data_9YJL # _entry.id 9YJL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.410 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9YJL pdb_00009yjl 10.2210/pdb9yjl/pdb WWPDB D_1000300658 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-03-18 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9YJL _pdbx_database_status.recvd_initial_deposition_date 2025-10-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email kovalevskyay@ornl.gov _pdbx_contact_author.name_first Andrey _pdbx_contact_author.name_last Kovalevsky _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-4459-9142 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kovalevsky, A.' 1 ? 'Gerlits, O.' 2 ? # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_patent _citation.unpublished_flag ? ? ? ? ? ? ? UK ? ? primary 'Curr Res Struct Biol' ? ? 2665-928X ? ? 11 ? 100188 ? ;Structural insights into RNase H catalytic mechanism from room-temperature X-ray and neutron crystallography of apo- and RNA/DNA hybrid-bound enzyme ; 2026 ? 10.1016/j.crstbi.2026.100188 ? ? ? ? ? ? ? ? ? ? ? ? ? 1 'To Be Published' ? 0353 ? ? ? ? ? ? ? 'Generalized X-ray and neutron crystallographic analysis: more accurate and complete structures for biological macromolecules' ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 'To Be Published' ? 0353 ? ? ? ? ? ? ? ;Structural insights into RNase H catalytic mechanism from room-temperature X-ray and neutron crystallography of apo- and RNA/DNA hybrid-bound enzyme ; ? ? ? ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Gerlits, O.' 1 ? primary 'Collins, A.' 2 ? primary 'Kovalevsky, A.' 3 ? 1 'Adams, P.D.' 4 ? 1 'Mustyakimov, M.' 5 ? 1 'Afonine, P.V.' 6 ? 1 'Langan, P.' 7 ? 2 'Gerlits, O.' 8 ? 2 'Collins, A.' 9 ? 2 'Kovalevsky, A.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ribonuclease H' 16004.066 1 3.1.26.4 ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 water nat water 18.015 59 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RNase H' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SAKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAI KWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK ; _entity_poly.pdbx_seq_one_letter_code_can ;SAKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAI KWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water DOD # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ALA n 1 3 LYS n 1 4 GLU n 1 5 GLU n 1 6 ILE n 1 7 ILE n 1 8 TRP n 1 9 GLU n 1 10 SER n 1 11 LEU n 1 12 SER n 1 13 VAL n 1 14 ASP n 1 15 VAL n 1 16 GLY n 1 17 SER n 1 18 GLN n 1 19 GLY n 1 20 ASN n 1 21 PRO n 1 22 GLY n 1 23 ILE n 1 24 VAL n 1 25 GLU n 1 26 TYR n 1 27 LYS n 1 28 GLY n 1 29 VAL n 1 30 ASP n 1 31 THR n 1 32 LYS n 1 33 THR n 1 34 GLY n 1 35 GLU n 1 36 VAL n 1 37 LEU n 1 38 PHE n 1 39 GLU n 1 40 ARG n 1 41 GLU n 1 42 PRO n 1 43 ILE n 1 44 PRO n 1 45 ILE n 1 46 GLY n 1 47 THR n 1 48 ASN n 1 49 ASN n 1 50 MET n 1 51 GLY n 1 52 GLU n 1 53 PHE n 1 54 LEU n 1 55 ALA n 1 56 ILE n 1 57 VAL n 1 58 HIS n 1 59 GLY n 1 60 LEU n 1 61 ARG n 1 62 TYR n 1 63 LEU n 1 64 LYS n 1 65 GLU n 1 66 ARG n 1 67 ASN n 1 68 SER n 1 69 ARG n 1 70 LYS n 1 71 PRO n 1 72 ILE n 1 73 TYR n 1 74 SER n 1 75 ASP n 1 76 SER n 1 77 GLN n 1 78 THR n 1 79 ALA n 1 80 ILE n 1 81 LYS n 1 82 TRP n 1 83 VAL n 1 84 LYS n 1 85 ASP n 1 86 LYS n 1 87 LYS n 1 88 ALA n 1 89 LYS n 1 90 SER n 1 91 THR n 1 92 LEU n 1 93 VAL n 1 94 ARG n 1 95 ASN n 1 96 GLU n 1 97 GLU n 1 98 THR n 1 99 ALA n 1 100 LEU n 1 101 ILE n 1 102 TRP n 1 103 LYS n 1 104 LEU n 1 105 VAL n 1 106 ASP n 1 107 GLU n 1 108 ALA n 1 109 GLU n 1 110 GLU n 1 111 TRP n 1 112 LEU n 1 113 ASN n 1 114 THR n 1 115 HIS n 1 116 THR n 1 117 TYR n 1 118 GLU n 1 119 THR n 1 120 PRO n 1 121 ILE n 1 122 LEU n 1 123 LYS n 1 124 TRP n 1 125 GLN n 1 126 THR n 1 127 ASP n 1 128 LYS n 1 129 TRP n 1 130 GLY n 1 131 GLU n 1 132 ILE n 1 133 LYS n 1 134 ALA n 1 135 ASP n 1 136 TYR n 1 137 GLY n 1 138 ARG n 1 139 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 139 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'rnhA, BH0863' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Halalkalibacterium halodurans' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 86665 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 DOD non-polymer . 'DEUTERATED WATER' ? 