data_9YOZ # _entry.id 9YOZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.416 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9YOZ pdb_00009yoz 10.2210/pdb9yoz/pdb WWPDB D_1000301018 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-09-09 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9YOZ _pdbx_database_status.recvd_initial_deposition_date 2025-10-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email dabaker@uw.edu _pdbx_contact_author.name_first David _pdbx_contact_author.name_last Baker _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7896-6217 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bera, A.K.' 1 ? 'Choi, H.' 2 ? 'Kang, A.' 3 ? 'Nguyen, H.' 4 ? 'Baker, D.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Computational design of cysteine proteases' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Choi, H.' 1 ? primary 'Bera, A.K.' 2 ? primary 'Baker, D.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'HC12 WT complex' 21606.107 1 ? ? ? 'Sequence starts at ALA(1)' 2 water nat water 18.015 69 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;ATQTLTVKVAPGVEVEVSFEGTEEQREKAQAIVDEGNKTLDSVDLGKGKLYKDKNGNIIVEISREQLGKAAELAKTRLPY IDGVAAAGAPGGSCLPLSIIRAYEEYYKAEELGKELGVPVSDKVLVVNFNNQHFVVQVPVGDKLYVFDVDENNNPVYYTE PLPELTYVADVNVTFYASGISGSIEAIPGSGSGSGSSIVLTGS ; _entity_poly.pdbx_seq_one_letter_code_can ;ATQTLTVKVAPGVEVEVSFEGTEEQREKAQAIVDEGNKTLDSVDLGKGKLYKDKNGNIIVEISREQLGKAAELAKTRLPY IDGVAAAGAPGGSCLPLSIIRAYEEYYKAEELGKELGVPVSDKVLVVNFNNQHFVVQVPVGDKLYVFDVDENNNPVYYTE PLPELTYVADVNVTFYASGISGSIEAIPGSGSGSGSSIVLTGS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 THR n 1 3 GLN n 1 4 THR n 1 5 LEU n 1 6 THR n 1 7 VAL n 1 8 LYS n 1 9 VAL n 1 10 ALA n 1 11 PRO n 1 12 GLY n 1 13 VAL n 1 14 GLU n 1 15 VAL n 1 16 GLU n 1 17 VAL n 1 18 SER n 1 19 PHE n 1 20 GLU n 1 21 GLY n 1 22 THR n 1 23 GLU n 1 24 GLU n 1 25 GLN n 1 26 ARG n 1 27 GLU n 1 28 LYS n 1 29 ALA n 1 30 GLN n 1 31 ALA n 1 32 ILE n 1 33 VAL n 1 34 ASP n 1 35 GLU n 1 36 GLY n 1 37 ASN n 1 38 LYS n 1 39 THR n 1 40 LEU n 1 41 ASP n 1 42 SER n 1 43 VAL n 1 44 ASP n 1 45 LEU n 1 46 GLY n 1 47 LYS n 1 48 GLY n 1 49 LYS n 1 50 LEU n 1 51 TYR n 1 52 LYS n 1 53 ASP n 1 54 LYS n 1 55 ASN n 1 56 GLY n 1 57 ASN n 1 58 ILE n 1 59 ILE n 1 60 VAL n 1 61 GLU n 1 62 ILE n 1 63 SER n 1 64 ARG n 1 65 GLU n 1 66 GLN n 1 67 LEU n 1 68 GLY n 1 69 LYS n 1 70 ALA n 1 71 ALA n 1 72 GLU n 1 73 LEU n 1 74 ALA n 1 75 LYS n 1 76 THR n 1 77 ARG n 1 78 LEU n 1 79 PRO n 1 80 TYR n 1 81 ILE n 1 82 ASP n 1 83 GLY n 1 84 VAL n 1 85 ALA n 1 86 ALA n 1 87 ALA n 1 88 GLY n 1 89 ALA n 1 90 PRO n 1 91 GLY n 1 92 GLY n 1 93 SER n 1 94 CYS n 1 95 LEU n 1 96 PRO n 1 97 LEU n 1 98 SER n 1 99 ILE n 1 100 ILE n 1 101 ARG n 1 102 ALA n 1 103 TYR n 1 104 GLU n 1 105 GLU n 1 106 TYR n 1 107 TYR n 1 108 LYS n 1 109 ALA n 1 110 GLU n 1 111 GLU n 1 112 LEU n 1 113 GLY n 1 114 LYS n 1 115 GLU n 1 116 LEU n 1 117 GLY n 1 118 VAL n 1 119 PRO n 1 120 VAL n 1 121 SER n 1 122 ASP n 1 123 LYS n 1 124 VAL n 1 125 LEU n 1 126 VAL n 1 127 VAL n 1 128 ASN n 1 129 PHE n 1 130 ASN n 1 131 ASN n 1 132 GLN n 1 133 HIS n 1 134 PHE n 1 135 VAL n 1 136 VAL n 1 137 GLN n 1 138 VAL