -2 ? A HIS 5 6 1 Y 1 A HIS -1 ? A HIS 6 7 1 Y 1 A HIS 0 ? A HIS 7 8 1 Y 1 A HIS 1 ? A HIS 8 9 1 Y 1 A GLY 81 ? A GLY 88 10 1 Y 1 A SER 82 ? A SER 89 11 1 Y 1 A MET 236 ? A MET 243 12 1 Y 1 A GLY 237 ? A GLY 244 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CP N N N N 75 CP C C N N 76 CP O O N N 77 CP O4P O N N 78 CP P P N N 79 CP O1P O N N 80 CP O2P O N N 81 CP O3P O N N 82 CP HN1 H N N 83 CP HN2 H N N 84 CP HOP2 H N N 85 CP HOP3 H N N 86 CYS N N N N 87 CYS CA C N R 88 CYS C C N N 89 CYS O O N N 90 CYS CB C N N 91 CYS SG S N N 92 CYS OXT O N N 93 CYS H H N N 94 CYS H2 H N N 95 CYS HA H N N 96 CYS HB2 H N N 97 CYS HB3 H N N 98 CYS HG H N N 99 CYS HXT H N N 100 GLN N N N N 101 GLN CA C N S 102 GLN C C N N 103 GLN O O N N 104 GLN CB C N N 105 GLN CG C N N 106 GLN CD C N N 107 GLN OE1 O N N 108 GLN NE2 N N N 109 GLN OXT O N N 110 GLN H H N N 111 GLN H2 H N N 112 GLN HA H N N 113 GLN HB2 H N N 114 GLN HB3 H N N 115 GLN HG2 H N N 116 GLN HG3 H N N 117 GLN HE21 H N N 118 GLN HE22 H N N 119 GLN HXT H N N 120 GLU N N N N 121 GLU CA C N S 122 GLU C C N N 123 GLU O O N N 124 GLU CB C N N 125 GLU CG C N N 126 GLU CD C N N 127 GLU OE1 O N N 128 GLU OE2 O N N 129 GLU OXT O N N 130 GLU H H N N 131 GLU H2 H N N 132 GLU HA H N N 133 GLU HB2 H N N 134 GLU HB3 H N N 135 GLU HG2 H N N 136 GLU HG3 H N N 137 GLU HE2 H N N 138 GLU HXT H N N 139 GLY N N N N 140 GLY CA C N N 141 GLY C C N N 142 GLY O O N N 143 GLY OXT O N N 144 GLY H H N N 145 GLY H2 H N N 146 GLY HA2 H N N 147 GLY HA3 H N N 148 GLY HXT H N N 149 HIS N N N N 150 HIS CA C N S 151 HIS C C N N 152 HIS O O N N 153 HIS CB C N N 154 HIS CG C Y N 155 HIS ND1 N Y N 156 HIS CD2 C Y N 157 HIS CE1 C Y N 158 HIS NE2 N Y N 159 HIS OXT O N N 160 HIS H H N N 161 HIS H2 H N N 162 HIS HA H N N 163 HIS HB2 H N N 164 HIS HB3 H N N 165 HIS HD1 H N N 166 HIS HD2 H N N 167 HIS HE1 H N N 168 HIS HE2 H N N 169 HIS HXT H N N 170 HOH O O N N 171 HOH H1 H N N 172 HOH H2 H N N 173 ILE N N N N 174 ILE CA C N S 175 ILE C C N N 176 ILE O O N N 177 ILE CB C N S 178 ILE CG1 C N N 179 ILE CG2 C N N 180 ILE CD1 C N N 181 ILE OXT O N N 182 ILE H H N N 183 ILE H2 H N N 184 ILE HA H N N 185 ILE HB H N N 186 ILE HG12 H N N 187 ILE HG13 H N N 188 ILE HG21 H N N 189 ILE HG22 H N N 190 ILE HG23 H N N 191 ILE HD11 H N N 192 ILE HD12 H N N 193 ILE HD13 H N N 194 ILE HXT H N N 195 LEU N N N N 196 LEU CA C N S 197 LEU C C N N 198 LEU O O N N 199 LEU CB C N N 200 LEU CG C N N 201 LEU CD1 C N N 202 LEU CD2 C N N 203 LEU OXT O N N 204 LEU H H N N 205 LEU H2 H N N 206 LEU HA H N N 207 LEU HB2 H N N 208 LEU HB3 H N N 209 LEU HG H N N 210 LEU HD11 H N N 211 LEU HD12 H N N 212 LEU HD13 H N N 213 LEU HD21 H N N 214 LEU HD22 H N N 215 LEU HD23 H N N 216 LEU HXT H N N 217 LYS N N N N 218 LYS CA C N S 219 LYS C C N N 220 LYS O O N N 221 LYS CB C N N 222 LYS CG C N N 223 LYS