'D2 O' 20.028 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 58 ? ? ? A . n A 1 2 ALA 2 59 ? ? ? A . n A 1 3 LYS 3 60 ? ? ? A . n A 1 4 GLU 4 61 ? ? ? A . n A 1 5 GLU 5 62 62 GLU GLU A . n A 1 6 ILE 6 63 63 ILE ILE A . n A 1 7 ILE 7 64 64 ILE ILE A . n A 1 8 TRP 8 65 65 TRP TRP A . n A 1 9 GLU 9 66 66 GLU GLU A . n A 1 10 SER 10 67 67 SER SER A . n A 1 11 LEU 11 68 68 LEU LEU A . n A 1 12 SER 12 69 69 SER SER A . n A 1 13 VAL 13 70 70 VAL VAL A . n A 1 14 ASP 14 71 71 ASP ASP A . n A 1 15 VAL 15 72 72 VAL VAL A . n A 1 16 GLY 16 73 73 GLY GLY A . n A 1 17 SER 17 74 74 SER SER A . n A 1 18 GLN 18 75 75 GLN GLN A . n A 1 19 GLY 19 76 76 GLY GLY A . n A 1 20 ASN 20 77 77 ASN ASN A . n A 1 21 PRO 21 78 78 PRO PRO A . n A 1 22 GLY 22 79 79 GLY GLY A . n A 1 23 ILE 23 80 80 ILE ILE A . n A 1 24 VAL 24 81 81 VAL VAL A . n A 1 25 GLU 25 82 82 GLU GLU A . n A 1 26 TYR 26 83 83 TYR TYR A . n A 1 27 LYS 27 84 84 LYS LYS A . n A 1 28 GLY 28 85 85 GLY GLY A . n A 1 29 VAL 29 86 86 VAL VAL A . n A 1 30 ASP 30 87 87 ASP ASP A . n A 1 31 THR 31 88 88 THR THR A . n A 1 32 LYS 32 89 89 LYS LYS A . n A 1 33 THR 33 90 90 THR THR A . n A 1 34 GLY 34 91 91 GLY GLY A . n A 1 35 GLU 35 92 92 GLU GLU A . n A 1 36 VAL 36 93 93 VAL VAL A . n A 1 37 LEU 37 94 94 LEU LEU A . n A 1 38 PHE 38 95 95 PHE PHE A . n A 1 39 GLU 39 96 96 GLU GLU A . n A 1 40 ARG 40 97 97 ARG ARG A . n A 1 41 GLU 41 98 98 GLU GLU A . n A 1 42 PRO 42 99 99 PRO PRO A . n A 1 43 ILE 43 100 100 ILE ILE A . n A 1 44 PRO 44 101 101 PRO PRO A . n A 1 45 ILE 45 102 102 ILE ILE A . n A 1 46 GLY 46 103 103 GLY GLY A . n A 1 47 THR 47 104 104 THR THR A . n A 1 48 ASN 48 105 105 ASN ASN A . n A 1 49 ASN 49 106 106 ASN ASN A . n A 1 50 MET 50 107 107 MET MET A . n A 1 51 GLY 51 108 108 GLY GLY A . n A 1 52 GLU 52 109 109 GLU GLU A . n A 1 53 PHE 53 110 110 PHE PHE A . n A 1 54 LEU 54 111 111 LEU LEU A . n A 1 55 ALA 55 112 112 ALA ALA A . n A 1 56 ILE 56 113 113 ILE ILE A . n A 1 57 VAL 57 114 114 VAL VAL A . n A 1 58 HIS 58 115 115 HIS HIS A . n A 1 59 GLY 59 116 116 GLY GLY A . n A 1 60 LEU 60 117 117 LEU LEU A . n A 1 61 ARG 61 118 118 ARG ARG A . n A 1 62 TYR 62 119 119 TYR TYR A . n A 1 63 LEU 63 120 120 LEU LEU A . n A 1 64 LYS 64 121 121 LYS LYS A . n A 1 65 GLU 65 122 122 GLU GLU A . n A 1 66 ARG 66 123 123 ARG ARG A . n A 1 67 ASN 67 124 124 ASN ASN A . n A 1 68 SER 68 125 125 SER SER A . n A 1 69 ARG 69 126 126 ARG ARG A . n A 1 70 LYS 70 127 127 LYS LYS A . n A 1 71 PRO 71 128 128 PRO PRO A . n A 1 72 ILE 72 129 129 ILE ILE A . n A 1 73 TYR 73 130 130 TYR TYR A . n A 1 74 SER 74 131 131 SER SER A . n A 1 75 ASP 75 132 132 ASP ASP A . n A 1 76 SER 76 133 133 SER SER A . n A 1 77 GLN 77 134 134 GLN GLN A . n A 1 78 THR 78 135 135 THR THR A . n A 1 79 ALA 79 136 136 ALA ALA A . n A 1 80 ILE 80 137 137 ILE ILE A . n A 1 81 LYS 81 138 138 LYS LYS A . n A 1 82 TRP 82 139 139 TRP TRP A . n A 1 83 VAL 83 140 140 VAL VAL A . n A 1 84 LYS 84 141 141 LYS LYS A . n A 1 85 ASP 85 142 142 ASP ASP A . n A 1 86 LYS 86 143 143 LYS LYS A . n A 1 87 LYS 87 144 144 LYS LYS A . n A 1 88 ALA 88 145 145 ALA ALA A . n A 1 89 LYS 89 146 146 LYS LYS A . n A 1 90 SER 90 147 147 SER SER A . n A 1 91 THR 91 148 148 THR THR A . n A 1 92 LEU 92 149 149 LEU LEU A . n A 1 93 VAL 93 150 150 VAL VAL A . n A 1 94 ARG 94 151 151 ARG ARG A . n A 1 95 ASN 95 152 152 ASN ASN A . n A 1 96 GLU 96 153 153 GLU GLU A . n A 1 97 GLU 97 154 154 GLU GLU A . n A 1 98 THR 98 155 155 THR THR A . n A 1 99 ALA 99 156 156 ALA ALA A . n A 1 100 LEU 100 157 157 LEU LEU A . n A 1 101 ILE 101 158 158 ILE ILE A . n A 1 102 TRP 102 159 159 TRP TRP A . n A 1 103 LYS 103 160 160 LYS LYS A . n A 1 104 LEU 104 161 161 LEU LEU A . n A 1 105 VAL 105 162 162 VAL VAL A . n A 1 106 ASP 106 163 163 ASP ASP A . n A 1 107 GLU 107 164 164 GLU GLU A . n A 1 108 ALA 108 165 165 ALA ALA A . n A 1 109 GLU 109 166 166 GLU GLU A . n A 1 110 GLU 110 167 167 GLU GLU A . n A 1 111 TRP 111 168 168 TRP TRP A . n A 1 112 LEU 112 169 169 LEU LEU A . n A 1 113 ASN 113 170 170 ASN ASN A . n A 1 114 THR 114 171 171 THR THR A . n A 1 115 HIS 115 172 172 HIS HIS A . n A 1 116 THR 116 173 173 THR THR A . n A 1 117 TYR 117 174 174 TYR TYR A . n A 1 118 GLU 118 175 175 GLU GLU A . n A 1 119 THR 119 176 176 THR THR A . n A 1 120 PRO 120 177 177 PRO PRO A . n A 1 121 ILE 121 178 178 ILE ILE A . n A 1 122 LEU 122 179 179 LEU LEU A . n A 1 123 LYS 123 180 180 LYS LYS A . n A 1 124 TRP 124 181 181 TRP TRP A . n A 1 125 GLN 125 182 182 GLN GLN A . n A 1 126 THR 126 183 183 THR THR A . n A 1 127 ASP 127 184 184 ASP ASP A . n A 1 128 LYS 128 185 185 LYS LYS A . n A 1 129 TRP 129 186 186 TRP TRP A . n A 1 130 GLY 130 187 187 GLY GLY A . n A 1 131 GLU 131 188 188 GLU GLU A . n A 1 132 ILE 132 189 189 ILE ILE A . n A 1 133 LYS 133 190 190 LYS LYS A . n A 1 134 ALA 134 191 191 ALA ALA A . n A 1 135 ASP 135 192 192 ASP ASP A . n A 1 136 TYR 136 193 193 TYR TYR A . n A 1 137 GLY 137 194 194 GLY GLY A . n A 1 138 ARG 138 195 195 ARG ARG A . n A 1 139 LYS 139 196 