n 1 139 PRO n 1 140 VAL n 1 141 GLY n 1 142 ASP n 1 143 LYS n 1 144 LEU n 1 145 TYR n 1 146 VAL n 1 147 PHE n 1 148 ASP n 1 149 VAL n 1 150 ASP n 1 151 GLU n 1 152 ASN n 1 153 ASN n 1 154 ASN n 1 155 PRO n 1 156 VAL n 1 157 TYR n 1 158 TYR n 1 159 THR n 1 160 GLU n 1 161 PRO n 1 162 LEU n 1 163 PRO n 1 164 GLU n 1 165 LEU n 1 166 THR n 1 167 TYR n 1 168 VAL n 1 169 ALA n 1 170 ASP n 1 171 VAL n 1 172 ASN n 1 173 VAL n 1 174 THR n 1 175 PHE n 1 176 TYR n 1 177 ALA n 1 178 SER n 1 179 GLY n 1 180 ILE n 1 181 SER n 1 182 GLY n 1 183 SER n 1 184 ILE n 1 185 GLU n 1 186 ALA n 1 187 ILE n 1 188 PRO n 1 189 GLY n 1 190 SER n 1 191 GLY n 1 192 SER n 1 193 GLY n 1 194 SER n 1 195 GLY n 1 196 SER n 1 197 SER n 1 198 ILE n 1 199 VAL n 1 200 LEU n 1 201 THR n 1 202 GLY n 1 203 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 203 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 ? ? ? A . n A 1 2 THR 2 2 11 THR THR A . n A 1 3 GLN 3 3 12 GLN GLN A . n A 1 4 THR 4 4 13 THR THR A . n A 1 5 LEU 5 5 14 LEU LEU A . n A 1 6 THR 6 6 15 THR THR A . n A 1 7 VAL 7 7 16 VAL VAL A . n A 1 8 LYS 8 8 17 LYS LYS A . n A 1 9 VAL 9 9 18 VAL VAL A . n A 1 10 ALA 10 10 19 ALA ALA A . n A 1 11 PRO 11 11 20 PRO PRO A . n A 1 12 GLY 12 12 21 GLY GLY A . n A 1 13 VAL 13 13 22 VAL VAL A . n A 1 14 GLU 14 14 23 GLU GLU A . n A 1 15 VAL 15 15 24 VAL VAL A . n A 1 16 GLU 16 16 25 GLU GLU A . n A 1 17 VAL 17 17 26 VAL VAL A . n A 1 18 SER 18 18 27 SER SER A . n A 1 19 PHE 19 19 28 PHE PHE A . n A 1 20 GLU 20 20 29 GLU GLU A . n A 1 21 GLY 21 21 30 GLY GLY A . n A 1 22 THR 22 22 31 THR THR A . n A 1 23 GLU 23 23 32 GLU GLU A . n A 1 24 GLU 24 24 33 GLU GLU A . n A 1 25 GLN 25 25 34 GLN GLN A . n A 1 26 ARG 26 26 35 ARG ARG A . n A 1 27 GLU 27 27 36 GLU GLU A . n A 1 28 LYS 28 28 37 LYS LYS A . n A 1 29 ALA 29 29 38 ALA ALA A . n A 1 30 GLN 30 30 39 GLN GLN A . n A 1 31 ALA 31 31 40 ALA ALA A . n A 1 32 ILE 32 32 41 ILE ILE A . n A 1 33 VAL 33 33 42 VAL VAL A . n A 1 34 ASP 34 34 43 ASP ASP A . n A 1 35 GLU 35 35 44 GLU GLU A . n A 1 36 GLY 36 36 45 GLY GLY A . n A 1 37 ASN 37 37 46 ASN ASN A . n A 1 38 LYS 38 38 47 LYS LYS A . n A 1 39 THR 39 39 48 THR THR A . n A 1 40 LEU 40 40 49 LEU LEU A . n A 1 41 ASP 41 41 50 ASP ASP A . n A 1 42 SER 42 42 51 SER SER A . n A 1 43 VAL 43 43 52 VAL VAL A . n A 1 44 ASP 44 44 53 ASP ASP A . n A 1 45 LEU 45 45 54 LEU LEU A . n A 1 46 GLY 46 46 55 GLY GLY A . n A 1 47 LYS 47 47 56 LYS LYS A . n A 1 48 GLY 48 48 57 GLY GLY A . n A 1 49 LYS 49 49 58 LYS LYS A . n A 1 50 LEU 50 50 59 LEU LEU A . n A 1 51 TYR 51 51 60 TYR TYR A . n A 1 52 LYS 52 52 61 LYS LYS A . n A 1 53 ASP 53 53 62 ASP ASP A . n A 1 54 LYS 54 54 63 LYS LYS A . n A 1 55 ASN 55 55 64 ASN ASN A . n A 1 56 GLY 56 56 65 GLY GLY A . n A 1 57 ASN 57 57 66 ASN ASN A . n A 1 58 ILE 58 58 67 ILE ILE A . n A 1 59 ILE 59 59 68 ILE ILE A . n A 1 60 VAL 60 60 69 VAL VAL A . n A 1 61 GLU 61 61 70 GLU GLU A . n A 1 62 ILE 62 62 71 ILE ILE A . n A 1 63 SER 63 63 72 SER SER A . n A 1 64 ARG 64 64 73 ARG ARG A . n A 1 65 GLU 65 65 74 GLU GLU A . n A 1 66 GLN 66 66 75 GLN GLN A . n A 1 67 LEU 67 67 76 LEU LEU A . n A 1 68 GLY 68 68 77 GLY GLY A . n A 