CD C N N 224 LYS CE C N N 225 LYS NZ N N N 226 LYS OXT O N N 227 LYS H H N N 228 LYS H2 H N N 229 LYS HA H N N 230 LYS HB2 H N N 231 LYS HB3 H N N 232 LYS HG2 H N N 233 LYS HG3 H N N 234 LYS HD2 H N N 235 LYS HD3 H N N 236 LYS HE2 H N N 237 LYS HE3 H N N 238 LYS HZ1 H N N 239 LYS HZ2 H N N 240 LYS HZ3 H N N 241 LYS HXT H N N 242 MET N N N N 243 MET CA C N S 244 MET C C N N 245 MET O O N N 246 MET CB C N N 247 MET CG C N N 248 MET SD S N N 249 MET CE C N N 250 MET OXT O N N 251 MET H H N N 252 MET H2 H N N 253 MET HA H N N 254 MET HB2 H N N 255 MET HB3 H N N 256 MET HG2 H N N 257 MET HG3 H N N 258 MET HE1 H N N 259 MET HE2 H N N 260 MET HE3 H N N 261 MET HXT H N N 262 PHE N N N N 263 PHE CA C N S 264 PHE C C N N 265 PHE O O N N 266 PHE CB C N N 267 PHE CG C Y N 268 PHE CD1 C Y N 269 PHE CD2 C Y N 270 PHE CE1 C Y N 271 PHE CE2 C Y N 272 PHE CZ C Y N 273 PHE OXT O N N 274 PHE H H N N 275 PHE H2 H N N 276 PHE HA H N N 277 PHE HB2 H N N 278 PHE HB3 H N N 279 PHE HD1 H N N 280 PHE HD2 H N N 281 PHE HE1 H N N 282 PHE HE2 H N N 283 PHE HZ H N N 284 PHE HXT H N N 285 PO4 P P N N 286 PO4 O1 O N N 287 PO4 O2 O N N 288 PO4 O3 O N N 289 PO4 O4 O N N 290 PRO N N N N 291 PRO CA C N S 292 PRO C C N N 293 PRO O O N N 294 PRO CB C N N 295 PRO CG C N N 296 PRO CD C N N 297 PRO OXT O N N 298 PRO H H N N 299 PRO HA H N N 300 PRO HB2 H N N 301 PRO HB3 H N N 302 PRO HG2 H N N 303 PRO HG3 H N N 304 PRO HD2 H N N 305 PRO HD3 H N N 306 PRO HXT H N N 307 SER N N N N 308 SER CA C N S 309 SER C C N N 310 SER O O N N 311 SER CB C N N 312 SER OG O N N 313 SER OXT O N N 314 SER H H N N 315 SER H2 H N N 316 SER HA H N N 317 SER HB2 H N N 318 SER HB3 H N N 319 SER HG H N N 320 SER HXT H N N 321 THR N N N N 322 THR CA C N S 323 THR C C N N 324 THR O O N N 325 THR CB C N R 326 THR OG1 O N N 327 THR CG2 C N N 328 THR OXT O N N 329 THR H H N N 330 THR H2 H N N 331 THR HA H N N 332 THR HB H N N 333 THR HG1 H N N 334 THR HG21 H N N 335 THR HG22 H N N 336 THR HG23 H N N 337 THR HXT H N N 338 TRP N N N N 339 TRP CA C N S 340 TRP C C N N 341 TRP O O N N 342 TRP CB C N N 343 TRP CG C Y N 344 TRP CD1 C Y N 345 TRP CD2 C Y N 346 TRP NE1 N Y N 347 TRP CE2 C Y N 348 TRP CE3 C Y N 349 TRP CZ2 C Y N 350 TRP CZ3 C Y N 351 TRP CH2 C Y N 352 TRP OXT O N N 353 TRP H H N N 354 TRP H2 H N N 355 TRP HA H N N 356 TRP HB2 H N N 357 TRP HB3 H N N 358 TRP HD1 H N N 359 TRP HE1 H N N 360 TRP HE3 H N N 361 TRP HZ2 H N N 362 TRP HZ3 H N N 363 TRP HH2 H N N 364 TRP HXT H N N 365 TYR N N N N 366 TYR CA C N S 367 TYR C C N N 368 TYR O O N N 369 TYR CB C N N 370 TYR CG C Y N 371 TYR CD1 C Y N 372 TYR CD2 C Y N 373 TYR CE1 C Y N 374 TYR CE2 C Y N 375 TYR CZ C Y N 376 TYR OH O N N 377 TYR OXT O N N 378 TYR H H N N 379 TYR H2 H N N 380 TYR HA H N N 381 TYR HB2 H N N 382 TYR HB3 H N N 383 TYR HD1 H N N 384 TYR HD2 H N N 385 TYR HE1 H N N 