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id DOD _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id DOD _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 201 1 SO4 SO4 A . C 3 DOD 1 301 33 DOD DOD A . C 3 DOD 2 302 17 DOD DOD A . C 3 DOD 3 303 29 DOD DOD A . C 3 DOD 4 304 45 DOD DOD A . C 3 DOD 5 305 23 DOD DOD A . C 3 DOD 6 306 34 DOD DOD A . C 3 DOD 7 307 48 DOD DOD A . C 3 DOD 8 308 10 DOD DOD A . C 3 DOD 9 309 15 DOD DOD A . C 3 DOD 10 310 20 DOD DOD A . C 3 DOD 11 311 37 DOD DOD A . C 3 DOD 12 312 2 DOD DOD A . C 3 DOD 13 313 12 DOD DOD A . C 3 DOD 14 314 41 DOD DOD A . C 3 DOD 15 315 14 DOD DOD A . C 3 DOD 16 316 61 DOD DOD A . C 3 DOD 17 317 1 DOD DOD A . C 3 DOD 18 318 11 DOD DOD A . C 3 DOD 19 319 19 DOD DOD A . C 3 DOD 20 320 27 DOD DOD A . C 3 DOD 21 321 38 DOD DOD A . C 3 DOD 22 322 43 DOD DOD A . C 3 DOD 23 323 13 DOD DOD A . C 3 DOD 24 324 52 DOD DOD A . C 3 DOD 25 325 59 DOD DOD A . C 3 DOD 26 326 65 DOD DOD A . C 3 DOD 27 327 5 DOD DOD A . C 3 DOD 28 328 9 DOD DOD A . C 3 DOD 29 329 8 DOD DOD A . C 3 DOD 30 330 6 DOD DOD A . C 3 DOD 31 331 26 DOD DOD A . C 3 DOD 32 332 39 DOD DOD A . C 3 DOD 33 333 32 DOD DOD A . C 3 DOD 34 334 4 DOD DOD A . C 3 DOD 35 335 21 DOD DOD A . C 3 DOD 36 336 22 DOD DOD A . C 3 DOD 37 337 3 DOD DOD A . C 3 DOD 38 338 35 DOD DOD A . C 3 DOD 39 339 53 DOD DOD A . C 3 DOD 40 340 7 DOD DOD A . C 3 DOD 41 341 56 DOD DOD A . C 3 DOD 42 342 18 DOD DOD A . C 3 DOD 43 343 36 DOD DOD A . C 3 DOD 44 344 25 DOD DOD A . C 3 DOD 45 345 40 DOD DOD A . C 3 DOD 46 346 24 DOD DOD A . C 3 DOD 47 347 74 DOD DOD A . C 3 DOD 48 348 30 DOD DOD A . C 3 DOD 49 349 49 DOD DOD A . C 3 DOD 50 350 42 DOD DOD A . C 3 DOD 51 351 70 DOD DOD A . C 3 DOD 52 352 67 DOD DOD A . C 3 DOD 53 353 28 DOD DOD A . C 3 DOD 54 354 57 DOD DOD A . C 3 DOD 55 355 62 DOD DOD A . C 3 DOD 56 356 50 DOD DOD A . C 3 DOD 57 357 75 DOD DOD A . C 3 DOD 58 358 44 DOD DOD A . C 3 DOD 59 359 73 DOD DOD A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.dependencies _software.description _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.pdbx_ordinal _software.pdbx_reference_DOI _software.type _software.version ? refinement ? ? ? ? ? ? ? ? ? ? ? nCNS ? ? 1 ? ? 1.0.8 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? Mantid ? ? 2 ? ? . ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? LAUENORM ? ? 3 ? ? . ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? 4 ? ? . # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 9YJL _cell.details ? _cell.formula_units_Z ? _cell.length_a 67.201 _cell.length_a_esd ? _cell.length_b 67.201 _cell.length_b_esd ? _cell.length_c 60.814 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9YJL _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _exptl.absorpt_coefficient_mu _exptl.absorpt_correction_T_max _exptl.absorpt_correction_T_min _exptl.absorpt_correction_type _exptl.absorpt_process_details _exptl.entry_id _exptl.crystals_number _exptl.details _exptl.method _exptl.method_details ? ? ? ? ? 9YJL 1 ? 'X-RAY DIFFRACTION' ? ? ? ? ? ? 9YJL ? ? 'NEUTRON DIFFRACTION' ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.48 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.34 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M NaOAc pH 5.0, 0.2 M (NH4)2SO4, and 20% PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # loop_ _diffrn.ambient_environment _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.ambient_temp_esd _diffrn.crystal_id _diffrn.crystal_support _diffrn.crystal_treatment _diffrn.details _diffrn.id _diffrn.ambient_pressure _diffrn.ambient_pressure_esd _diffrn.ambient_pressure_gt _diffrn.ambient_pressure_lt _diffrn.ambient_temp_gt _diffrn.ambient_temp_lt _diffrn.pdbx_serial_crystal_experiment ? 293 ? ? 1 ? ? ? 1 ? ? ? ? ? ? N ? 293 ? ? 1 ? ? ? 2 ? ? ? ? ? ? N # loop_ _diffrn_detector.details _diffrn_detector.detector _diffrn_detector.diffrn_id _diffrn_detector.type _diffrn_detector.area_resol_mean _diffrn_detector.dtime _diffrn_detector.pdbx_frames_total _diffrn_detector.pdbx_collection_time_total _diffrn_detector.pdbx_collection_date _diffrn_detector.pdbx_frequency _diffrn_detector.id _diffrn_detector.number_of_axes ? 'POSITION SENSITIVE DETECTOR' 1 'ORNL ANGER CAMERA' ? ? ? ? 2023-07-05 ? ? ? ? PIXEL 2 'DECTRIS EIGER R 4M' ? ? ? ? 2023-07-06 ? ? ? # loop_ _diffrn_radiation.collimation _diffrn_radiation.diffrn_id _diffrn_radiation.filter_edge _diffrn_radiation.inhomogeneity _diffrn_radiation.monochromator _diffrn_radiation.polarisn_norm _diffrn_radiation.polarisn_ratio _diffrn_radiation.probe _diffrn_radiation.type _diffrn_radiation.xray_symbol _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.pdbx_wavelength_list _diffrn_radiation.pdbx_wavelength _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_analyzer _diffrn_radiation.pdbx_scattering_type ? 