1 69 LYS 69 69 78 LYS LYS A . n A 1 70 ALA 70 70 79 ALA ALA A . n A 1 71 ALA 71 71 80 ALA ALA A . n A 1 72 GLU 72 72 81 GLU GLU A . n A 1 73 LEU 73 73 82 LEU LEU A . n A 1 74 ALA 74 74 83 ALA ALA A . n A 1 75 LYS 75 75 84 LYS LYS A . n A 1 76 THR 76 76 85 THR THR A . n A 1 77 ARG 77 77 86 ARG ARG A . n A 1 78 LEU 78 78 87 LEU LEU A . n A 1 79 PRO 79 79 88 PRO PRO A . n A 1 80 TYR 80 80 89 TYR TYR A . n A 1 81 ILE 81 81 90 ILE ILE A . n A 1 82 ASP 82 82 91 ASP ASP A . n A 1 83 GLY 83 83 92 GLY GLY A . n A 1 84 VAL 84 84 93 VAL VAL A . n A 1 85 ALA 85 85 94 ALA ALA A . n A 1 86 ALA 86 86 95 ALA ALA A . n A 1 87 ALA 87 87 96 ALA ALA A . n A 1 88 GLY 88 88 97 GLY GLY A . n A 1 89 ALA 89 89 98 ALA ALA A . n A 1 90 PRO 90 90 99 PRO PRO A . n A 1 91 GLY 91 91 100 GLY GLY A . n A 1 92 GLY 92 92 101 GLY GLY A . n A 1 93 SER 93 93 102 SER SER A . n A 1 94 CYS 94 94 103 CYS CYS A . n A 1 95 LEU 95 95 104 LEU LEU A . n A 1 96 PRO 96 96 105 PRO PRO A . n A 1 97 LEU 97 97 106 LEU LEU A . n A 1 98 SER 98 98 107 SER SER A . n A 1 99 ILE 99 99 108 ILE ILE A . n A 1 100 ILE 100 100 109 ILE ILE A . n A 1 101 ARG 101 101 110 ARG ARG A . n A 1 102 ALA 102 102 111 ALA ALA A . n A 1 103 TYR 103 103 112 TYR TYR A . n A 1 104 GLU 104 104 113 GLU GLU A . n A 1 105 GLU 105 105 114 GLU GLU A . n A 1 106 TYR 106 106 115 TYR TYR A . n A 1 107 TYR 107 107 116 TYR TYR A . n A 1 108 LYS 108 108 117 LYS LYS A . n A 1 109 ALA 109 109 118 ALA ALA A . n A 1 110 GLU 110 110 119 GLU GLU A . n A 1 111 GLU 111 111 120 GLU GLU A . n A 1 112 LEU 112 112 121 LEU LEU A . n A 1 113 GLY 113 113 122 GLY GLY A . n A 1 114 LYS 114 114 123 LYS LYS A . n A 1 115 GLU 115 115 124 GLU GLU A . n A 1 116 LEU 116 116 125 LEU LEU A . n A 1 117 GLY 117 117 126 GLY GLY A . n A 1 118 VAL 118 118 127 VAL VAL A . n A 1 119 PRO 119 119 128 PRO PRO A . n A 1 120 VAL 120 120 129 VAL VAL A . n A 1 121 SER 121 121 130 SER SER A . n A 1 122 ASP 122 122 131 ASP ASP A . n A 1 123 LYS 123 123 132 LYS LYS A . n A 1 124 VAL 124 124 133 VAL VAL A . n A 1 125 LEU 125 125 134 LEU LEU A . n A 1 126 VAL 126 126 135 VAL VAL A . n A 1 127 VAL 127 127 136 VAL VAL A . n A 1 128 ASN 128 128 137 ASN ASN A . n A 1 129 PHE 129 129 138 PHE PHE A . n A 1 130 ASN 130 130 139 ASN ASN A . n A 1 131 ASN 131 131 140 ASN ASN A . n A 1 132 GLN 132 132 141 GLN GLN A . n A 1 133 HIS 133 133 142 HIS HIS A . n A 1 134 PHE 134 134 143 PHE PHE A . n A 1 135 VAL 135 135 144 VAL VAL A . n A 1 136 VAL 136 136 145 VAL VAL A . n A 1 137 GLN 137 137 146 GLN GLN A . n A 1 138 VAL 138 138 147 VAL VAL A . n A 1 139 PRO 139 139 148 PRO PRO A . n A 1 140 VAL 140 140 149 VAL VAL A . n A 1 141 GLY 141 141 150 GLY GLY A . n A 1 142 ASP 142 142 151 ASP ASP A . n A 1 143 LYS 143 143 152 LYS LYS A . n A 1 144 LEU 144 144 153 LEU LEU A . n A 1 145 TYR 145 145 154 TYR TYR A . n A 1 146 VAL 146 146 155 VAL VAL A . n A 1 147 PHE 147 147 156 PHE PHE A . n A 1 148 ASP 148 148 157 ASP ASP A . n A 1 149 VAL 149 149 158 VAL VAL A . n A 1 150 ASP 150 150 159 ASP ASP A . n A 1 151 GLU 151 151 160 GLU GLU A . n A 1 152 ASN 152 152 161 ASN ASN A . n A 1 153 ASN 153 153 162 ASN ASN A . n A 1 154 ASN 154 154 163 ASN ASN A . n A 1 