386 TYR HE2 H N N 387 TYR HH H N N 388 TYR HXT H N N 389 VAL N N N N 390 VAL CA C N S 391 VAL C C N N 392 VAL O O N N 393 VAL CB C N N 394 VAL CG1 C N N 395 VAL CG2 C N N 396 VAL OXT O N N 397 VAL H H N N 398 VAL H2 H N N 399 VAL HA H N N 400 VAL HB H N N 401 VAL HG11 H N N 402 VAL HG12 H N N 403 VAL HG13 H N N 404 VAL HG21 H N N 405 VAL HG22 H N N 406 VAL HG23 H N N 407 VAL HXT H N N 408 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CP N C sing N N 70 CP N HN1 sing N N 71 CP N HN2 sing N N 72 CP C O doub N N 73 CP C O4P sing N N 74 CP O4P P sing N N 75 CP P O1P doub N N 76 CP P O2P sing N N 77 CP P O3P sing N N 78 CP O2P HOP2 sing N N 79 CP O3P HOP3 sing N N 80 CYS N CA sing N N 81 CYS N H sing N N 82 CYS N H2 sing N N 83 CYS CA C sing N N 84 CYS CA CB sing N N 85 CYS CA HA sing N N 86 CYS C O doub N N 87 CYS C OXT sing N N 88 CYS CB SG sing N N 89 CYS CB HB2 sing N N 90 CYS CB HB3 sing N N 91 CYS SG HG sing N N 92 CYS OXT HXT sing N N 93 GLN N CA sing N N 94 GLN N H sing N N 95 GLN N H2 sing N N 96 GLN CA C sing N N 97 GLN CA CB sing N N 98 GLN CA HA sing N N 99 GLN C O doub N N 100 GLN C OXT sing N N 101 GLN CB CG sing N N 102 GLN CB HB2 sing N N 103 GLN CB HB3 sing N N 104 GLN CG CD sing N N 105 GLN CG HG2 sing N N 106 GLN CG HG3 sing N N 107 GLN CD OE1 doub N N 108 GLN CD NE2 sing N N 109 GLN NE2 HE21 sing N N 110 GLN NE2 HE22 sing N N 111 GLN OXT HXT sing N N 112 GLU N CA sing N N 113 GLU N H sing N N 114 GLU N H2 sing N N 115 GLU CA C sing N N 116 GLU CA CB sing N N 117 GLU CA HA sing N N 118 GLU C O doub N N 119 GLU C OXT sing N N 120 GLU CB CG sing N N 121 GLU CB HB2 sing N N 122 GLU CB HB3 sing N N 123 GLU CG CD sing N N 124 GLU CG HG2 sing N N 125 GLU CG HG3 sing N N 126 GLU CD OE1 doub N N 127 GLU CD OE2 sing N N 128 GLU OE2 HE2 sing N N 129 GLU OXT HXT sing N N 130 GLY N CA sing N N 131 GLY N H sing N N 132 GLY N H2 sing N N 133 GLY CA C sing N N 134 GLY CA HA2 sing N N 135 GLY CA HA3 sing N N 136 GLY C O doub N N 137 GLY C OXT sing N N 138 GLY OXT HXT sing N N 139 HIS N CA sing N N 140 HIS N H sing N N 141 HIS N H2 sing N N 142 HIS CA C sing N N 143 HIS CA CB sing N N 144 HIS CA HA sing N N 145 HIS C O doub N N 146 HIS C OXT sing N N 147 HIS CB CG sing N N 148 HIS CB HB2 sing N N 149 HIS CB HB3 sing N N 150 HIS CG ND1 sing Y N 151 HIS CG CD2 doub Y N 152 HIS ND1 CE1 doub Y N 153 HIS ND1 HD1 sing N N 154 HIS CD2 NE2 sing Y N 155 HIS CD2 HD2 sing N N 156 HIS CE1 NE2 sing Y N 157 HIS CE1 HE1 sing N N 158 HIS NE2 HE2 sing N N 159 HIS OXT HXT sing N N 160 HOH O H1 sing N N 161 HOH O H2 sing N N 162 ILE N CA sing N N 163 ILE N H sing N N 164 ILE N H2 sing N N 165 ILE CA C sing N N 166 ILE CA CB sing N N 167 ILE CA HA sing N N 168 ILE C O doub N N 169 ILE C OXT sing N N 170 ILE CB CG1 sing N N 171 ILE CB CG2 sing N N 172 ILE CB HB sing N N 173 ILE CG1 CD1 