1 ? ? ? ? ? ? ? ? 1 L ? ? LAUE ? neutron ? 2 ? ? ? ? ? ? ? ? 2 M ? ? 'SINGLE WAVELENGTH' ? x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 2 1.0 2 4.16 1.0 3 1.54 1.0 # loop_ _diffrn_source.current _diffrn_source.details _diffrn_source.diffrn_id _diffrn_source.power _diffrn_source.size _diffrn_source.source _diffrn_source.target _diffrn_source.type _diffrn_source.voltage _diffrn_source.take-off_angle _diffrn_source.pdbx_wavelength_list _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_synchrotron_site ? ? 1 ? ? 'SPALLATION SOURCE' ? 'ORNL Spallation Neutron Source BEAMLINE MANDI' ? ? 2-4.16 ? MANDI 'ORNL Spallation Neutron Source' ? ? 2 ? ? 'ROTATING ANODE' ? 'RIGAKU MICROMAX-007 HF' ? ? 1.54 ? ? ? # loop_ _reflns.B_iso_Wilson_estimate _reflns.entry_id _reflns.data_reduction_details _reflns.data_reduction_method _reflns.d_resolution_high _reflns.d_resolution_low _reflns.details _reflns.limit_h_max _reflns.limit_h_min _reflns.limit_k_max _reflns.limit_k_min _reflns.limit_l_max _reflns.limit_l_min _reflns.number_all _reflns.number_obs _reflns.observed_criterion _reflns.observed_criterion_F_max _reflns.observed_criterion_F_min _reflns.observed_criterion_I_max _reflns.observed_criterion_I_min _reflns.observed_criterion_sigma_F _reflns.observed_criterion_sigma_I _reflns.percent_possible_obs _reflns.R_free_details _reflns.Rmerge_F_all _reflns.Rmerge_F_obs _reflns.Friedel_coverage _reflns.number_gt _reflns.threshold_expression _reflns.pdbx_redundancy _reflns.pdbx_netI_over_av_sigmaI _reflns.pdbx_netI_over_sigmaI _reflns.pdbx_res_netI_over_av_sigmaI_2 _reflns.pdbx_res_netI_over_sigmaI_2 _reflns.pdbx_chi_squared _reflns.pdbx_scaling_rejects _reflns.pdbx_d_res_high_opt _reflns.pdbx_d_res_low_opt _reflns.pdbx_d_res_opt_method _reflns.phase_calculation_details _reflns.pdbx_Rrim_I_all _reflns.pdbx_Rpim_I_all _reflns.pdbx_d_opt _reflns.pdbx_number_measured_all _reflns.pdbx_diffrn_id _reflns.pdbx_ordinal _reflns.pdbx_CC_half _reflns.pdbx_CC_star _reflns.pdbx_R_split _reflns.pdbx_Rmerge_I_obs _reflns.pdbx_Rmerge_I_all _reflns.pdbx_Rsym_value _reflns.pdbx_CC_split_method _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] _reflns.pdbx_aniso_diffraction_limit_1 _reflns.pdbx_aniso_diffraction_limit_2 _reflns.pdbx_aniso_diffraction_limit_3 _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] _reflns.pdbx_aniso_B_tensor_eigenvalue_1 _reflns.pdbx_aniso_B_tensor_eigenvalue_2 _reflns.pdbx_aniso_B_tensor_eigenvalue_3 _reflns.pdbx_orthogonalization_convention _reflns.pdbx_percent_possible_ellipsoidal _reflns.pdbx_percent_possible_spherical _reflns.pdbx_percent_possible_ellipsoidal_anomalous _reflns.pdbx_percent_possible_spherical_anomalous _reflns.pdbx_redundancy_anomalous _reflns.pdbx_CC_half_anomalous _reflns.pdbx_absDiff_over_sigma_anomalous _reflns.pdbx_percent_possible_anomalous _reflns.pdbx_observed_signal_threshold _reflns.pdbx_signal_type _reflns.pdbx_signal_details _reflns.pdbx_signal_software_id ? 9YJL ? ? 2.48 14.7 ? ? ? ? ? ? ? ? 5519 ? ? ? ? ? ? ? 95.5 ? ? ? ? ? ? 4.6 ? 7.6 ? ? ? ? ? ? ? ? ? 0.096 ? ? 1 1 0.95 ? ? 0.201 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 9YJL ? ? 1.90 60.8 ? ? ? ? ? ? ? ? 12840 ? ? ? ? ? ? ? 99.6 ? ? ? ? ? ? 7.4 ? 25.0 ? ? ? ? ? ? ? ? ? 0.023 ? ? 2 2 0.997 ? ? 0.058 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.48 2.57 ? 2.8 ? ? ? ? 465 ? ? ? ? ? ? ? ? ? ? ? 3.6 ? ? ? ? 0.131 ? 1 1 0.295 ? ? 80.6 ? 0.233 ? ? ? ? ? ? ? ? ? 1.90 1.97 ? 1.6 ? ? ? ? 1250 ? ? ? ? ? ? ? ? ? ? ? 5.5 ? ? ? ? 0.297 ? 2 2 0.623 ? ? 96.7 ? 0.663 ? ? ? ? ? ? ? ? ? # loop_ _refine.aniso_B[1][1] _refine.aniso_B[1][2] _refine.aniso_B[1][3] _refine.aniso_B[2][2] _refine.aniso_B[2][3] _refine.aniso_B[3][3] _refine.B_iso_max _refine.B_iso_mean _refine.B_iso_min _refine.correlation_coeff_Fo_to_Fc _refine.correlation_coeff_Fo_to_Fc_free _refine.details _refine.diff_density_max _refine.diff_density_max_esd _refine.diff_density_min _refine.diff_density_min_esd _refine.diff_density_rms _refine.diff_density_rms_esd _refine.entry_id _refine.pdbx_refine_id _refine.ls_abs_structure_details _refine.ls_abs_structure_Flack _refine.ls_abs_structure_Flack_esd _refine.ls_abs_structure_Rogers _refine.ls_abs_structure_Rogers_esd _refine.ls_d_res_high _refine.ls_d_res_low _refine.ls_extinction_coef _refine.ls_extinction_coef_esd _refine.ls_extinction_expression _refine.ls_extinction_method _refine.ls_goodness_of_fit_all _refine.ls_goodness_of_fit_all_esd _refine.ls_goodness_of_fit_obs _refine.ls_goodness_of_fit_obs_esd _refine.ls_hydrogen_treatment _refine.ls_matrix_type _refine.ls_number_constraints _refine.ls_number_parameters _refine.ls_number_reflns_all _refine.ls_number_reflns_obs _refine.ls_number_reflns_R_free _refine.ls_number_reflns_R_work _refine.ls_number_restraints _refine.ls_percent_reflns_obs _refine.ls_percent_reflns_R_free _refine.ls_R_factor_all _refine.ls_R_factor_obs _refine.ls_R_factor_R_free _refine.ls_R_factor_R_free_error _refine.ls_R_factor_R_free_error_details _refine.ls_R_factor_R_work _refine.ls_R_Fsqd_factor_obs _refine.ls_R_I_factor_obs _refine.ls_redundancy_reflns_all _refine.ls_redundancy_reflns_obs _refine.ls_restrained_S_all _refine.ls_restrained_S_obs _refine.ls_shift_over_esd_max _refine.ls_shift_over_esd_mean _refine.ls_structure_factor_coef _refine.ls_weighting_details _refine.ls_weighting_scheme _refine.ls_wR_factor_all _refine.ls_wR_factor_obs _refine.ls_wR_factor_R_free _refine.ls_wR_factor_R_work _refine.occupancy_max _refine.occupancy_min _refine.solvent_model_details _refine.solvent_model_param_bsol _refine.solvent_model_param_ksol _refine.correlation_coeff_I_to_Fcsqd_work _refine.correlation_coeff_I_to_Fcsqd_free _refine.pdbx_R_complete _refine.ls_R_factor_gt _refine.ls_goodness_of_fit_gt _refine.ls_goodness_of_fit_ref _refine.ls_shift_over_su_max _refine.ls_shift_over_su_max_lt _refine.ls_shift_over_su_mean _refine.ls_shift_over_su_mean_lt _refine.pdbx_ls_sigma_I _refine.pdbx_ls_sigma_F _refine.pdbx_ls_sigma_Fsqd _refine.pdbx_data_cutoff_high_absF _refine.pdbx_data_cutoff_high_rms_absF _refine.pdbx_data_cutoff_low_absF _refine.pdbx_isotropic_thermal_model _refine.pdbx_ls_cross_valid_method _refine.pdbx_method_to_determine_struct _refine.pdbx_starting_model _refine.pdbx_stereochemistry_target_values _refine.pdbx_R_Free_selection_details _refine.pdbx_stereochem_target_val_spec_case _refine.pdbx_overall_ESU_R _refine.pdbx_overall_ESU_R_Free _refine.pdbx_solvent_vdw_probe_radii _refine.pdbx_solvent_ion_probe_radii _refine.pdbx_solvent_shrinkage_radii _refine.pdbx_real_space_R _refine.pdbx_density_correlation _refine.pdbx_pd_number_of_powder_patterns _refine.pdbx_pd_number_of_points _refine.pdbx_pd_meas_number_of_points _refine.pdbx_pd_proc_ls_prof_R_factor _refine.pdbx_pd_proc_ls_prof_wR_factor _refine.pdbx_pd_Marquardt_correlation_coeff _refine.pdbx_pd_Fsqrd_R_factor _refine.pdbx_pd_ls_matrix_band_width _refine.pdbx_overall_phase_error _refine.pdbx_overall_SU_R_free_Cruickshank_DPI _refine.pdbx_overall_SU_R_free_Blow_DPI _refine.pdbx_overall_SU_R_Blow_DPI _refine.pdbx_TLS_residual_ADP_flag _refine.pdbx_diffrn_id _refine.overall_SU_B _refine.overall_SU_ML _refine.overall_SU_R_Cruickshank_DPI _refine.overall_SU_R_free _refine.overall_FOM_free_R_set _refine.overall_FOM_work_R_set _refine.pdbx_average_fsc_overall _refine.pdbx_average_fsc_work _refine.pdbx_average_fsc_free ? ? ? ? ? ? 76.01 35.69 15.82 ? ? ? ? ? ? ? ? ? 9YJL 'NEUTRON DIFFRACTION' ? ? ? ? ? 2.48 14.7 ? ? ? ? ? ? ? ? ? ? ? ? ? 5519 305 5214 ? 93.8 5.5 ? ? 0.311 0.022 ? 0.279 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'CNS bulk solvent model used' 47.7202 0.646568 ? ? ? ? ? ? ? ? ? ? ? 2.5 ? ? ? ? ? 'FREE R-VALUE' 'MOLECULAR REPLACEMENT' ? 'Joint X-ray/neutron ML' random ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 76.01 35.69 15.82 ? ? ? ? ? ? ? ? ? 9YJL 'X-RAY DIFFRACTION' ? ? ? ? ? 1.90 40 ? ? ? ? ? ? ? ? ? ? ? ? ? 11690 609 10951 ? 90.8 5.3 ? ? 0.226 0.009 ? 0.219 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'CNS bulk solvent model used' 47.7202 0.646568 ? ? ? ? ? ? ? ? ? ? ? 2.5 ? ? ? ? ? 'FREE R-VALUE' 'MOLECULAR REPLACEMENT' ? 'Joint X-ray/neutron ML' random ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 ? ? ? ? ? ? ? ? ? # loop_ _refine_analyze.entry_id _refine_analyze.pdbx_refine_id _refine_analyze.Luzzati_coordinate_error_free _refine_analyze.Luzzati_coordinate_error_obs _refine_analyze.Luzzati_d_res_low_free _refine_analyze.Luzzati_d_res_low_obs _refine_analyze.Luzzati_sigma_a_free _refine_analyze.Luzzati_sigma_a_free_details _refine_analyze.Luzzati_sigma_a_obs _refine_analyze.Luzzati_sigma_a_obs_details _refine_analyze.number_disordered_residues _refine_analyze.occupancy_sum_hydrogen _refine_analyze.occupancy_sum_non_hydrogen _refine_analyze.RG_d_res_high _refine_analyze.RG_d_res_low _refine_analyze.RG_free _refine_analyze.RG_work _refine_analyze.RG_free_work_ratio _refine_analyze.pdbx_Luzzati_d_res_high_obs 9YJL 'X-RAY DIFFRACTION' 0.50 0.46 ? 5.00 0.74 ? 0.66 ? ? ? ? ? ? ? ? ? 2.50 9YJL 'NEUTRON DIFFRACTION' 0.25 0.24 ? 5.00 0.21 ? 0.21 ? ? ? ? ? ? ? ? ? 