155 PRO 155 155 164 PRO PRO A . n A 1 156 VAL 156 156 165 VAL VAL A . n A 1 157 TYR 157 157 166 TYR TYR A . n A 1 158 TYR 158 158 167 TYR TYR A . n A 1 159 THR 159 159 168 THR THR A . n A 1 160 GLU 160 160 169 GLU GLU A . n A 1 161 PRO 161 161 170 PRO PRO A . n A 1 162 LEU 162 162 171 LEU LEU A . n A 1 163 PRO 163 163 172 PRO PRO A . n A 1 164 GLU 164 164 173 GLU GLU A . n A 1 165 LEU 165 165 174 LEU LEU A . n A 1 166 THR 166 166 175 THR THR A . n A 1 167 TYR 167 167 176 TYR TYR A . n A 1 168 VAL 168 168 177 VAL VAL A . n A 1 169 ALA 169 169 178 ALA ALA A . n A 1 170 ASP 170 170 179 ASP ASP A . n A 1 171 VAL 171 171 180 VAL VAL A . n A 1 172 ASN 172 172 181 ASN ASN A . n A 1 173 VAL 173 173 182 VAL VAL A . n A 1 174 THR 174 174 183 THR THR A . n A 1 175 PHE 175 175 184 PHE PHE A . n A 1 176 TYR 176 176 185 TYR TYR A . n A 1 177 ALA 177 177 186 ALA ALA A . n A 1 178 SER 178 178 187 SER SER A . n A 1 179 GLY 179 179 188 GLY GLY A . n A 1 180 ILE 180 180 189 ILE ILE A . n A 1 181 SER 181 181 190 SER SER A . n A 1 182 GLY 182 182 191 GLY GLY A . n A 1 183 SER 183 183 192 SER SER A . n A 1 184 ILE 184 184 193 ILE ILE A . n A 1 185 GLU 185 185 194 GLU GLU A . n A 1 186 ALA 186 186 195 ALA ALA A . n A 1 187 ILE 187 187 196 ILE ILE A . n A 1 188 PRO 188 188 197 PRO PRO A . n A 1 189 GLY 189 189 198 GLY GLY A . n A 1 190 SER 190 190 199 SER SER A . n A 1 191 GLY 191 191 200 GLY GLY A . n A 1 192 SER 192 192 201 SER SER A . n A 1 193 GLY 193 193 202 GLY GLY A . n A 1 194 SER 194 194 203 SER SER A . n A 1 195 GLY 195 195 204 GLY GLY A . n A 1 196 SER 196 196 205 SER SER A . n A 1 197 SER 197 197 206 SER SER A . n A 1 198 ILE 198 198 207 ILE ILE A . n A 1 199 VAL 199 199 208 VAL VAL A . n A 1 200 LEU 200 200 209 LEU LEU A . n A 1 201 THR 201 201 210 THR THR A . n A 1 202 GLY 202 202 211 GLY GLY A . n A 1 203 SER 203 203 212 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 46 HOH HOH A . B 2 HOH 2 302 10 HOH HOH A . B 2 HOH 3 303 21 HOH HOH A . B 2 HOH 4 304 48 HOH HOH A . B 2 HOH 5 305 14 HOH HOH A . B 2 HOH 6 306 27 HOH HOH A . B 2 HOH 7 307 3 HOH HOH A . B 2 HOH 8 308 11 HOH HOH A . B 2 HOH 9 309 43 HOH HOH A . B 2 HOH 10 310 1 HOH HOH A . B 2 HOH 11 311 5 HOH HOH A . B 2 HOH 12 312 63 HOH HOH A . B 2 HOH 13 313 4 HOH HOH A . B 2 HOH 14 314 9 HOH HOH A . B 2 HOH 15 315 50 HOH HOH A . B 2 HOH 16 316 7 HOH HOH A . B 2 HOH 17 317 19 HOH HOH A . B 2 HOH 18 318 36 HOH HOH A . B 2 HOH 19 319 16 HOH HOH A . B 2 HOH 20 320 26 HOH HOH A . B 2 HOH 21 321 53 HOH HOH A . B 2 HOH 22 322 60 HOH HOH A . B 2 HOH 23 323 33 HOH HOH A . B 2 HOH 24 324 47 HOH HOH A . B 2 HOH 25 325 2 HOH HOH A . B 2 HOH 26 326 35 HOH HOH A . B 2 HOH 27 327 57 HOH HOH A . B 2 HOH 28 328 15 HOH HOH A . B 2 HOH 29 329 54 HOH HOH A . B 2 HOH 30 330 31 HOH HOH A . B 2 HOH 31 331 30 HOH HOH A . B 2 HOH 32 332 8 HOH HOH A . B 2 HOH 33 333 22 HOH HOH A . B 2 HOH 34 334 29 HOH HOH A . B 2 HOH 35 335 58 HOH HOH A . B 2 HOH 36 336 66 HOH HOH A . B 2 HOH 37 337 32 HOH HOH A . B 2 HOH 38 338 6 HOH HOH A . B 2 HOH 39 339 37 HOH HOH A . B 2 HOH 40 340 20 HOH HOH A . B 2 HOH 41 341 23 HOH HOH A . B 2 HOH 42 342 64 HOH HOH A . B 2 HOH 43 343 41 HOH HOH A . B 