sing N N 174 ILE CG1 HG12 sing N N 175 ILE CG1 HG13 sing N N 176 ILE CG2 HG21 sing N N 177 ILE CG2 HG22 sing N N 178 ILE CG2 HG23 sing N N 179 ILE CD1 HD11 sing N N 180 ILE CD1 HD12 sing N N 181 ILE CD1 HD13 sing N N 182 ILE OXT HXT sing N N 183 LEU N CA sing N N 184 LEU N H sing N N 185 LEU N H2 sing N N 186 LEU CA C sing N N 187 LEU CA CB sing N N 188 LEU CA HA sing N N 189 LEU C O doub N N 190 LEU C OXT sing N N 191 LEU CB CG sing N N 192 LEU CB HB2 sing N N 193 LEU CB HB3 sing N N 194 LEU CG CD1 sing N N 195 LEU CG CD2 sing N N 196 LEU CG HG sing N N 197 LEU CD1 HD11 sing N N 198 LEU CD1 HD12 sing N N 199 LEU CD1 HD13 sing N N 200 LEU CD2 HD21 sing N N 201 LEU CD2 HD22 sing N N 202 LEU CD2 HD23 sing N N 203 LEU OXT HXT sing N N 204 LYS N CA sing N N 205 LYS N H sing N N 206 LYS N H2 sing N N 207 LYS CA C sing N N 208 LYS CA CB sing N N 209 LYS CA HA sing N N 210 LYS C O doub N N 211 LYS C OXT sing N N 212 LYS CB CG sing N N 213 LYS CB HB2 sing N N 214 LYS CB HB3 sing N N 215 LYS CG CD sing N N 216 LYS CG HG2 sing N N 217 LYS CG HG3 sing N N 218 LYS CD CE sing N N 219 LYS CD HD2 sing N N 220 LYS CD HD3 sing N N 221 LYS CE NZ sing N N 222 LYS CE HE2 sing N N 223 LYS CE HE3 sing N N 224 LYS NZ HZ1 sing N N 225 LYS NZ HZ2 sing N N 226 LYS NZ HZ3 sing N N 227 LYS OXT HXT sing N N 228 MET N CA sing N N 229 MET N H sing N N 230 MET N H2 sing N N 231 MET CA C sing N N 232 MET CA CB sing N N 233 MET CA HA sing N N 234 MET C O doub N N 235 MET C OXT sing N N 236 MET CB CG sing N N 237 MET CB HB2 sing N N 238 MET CB HB3 sing N N 239 MET CG SD sing N N 240 MET CG HG2 sing N N 241 MET CG HG3 sing N N 242 MET SD CE sing N N 243 MET CE HE1 sing N N 244 MET CE HE2 sing N N 245 MET CE HE3 sing N N 246 MET OXT HXT sing N N 247 PHE N CA sing N N 248 PHE N H sing N N 249 PHE N H2 sing N N 250 PHE CA C sing N N 251 PHE CA CB sing N N 252 PHE CA HA sing N N 253 PHE C O doub N N 254 PHE C OXT sing N N 255 PHE CB CG sing N N 256 PHE CB HB2 sing N N 257 PHE CB HB3 sing N N 258 PHE CG CD1 doub Y N 259 PHE CG CD2 sing Y N 260 PHE CD1 CE1 sing Y N 261 PHE CD1 HD1 sing N N 262 PHE CD2 CE2 doub Y N 263 PHE CD2 HD2 sing N N 264 PHE CE1 CZ doub Y N 265 PHE CE1 HE1 sing N N 266 PHE CE2 CZ sing Y N 267 PHE CE2 HE2 sing N N 268 PHE CZ HZ sing N N 269 PHE OXT HXT sing N N 270 PO4 P O1 doub N N 271 PO4 P O2 sing N N 272 PO4 P O3 sing N N 273 PO4 P O4 sing N N 274 PRO N CA sing N N 275 PRO N CD sing N N 276 PRO N H sing N N 277 PRO CA C sing N N 278 PRO CA CB sing N N 279 PRO CA HA sing N N 280 PRO C O doub N N 281 PRO C OXT sing N N 282 PRO CB CG sing N N 283 PRO CB HB2 sing N N 284 PRO CB HB3 sing N N 285 PRO CG CD sing N N 286 PRO CG HG2 sing N N 287 PRO CG HG3 sing N N 288 PRO CD HD2 sing N N 289 PRO CD HD3 sing N N 290 PRO OXT HXT sing N N 291 SER N CA sing N N 292 SER N H sing N N 293 SER N H2 