1.90 # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.48 _refine_hist.d_res_low 14.7 _refine_hist.number_atoms_solvent 59 _refine_hist.number_atoms_total 1156 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1092 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'NEUTRON DIFFRACTION' ? 0.008 ? ? ? x_bond_d ? ? ? 'NEUTRON DIFFRACTION' ? 1.1 ? ? ? x_angle_deg ? ? ? 'NEUTRON DIFFRACTION' ? 19.5 ? ? ? x_torsion_deg ? ? ? 'NEUTRON DIFFRACTION' ? 0.77 ? ? ? x_torsion_impr_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.008 ? ? ? x_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 1.1 ? ? ? x_angle_deg ? ? ? 'X-RAY DIFFRACTION' ? 19.5 ? ? ? x_torsion_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.77 ? ? ? x_torsion_impr_deg ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'NEUTRON DIFFRACTION' 2.50 2.61 . . 28 571 84.0 4.7 . . 0.070 0.388 . . . . . . . . . . . . . . . 0.373 'NEUTRON DIFFRACTION' 2.61 2.74 . . 36 661 97.5 5.2 . . 0.067 0.399 . . . . . . . . . . . . . . . 0.405 'NEUTRON DIFFRACTION' 2.74 2.92 . . 44 642 95.7 6.4 . . 0.058 0.355 . . . . . . . . . . . . . . . 0.385 'NEUTRON DIFFRACTION' 2.92 3.14 . . 36 650 97.6 5.2 . . 0.070 0.352 . . . . . . . . . . . . . . . 0.419 'NEUTRON DIFFRACTION' 3.14 3.45 . . 53 640 98.0 7.6 . . 0.048 0.308 . . . . . . . . . . . . . . . 0.350 'NEUTRON DIFFRACTION' 3.45 3.94 . . 32 678 97.9 4.5 . . 0.052 0.301 . . . . . . . . . . . . . . . 0.292 'NEUTRON DIFFRACTION' 3.94 4.93 . . 33 687 99.4 4.6 . . 0.055 0.318 . . . . . . . . . . . . . . . 0.314 'NEUTRON DIFFRACTION' 4.93 14.7 . . 43 685 94.4 5.9 . . 0.069 0.434 . . . . . . . . . . . . . . . 0.451 'X-RAY DIFFRACTION' 1.90 1.99 . . 49 980 65.4 4.8 . . 0.039 0.280 . . . . . . . . . . . . . . . 0.271 'X-RAY DIFFRACTION' 1.99 2.09 . . 62 1236 81.5 4.8 . . 0.036 0.244 . . . . . . . . . . . . . . . 0.280 'X-RAY DIFFRACTION' 2.09 2.22 . . 73 1345 89.7 5.1 . . 0.031 0.249 . . . . . . . . . . . . . . . 0.267 'X-RAY DIFFRACTION' 2.22 2.39 . . 71 1395 91.9 4.8 . . 0.030 0.238 . . . . . . . . . . . . . . . 0.249 'X-RAY DIFFRACTION' 2.39 2.63 . . 85 1436 95.5 5.6 . . 0.029 0.255 . . . . . . . . . . . . . . . 0.263 'X-RAY DIFFRACTION' 2.63 3.02 . . 90 1469 96.6 5.8 . . 0.027 0.229 . . . . . . . . . . . . . . . 0.258 'X-RAY DIFFRACTION' 3.02 3.80 . . 88 1491 97.5 5.6 . . 0.020 0.199 . . . . . . . . . . . . . . . 0.188 'X-RAY DIFFRACTION' 3.80 29.41 . . 91 1599 99.1 5.4 . . 0.022 0.192 . . . . . . . . . . . . . . . 0.213 # _struct.entry_id 9YJL _struct.title 'Joint X-ray/neutron structure of wild-type Bacillus halodurans RNase H1 in the apo-form' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9YJL _struct_keywords.text 'rna hydrolase, nucleic acid binding, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RNH1_HALH5 _struct_ref.pdbx_db_accession Q9KEI9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIK WVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK ; _struct_ref.pdbx_align_begin 59 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9YJL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 139 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9KEI9 _struct_ref_seq.db_align_beg 59 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 196 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 59 _struct_ref_seq.pdbx_auth_seq_align_end 196 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 9YJL _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q9KEI9 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 58 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 47 ? GLU A 65 ? THR A 104 GLU A 122 1 ? 19 HELX_P HELX_P2 AA2 SER A 76 ? LYS A 86 ? SER A 133 LYS A 143 1 ? 11 HELX_P HELX_P3 AA3 THR A 98 ? THR A 114 ? THR A 155 THR A 171 1 ? 17 HELX_P HELX_P4 AA4 GLN A 125 ? GLY A 130 ? GLN A 182 GLY A 187 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASN _struct_mon_prot_cis.label_seq_id 20 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASN _struct_mon_prot_cis.auth_seq_id 77 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 21 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 78 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 2.45 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? parallel AA2 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 36 ? GLU A 39 ? VAL A 93 GLU A 96 AA1 2 GLY A 22 ? ASP A 30 ? GLY A 79 ASP A 87 AA1 3 ILE A 43 ? GLY A 46 ? ILE A 100 GLY A 103 AA2 1 VAL A 36 ? GLU A 39 ? VAL A 93 GLU A 96 AA2 2 GLY A 22 ? ASP A 30 ? GLY A 79 ASP A 87 AA2 3 LEU A 11 ? GLN A 18 ? LEU A 68 GLN A 75 AA2 4 ILE A 72 ? SER A 74 ? ILE A 129 SER A 131 AA2 5 ILE A 121 ? LYS A 123 ? ILE A 178 LYS A 180 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LEU A 37 ? O LEU A 94 N GLY A 28 ? N GLY A 85 AA1 2 3 N VAL A 24 ? N VAL A 81 O ILE A 43 ? O ILE A 100 AA2 1 2 O LEU A 37 ? O LEU A 94 N GLY A 28 ? N GLY A 85 AA2 2 3 O GLU A 25 ? O GLU A 82 N GLY A 16 ? N GLY A 73 AA2 3 4 N LEU A 11 ? N LEU A 68 O TYR A 73 ? O TYR A 130 AA2 4 5 N ILE A 72 ? N ILE A 129 O LEU A 122 ? O LEU A 179 # _pdbx_entry_details.entry_id 9YJL _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLU 167 ? ? D1 A DOD 301 ? ? 