2 HOH 44 344 12 HOH HOH A . B 2 HOH 45 345 49 HOH HOH A . B 2 HOH 46 346 67 HOH HOH A . B 2 HOH 47 347 24 HOH HOH A . B 2 HOH 48 348 13 HOH HOH A . B 2 HOH 49 349 18 HOH HOH A . B 2 HOH 50 350 56 HOH HOH A . B 2 HOH 51 351 40 HOH HOH A . B 2 HOH 52 352 55 HOH HOH A . B 2 HOH 53 353 34 HOH HOH A . B 2 HOH 54 354 69 HOH HOH A . B 2 HOH 55 355 45 HOH HOH A . B 2 HOH 56 356 65 HOH HOH A . B 2 HOH 57 357 59 HOH HOH A . B 2 HOH 58 358 68 HOH HOH A . B 2 HOH 59 359 51 HOH HOH A . B 2 HOH 60 360 42 HOH HOH A . B 2 HOH 61 361 61 HOH HOH A . B 2 HOH 62 362 52 HOH HOH A . B 2 HOH 63 363 44 HOH HOH A . B 2 HOH 64 364 38 HOH HOH A . B 2 HOH 65 365 39 HOH HOH A . B 2 HOH 66 366 17 HOH HOH A . B 2 HOH 67 367 25 HOH HOH A . B 2 HOH 68 368 62 HOH HOH A . B 2 HOH 69 369 28 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21.2_5419 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9YOZ _cell.details ? _cell.formula_units_Z ? _cell.length_a 77.234 _cell.length_a_esd ? _cell.length_b 77.234 _cell.length_b_esd ? _cell.length_c 104.974 _cell.length_c_esd ? _cell.volume 626179.437 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9YOZ _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall 'P 4nw 2abw' _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9YOZ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.62 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 66.05 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.8M sodium acetate trihydrate pH 7.0' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2025-07-03 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97920 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-E' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97920 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-E _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 34.79 _reflns.entry_id 9YOZ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.19 _reflns.d_resolution_low 104.97 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17005 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 25.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.091 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.989 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.437 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.19 _reflns_shell.d_res_low 2.26 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1426 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 27.6 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.295 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.253 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.518 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 47.07 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9YOZ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.19 _refine.ls_d_res_low 62.21 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16675 _refine.ls_number_reflns_R_free 822 _refine.ls_number_reflns_R_work 15853 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.35 _refine.ls_percent_reflns_R_free 4.93 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2003 _refine.ls_R_factor_R_free 0.2546 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1976 