sing N N 294 SER CA C sing N N 295 SER CA CB sing N N 296 SER CA HA sing N N 297 SER C O doub N N 298 SER C OXT sing N N 299 SER CB OG sing N N 300 SER CB HB2 sing N N 301 SER CB HB3 sing N N 302 SER OG HG sing N N 303 SER OXT HXT sing N N 304 THR N CA sing N N 305 THR N H sing N N 306 THR N H2 sing N N 307 THR CA C sing N N 308 THR CA CB sing N N 309 THR CA HA sing N N 310 THR C O doub N N 311 THR C OXT sing N N 312 THR CB OG1 sing N N 313 THR CB CG2 sing N N 314 THR CB HB sing N N 315 THR OG1 HG1 sing N N 316 THR CG2 HG21 sing N N 317 THR CG2 HG22 sing N N 318 THR CG2 HG23 sing N N 319 THR OXT HXT sing N N 320 TRP N CA sing N N 321 TRP N H sing N N 322 TRP N H2 sing N N 323 TRP CA C sing N N 324 TRP CA CB sing N N 325 TRP CA HA sing N N 326 TRP C O doub N N 327 TRP C OXT sing N N 328 TRP CB CG sing N N 329 TRP CB HB2 sing N N 330 TRP CB HB3 sing N N 331 TRP CG CD1 doub Y N 332 TRP CG CD2 sing Y N 333 TRP CD1 NE1 sing Y N 334 TRP CD1 HD1 sing N N 335 TRP CD2 CE2 doub Y N 336 TRP CD2 CE3 sing Y N 337 TRP NE1 CE2 sing Y N 338 TRP NE1 HE1 sing N N 339 TRP CE2 CZ2 sing Y N 340 TRP CE3 CZ3 doub Y N 341 TRP CE3 HE3 sing N N 342 TRP CZ2 CH2 doub Y N 343 TRP CZ2 HZ2 sing N N 344 TRP CZ3 CH2 sing Y N 345 TRP CZ3 HZ3 sing N N 346 TRP CH2 HH2 sing N N 347 TRP OXT HXT sing N N 348 TYR N CA sing N N 349 TYR N H sing N N 350 TYR N H2 sing N N 351 TYR CA C sing N N 352 TYR CA CB sing N N 353 TYR CA HA sing N N 354 TYR C O doub N N 355 TYR C OXT sing N N 356 TYR CB CG sing N N 357 TYR CB HB2 sing N N 358 TYR CB HB3 sing N N 359 TYR CG CD1 doub Y N 360 TYR CG CD2 sing Y N 361 TYR CD1 CE1 sing Y N 362 TYR CD1 HD1 sing N N 363 TYR CD2 CE2 doub Y N 364 TYR CD2 HD2 sing N N 365 TYR CE1 CZ doub Y N 366 TYR CE1 HE1 sing N N 367 TYR CE2 CZ sing Y N 368 TYR CE2 HE2 sing N N 369 TYR CZ OH sing N N 370 TYR OH HH sing N N 371 TYR OXT HXT sing N N 372 VAL N CA sing N N 373 VAL N H sing N N 374 VAL N H2 sing N N 375 VAL CA C sing N N 376 VAL CA CB sing N N 377 VAL CA HA sing N N 378 VAL C O doub N N 379 VAL C OXT sing N N 380 VAL CB CG1 sing N N 381 VAL CB CG2 sing N N 382 VAL CB HB sing N N 383 VAL CG1 HG11 sing N N 384 VAL CG1 HG12 sing N N 385 VAL CG1 HG13 sing N N 386 VAL CG2 HG21 sing N N 387 VAL CG2 HG22 sing N N 388 VAL CG2 HG23 sing N N 389 VAL OXT HXT sing N N 390 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' 75N93022C00036 1 'National Institutes of Health/Office of the Director' 'United States' S10OD030394 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7XJT _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9Y8H _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.007605 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007605 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007605 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL N O P S # loop_ # loop_ #