1.36 2 1 D1 A DOD 329 ? ? O A DOD 359 ? ? 1.41 3 1 DH A TYR 174 ? A O A DOD 302 ? ? 1.44 4 1 HH A TYR 174 ? B O A DOD 302 ? ? 1.44 5 1 O A SER 125 ? ? D1 A DOD 304 ? ? 1.46 6 1 DZ3 A LYS 121 ? ? O A THR 173 ? ? 1.49 7 1 OD2 A ASP 87 ? ? D2 A DOD 307 ? ? 1.53 8 1 DG1 A THR 176 ? A O A DOD 309 ? ? 1.55 9 1 HG1 A THR 176 ? B O A DOD 309 ? ? 1.55 10 1 O A TYR 193 ? ? D A ARG 195 ? ? 1.56 11 1 DG A SER 147 ? ? O4 A SO4 201 ? ? 1.58 12 1 DH11 A ARG 151 ? A O A DOD 306 ? ? 1.59 13 1 HH11 A ARG 151 ? B O A DOD 306 ? ? 1.59 14 1 DH A TYR 130 ? A O A DOD 305 ? ? 1.60 15 1 HH A TYR 130 ? B O A DOD 305 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 75 ? ? -119.61 64.45 2 1 ASN A 124 ? ? 39.48 50.09 3 1 ASN A 152 ? ? -125.26 -168.86 4 1 THR A 176 ? ? -38.34 110.17 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 58 ? A SER 1 2 1 Y 1 A ALA 59 ? A ALA 2 3 1 Y 1 A LYS 60 ? A LYS 3 4 1 Y 1 A GLU 61 ? A GLU 4 5 1 Y 1 A LYS 196 ? A LYS 139 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 DOD O O N N 74 DOD D1 D N N 75 DOD D2 D N N 76 GLN N N N N 77 GLN CA C N S 78 GLN C C N N 79 GLN O O N N 80 GLN CB C N N 81 GLN CG C N N 82 GLN CD C N N 83 GLN OE1 O N N 84 GLN NE2 N N N 85 GLN OXT O N N 86 GLN H H N N 87 GLN H2 H N N 88 GLN HA H N N 89 GLN HB2 H N N 90 GLN HB3 H N N 91 GLN HG2 H N N 92 GLN HG3 H N N 93 GLN HE21 H N N 94 GLN HE22 H N N 95 GLN HXT H N N 96 GLU N N N N 97 GLU CA C N S 98 GLU C C N N 99 GLU O O N N 100 GLU CB C N N 101 GLU CG C N N 102 GLU CD C N N 103 GLU OE1 O N N 104 GLU OE2 O N N 105 GLU OXT O N N 106 GLU H H N N 107 GLU H2 H N N 108 GLU HA H N N 109 GLU HB2 H N N 110 GLU HB3 H N N 111 GLU HG2 H N N 112 GLU HG3 H N N 113 GLU HE2 H N N 114 GLU HXT H N N 115 GLY N N N N 116 GLY CA C N N 117 GLY C C N N 118 GLY O O N N 119 GLY OXT O N N 120 GLY H H N N 121 GLY H2 H N N 122 GLY HA2 H N N 123 GLY HA3 H N N 124 GLY HXT H N N 125 HIS N N N N 126 HIS CA C N S 127 HIS C C N N 128 HIS O O N N 129 HIS CB C N N 130 HIS CG C Y N 131 HIS ND1 N Y N 132 HIS CD2 C Y N 133 HIS CE1 C Y N 134 HIS NE2 N Y N 135 HIS OXT O N N 136 HIS H H N N 137 HIS H2 H N N 138 HIS HA H N N 139 HIS HB2 H N N 140 HIS HB3 H N N 141 HIS HD1 H N N 142 HIS HD2 H N N 143 HIS HE1 H N N 144 HIS HE2 H N N 145 HIS HXT H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 SO4 S S N N 290 SO4 O1 O N N 291 SO4 O2 O N N 292 SO4 O3 O N N 293 SO4 O4 O N N 294 THR N N N N 295 THR CA C N S 296 THR C C N N 297 THR O O N N 298 THR CB C N R 299 THR OG1 O N N 300 THR CG2 C N N 301 THR OXT O N N 302 THR H H N N 303 THR H2 H N N 304 THR HA H N N 305 THR HB H N N 306 THR HG1 H N N 307 THR HG21 H N N 308 THR HG22 H N N 309 THR HG23 H N N 310 THR HXT H N N 311 TRP N N N N 312 TRP CA C N S 313 TRP C C N N 314 TRP O O N N 315 TRP CB C N N 316 TRP CG C Y N 317 TRP CD1 C Y N 318 TRP CD2 C Y N 319 TRP NE1 N Y N 320 TRP CE2 C Y N 321 TRP CE3 C Y N 322 TRP CZ2 C Y N 323 TRP CZ3 C Y N 324 TRP CH2 C Y N 325 TRP OXT O N N 326 TRP H H N N 327 TRP H2 H N N 328 TRP HA H N N 329 TRP HB2 H N N 330 TRP HB3 H N N 331 TRP HD1 H N N 332 TRP HE1 H N N 333 TRP HE3 H N N 334 TRP HZ2 H N N 335 TRP HZ3 H N N 336 TRP HH2 H N N 337 TRP HXT H N N 338 TYR N N N N 339 TYR CA C N S 340 TYR C C N N 341 TYR O O N N 342 TYR CB C N N 343 TYR CG C Y N 344 TYR CD1 C Y N 345 TYR CD2 C Y N 346 TYR CE1 C Y N 347 TYR CE2 C Y N 348 TYR CZ C Y N 349 TYR OH O N N 350 TYR OXT O N N 351 TYR H H N N 352 TYR H2 H N N 353 TYR HA H N N 354 TYR HB2 H N N 355 TYR HB3 H N N 356 TYR HD1 H N N 357 TYR HD2 H N N 358 TYR HE1 H N N 359 TYR HE2 H N N 360 TYR HH H N N 361 TYR HXT H N N 362 VAL N N N N 363 VAL CA C N S 364 VAL C C N N 365 VAL O O N N 366 VAL CB C N N 367 VAL CG1 C N N 368 VAL CG2 C N N 369 VAL OXT O N N 370 VAL H H N N 371 VAL H2 H N N 372 VAL HA H N N 373 VAL HB H N N 374 VAL HG11 H N N 375 VAL HG12 H N N 376 VAL HG13 H N N 377 VAL HG21 H N N 378 VAL HG22 H N N 379 VAL HG23 H N N 380 VAL HXT H N N 381 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 DOD O D1 sing N N 70 DOD O D2 sing N N 71 GLN N CA sing N N 72 GLN N H sing N N 73 GLN N H2 sing N N 74 GLN CA C sing N N 75 GLN CA CB sing N N 76 GLN CA HA sing N N 77 GLN C O doub N N 78 GLN C OXT sing N N 79 GLN CB CG sing N N 80 GLN CB HB2 sing N N 