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.03 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.3226 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2838 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.19 _refine_hist.d_res_low 62.21 _refine_hist.number_atoms_solvent 69 _refine_hist.number_atoms_total 1586 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1517 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0047 ? 1542 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.6896 ? 2096 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0494 ? 243 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0042 ? 276 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 16.7184 ? 565 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.19 2.33 . . 145 2589 99.06 . . . . 0.3072 . . . . . . . . . . . . . . . 0.3361 'X-RAY DIFFRACTION' 2.33 2.51 . . 129 2588 98.44 . . . . 0.2791 . . . . . . . . . . . . . . . 0.3346 'X-RAY DIFFRACTION' 2.51 2.76 . . 124 2635 99.03 . . . . 0.2544 . . . . . . . . . . . . . . . 0.3044 'X-RAY DIFFRACTION' 2.76 3.16 . . 148 2649 99.75 . . . . 0.2166 . . . . . . . . . . . . . . . 0.2600 'X-RAY DIFFRACTION' 3.16 3.98 . . 131 2686 99.33 . . . . 0.1685 . . . . . . . . . . . . . . . 0.2622 'X-RAY DIFFRACTION' 3.98 62.21 . . 145 2706 94.81 . . . . 0.1546 . . . . . . . . . . . . . . . 0.1998 # _struct.entry_id 9YOZ _struct.title 'Crystal structure of de novo cysteine protease (HC12 WT complex)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9YOZ _struct_keywords.text 'de novo design, Cysteine proteases, enzyme design, deep learning method RFD2-MI, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 9YOZ _struct_ref.pdbx_db_accession 9YOZ _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9YOZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 203 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 9YOZ _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 203 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 203 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 22 ? LYS A 38 ? THR A 22 LYS A 38 1 ? 17 HELX_P HELX_P2 AA2 ARG A 64 ? LYS A 75 ? ARG A 64 LYS A 75 1 ? 12 HELX_P HELX_P3 AA3 ARG A 77 ? ALA A 87 ? ARG A 77 ALA A 87 1 ? 11 HELX_P HELX_P4 AA4 SER A 93 ? GLU A 105 ? SER A 93 GLU A 105 1 ? 13 HELX_P HELX_P5 AA5 GLU A 105 ? GLY A 117 ? GLU A 105 GLY A 117 1 ? 13 HELX_P HELX_P6 AA6 SER A 190 ? GLY A 195 ? SER A 190 GLY A 195 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 9 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA2 7 8 ? anti-parallel AA2 8 9 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 3 ? ALA A 10 ? GLN A 3 ALA A 10 AA1 2 VAL A 13 ? PHE A 19 ? VAL A 13 PHE A 19 AA2 1 PRO A 155 ? PRO A 161 ? PRO A 155 PRO A 161 AA2 2 LYS A 143 ? VAL A 149 ? LYS A 143 VAL A 149 AA2 3 HIS A 133 ? VAL A 140 ? HIS A 133 VAL A 140 AA2 4 LYS A 123 ? PHE A 129 ? LYS A 123 PHE A 129 AA2 5 ILE A 58 ? SER A 63 ? ILE A 58 SER A 63 AA2 6 ASP A 41 ? ASP A 53 ? ASP A 41 ASP A 53 AA2 7 LEU A 165 ? SER A 178 ? LEU A 165 SER A 178 AA2 8 SER A 181 ? PRO A 188 ? SER A 181 PRO A 188 AA2 9 ILE A 198 ? THR A 201 ? ILE A 198 THR A 201 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLN A 3 ? N GLN A 3 O PHE A 19 ? O PHE A 19 AA2 1 2 O TYR A 158 ? O TYR A 158 N VAL A 146 ? N VAL A 146 AA2 2 3 O LYS A 143 ? O LYS A 143 N VAL A 140 ? N VAL A 140 AA2 3 4 O VAL A 135 ? O VAL A 135 N VAL A 127 ? N VAL A 127 AA2 4 5 O VAL A 126 ? O VAL A 126 N VAL A 60 ? N VAL A 60 AA2 5 6 O GLU A 61 ? O GLU A 61 N LYS A 49 ? N LYS A 49 AA2 6 7 N GLY A 46 ? N GLY A 46 O VAL A 173 ? O VAL A 173 AA2 7 8 N ASN A 172 ? N ASN A 172 O ILE A 187 ? O ILE A 187 AA2 8 9 N ILE A 184 ? N ILE A 184 O LEU A 200 ? O LEU A 200 # _pdbx_entry_details.entry_id 9YOZ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 122 ? ? -88.36 36.92 2 1 GLN A 132 ? ? -138.17 -31.89 3 1 VAL A 168 ? ? -106.11 -60.09 4 1 SER A 181 ? ? -142.71 -144.67 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+3/4 3 y+1/2,-x+1/2,z+1/4 4 x+1/2,-y+1/2,-z+1/4 5 -x+1/2,y+1/2,-z+3/4 6 -x,-y,z+1/2 7 y,x,-z 8 -y,-x,-z+1/2 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -1.50037213716 _pdbx_refine_tls.origin_y 27.2432281267 _pdbx_refine_tls.origin_z -21.179860944 _pdbx_refine_tls.T[1][1] 0.183364147805 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0131302983634 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.00185071632156 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.202953057752 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.00306435658105 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.189147827455 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 1.32325995085 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.152771624263 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.280266978723 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.742401627287 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.0506746949373 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 1.48960228603 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.00339022413052 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.060816197193 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.0464915365617 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.044787361275 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0223388794777 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.0186395480633 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.125631720694 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.244078851376 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.000345394080078 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 11 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id B _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id S _pdbx_refine_tls_group.end_auth_seq_id 69 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id ALA _pdbx_unobs_or_zero_occ_residues.auth_seq_id 1 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id ALA _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 PHE N N N N 230 PHE CA C N S 231 PHE C C N N 232 PHE O O N N 233 PHE CB C N N 234 PHE CG C Y N 235 PHE CD1 C Y N 236 PHE CD2 C Y N 237 PHE CE1 C Y N 238 PHE CE2 C Y N 239 PHE CZ C Y N 240 PHE OXT O N N 241 PHE H H N