81 GLN CB HB3 sing N N 82 GLN CG CD sing N N 83 GLN CG HG2 sing N N 84 GLN CG HG3 sing N N 85 GLN CD OE1 doub N N 86 GLN CD NE2 sing N N 87 GLN NE2 HE21 sing N N 88 GLN NE2 HE22 sing N N 89 GLN OXT HXT sing N N 90 GLU N CA sing N N 91 GLU N H sing N N 92 GLU N H2 sing N N 93 GLU CA C sing N N 94 GLU CA CB sing N N 95 GLU CA HA sing N N 96 GLU C O doub N N 97 GLU C OXT sing N N 98 GLU CB CG sing N N 99 GLU CB HB2 sing N N 100 GLU CB HB3 sing N N 101 GLU CG CD sing N N 102 GLU CG HG2 sing N N 103 GLU CG HG3 sing N N 104 GLU CD OE1 doub N N 105 GLU CD OE2 sing N N 106 GLU OE2 HE2 sing N N 107 GLU OXT HXT sing N N 108 GLY N CA sing N N 109 GLY N H sing N N 110 GLY N H2 sing N N 111 GLY CA C sing N N 112 GLY CA HA2 sing N N 113 GLY CA HA3 sing N N 114 GLY C O doub N N 115 GLY C OXT sing N N 116 GLY OXT HXT sing N N 117 HIS N CA sing N N 118 HIS N H sing N N 119 HIS N H2 sing N N 120 HIS CA C sing N N 121 HIS CA CB sing N N 122 HIS CA HA sing N N 123 HIS C O doub N N 124 HIS C OXT sing N N 125 HIS CB CG sing N N 126 HIS CB HB2 sing N N 127 HIS CB HB3 sing N N 128 HIS CG ND1 sing Y N 129 HIS CG CD2 doub Y N 130 HIS ND1 CE1 doub Y N 131 HIS ND1 HD1 sing N N 132 HIS CD2 NE2 sing Y N 133 HIS CD2 HD2 sing N N 134 HIS CE1 NE2 sing Y N 135 HIS CE1 HE1 sing N N 136 HIS NE2 HE2 sing N N 137 HIS OXT HXT sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 SO4 S O1 doub N N 277 SO4 S O2 doub N N 278 SO4 S O3 sing N N 279 SO4 S O4 sing N N 280 THR N CA sing N N 281 THR N H sing N N 282 THR N H2 sing N N 283 THR CA C sing N N 284 THR CA CB sing N N 285 THR CA HA sing N N 286 THR C O doub N N 287 THR C OXT sing N N 288 THR CB OG1 sing N N 289 THR CB CG2 sing N N 290 THR CB HB sing N N 291 THR OG1 HG1 sing N N 292 THR CG2 HG21 sing N N 293 THR CG2 HG22 sing N N 294 THR CG2 HG23 sing N N 295 THR OXT HXT sing N N 296 TRP N CA sing N N 297 TRP N H sing N N 298 TRP N H2 sing N N 299 TRP CA C sing N N 300 TRP CA CB sing N N 301 TRP CA HA sing N N 302 TRP C O doub N N 303 TRP C OXT sing N N 304 TRP CB CG sing N N 305 TRP CB HB2 sing N N 306 TRP CB HB3 sing N N 307 TRP CG CD1 doub Y N 308 TRP CG CD2 sing Y N 309 TRP CD1 NE1 sing Y N 310 TRP CD1 HD1 sing N N 311 TRP CD2 CE2 doub Y N 312 TRP CD2 CE3 sing Y N 313 TRP NE1 CE2 sing Y N 314 TRP NE1 HE1 sing N N 315 TRP CE2 CZ2 sing Y N 316 TRP CE3 CZ3 doub Y N 317 TRP CE3 HE3 sing N N 318 TRP CZ2 CH2 doub Y N 319 TRP CZ2 HZ2 sing N N 320 TRP CZ3 CH2 sing Y N 321 TRP CZ3 HZ3 sing N N 322 TRP CH2 HH2 sing N N 323 TRP OXT HXT sing N N 324 TYR N CA sing N N 325 TYR N H sing N N 326 TYR N H2 sing N N 327 TYR CA C sing N N 328 TYR CA CB sing N N 329 TYR CA HA sing N N 330 TYR C O doub N N 331 TYR C OXT sing N N 332 TYR CB CG sing N N 333 TYR CB HB2 sing N N 334 TYR CB HB3 sing N N 335 TYR CG CD1 doub Y N 336 TYR CG CD2 sing Y N 337 TYR CD1 CE1 sing Y N 338 TYR CD1 HD1 sing N N 339 TYR CD2 CE2 doub Y N 340 TYR CD2 HD2 sing N N 341 TYR CE1 CZ doub Y N 342 TYR CE1 HE1 sing N N 343 TYR CE2 CZ sing Y N 344 TYR CE2 HE2 sing N N 345 TYR CZ OH sing N N 346 TYR OH HH sing N N 347 TYR OXT HXT sing N N 348 VAL N CA sing N N 349 VAL N H sing N N 350 VAL N H2 sing N N 351 VAL CA C sing N N 352 VAL CA CB sing N N 353 VAL CA HA sing N N 354 VAL C O doub N N 355 VAL C OXT sing N N 356 VAL CB CG1 sing N N 357 VAL CB CG2 sing N N 358 VAL CB HB sing N N 359 VAL CG1 HG11 sing N N 360 VAL CG1 HG12 sing N N 361 VAL CG1 HG13 sing N N 362 VAL CG2 HG21 sing N N 363 VAL CG2 HG22 sing N N 364 VAL CG2 HG23 sing N N 365 VAL OXT HXT sing N N 366 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1ZBF _pdbx_initial_refinement_model.details ? # loop_ _refine_funct_minimized.pdbx_refine_id _refine_funct_minimized.type 'X-RAY DIFFRACTION' 'Joint X-ray/neutron ML' 'NEUTRON DIFFRACTION' 'Joint X-ray/neutron ML' # _atom_sites.entry_id 9YJL _atom_sites.Cartn_transf_matrix[1][1] 1.000000 _atom_sites.Cartn_transf_matrix[1][2] 0.000000 _atom_sites.Cartn_transf_matrix[1][3] 0.000000 _atom_sites.Cartn_transf_matrix[2][1] 0.000000 _atom_sites.Cartn_transf_matrix[2][2] 1.000000 _atom_sites.Cartn_transf_matrix[2][3] 0.000000 _atom_sites.Cartn_transf_matrix[3][1] 0.000000 _atom_sites.Cartn_transf_matrix[3][2] 0.000000 _atom_sites.Cartn_transf_matrix[3][3] 1.000000 _atom_sites.Cartn_transf_vector[1] 0.000000 _atom_sites.Cartn_transf_vector[2] 0.000000 _atom_sites.Cartn_transf_vector[3] 0.000000 _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.014881 _atom_sites.fract_transf_matrix[1][2] 0.008591 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017183 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016444 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C D H N O S # loop_ #