N 242 PHE H2 H N N 243 PHE HA H N N 244 PHE HB2 H N N 245 PHE HB3 H N N 246 PHE HD1 H N N 247 PHE HD2 H N N 248 PHE HE1 H N N 249 PHE HE2 H N N 250 PHE HZ H N N 251 PHE HXT H N N 252 PRO N N N N 253 PRO CA C N S 254 PRO C C N N 255 PRO O O N N 256 PRO CB C N N 257 PRO CG C N N 258 PRO CD C N N 259 PRO OXT O N N 260 PRO H H N N 261 PRO HA H N N 262 PRO HB2 H N N 263 PRO HB3 H N N 264 PRO HG2 H N N 265 PRO HG3 H N N 266 PRO HD2 H N N 267 PRO HD3 H N N 268 PRO HXT H N N 269 SER N N N N 270 SER CA C N S 271 SER C C N N 272 SER O O N N 273 SER CB C N N 274 SER OG O N N 275 SER OXT O N N 276 SER H H N N 277 SER H2 H N N 278 SER HA H N N 279 SER HB2 H N N 280 SER HB3 H N N 281 SER HG H N N 282 SER HXT H N N 283 THR N N N N 284 THR CA C N S 285 THR C C N N 286 THR O O N N 287 THR CB C N R 288 THR OG1 O N N 289 THR CG2 C N N 290 THR OXT O N N 291 THR H H N N 292 THR H2 H N N 293 THR HA H N N 294 THR HB H N N 295 THR HG1 H N N 296 THR HG21 H N N 297 THR HG22 H N N 298 THR HG23 H N N 299 THR HXT H N N 300 TYR N N N N 301 TYR CA C N S 302 TYR C C N N 303 TYR O O N N 304 TYR CB C N N 305 TYR CG C Y N 306 TYR CD1 C Y N 307 TYR CD2 C Y N 308 TYR CE1 C Y N 309 TYR CE2 C Y N 310 TYR CZ C Y N 311 TYR OH O N N 312 TYR OXT O N N 313 TYR H H N N 314 TYR H2 H N N 315 TYR HA H N N 316 TYR HB2 H N N 317 TYR HB3 H N N 318 TYR HD1 H N N 319 TYR HD2 H N N 320 TYR HE1 H N N 321 TYR HE2 H N N 322 TYR HH H N N 323 TYR HXT H N N 324 VAL N N N N 325 VAL CA C N S 326 VAL C C N N 327 VAL O O N N 328 VAL CB C N N 329 VAL CG1 C N N 330 VAL CG2 C N N 331 VAL OXT O N N 332 VAL H H N N 333 VAL H2 H N N 334 VAL HA H N N 335 VAL HB H N N 336 VAL HG11 H N N 337 VAL HG12 H N N 338 VAL HG13 H N N 339 VAL HG21 H N N 340 VAL HG22 H N N 341 VAL HG23 H N N 342 VAL HXT H N N 343 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 PHE N CA sing N N 218 PHE N H sing N N 219 PHE N H2 sing N N 220 PHE CA C sing N N 221 PHE CA CB sing N N 222 PHE CA HA sing N N 223 PHE C O doub N N 224 PHE C OXT sing N N 225 PHE CB CG sing N N 226 PHE CB HB2 sing N N 227 PHE CB HB3 sing N N 228 PHE CG CD1 doub Y N 229 PHE CG CD2 sing Y N 230 PHE CD1 CE1 sing Y N 231 PHE CD1 HD1 sing N N 232 PHE CD2 CE2 doub Y N 233 PHE CD2 HD2 sing N N 234 PHE CE1 CZ doub Y N 235 PHE CE1 HE1 sing N N 236 PHE CE2 CZ sing Y N 237 PHE CE2 HE2 sing N N 238 PHE CZ HZ sing N N 239 PHE OXT HXT sing N N 240 PRO N CA sing N N 241 PRO N CD sing N N 242 PRO N H sing N N 243 PRO CA C sing N N 244 PRO CA CB sing N N 245 PRO CA HA sing N N 246 PRO C O doub N N 247 PRO C OXT sing N N 248 PRO CB CG sing N N 249 PRO CB HB2 sing N N 250 PRO CB HB3 sing N N 251 PRO CG CD sing N N 252 PRO CG HG2 sing N N 253 PRO CG HG3 sing N N 254 PRO CD HD2 sing N N 255 PRO CD HD3 sing N N 256 PRO OXT HXT sing N N 257 SER N CA sing N N 258 SER N H sing N N 259 SER N H2 sing N N 260 SER CA C sing N N 261 SER CA CB sing N N 262 SER CA HA sing N N 263 SER C O doub N N 264 SER C OXT sing N N 265 SER CB OG sing N N 266 SER CB HB2 sing N N 267 SER CB HB3 sing N N 268 SER OG HG sing N N 269 SER OXT HXT sing N N 270 THR N CA sing N N 271 THR N H sing N N 272 THR N H2 sing N N 273 THR CA C sing N N 274 THR CA CB sing N N 275 THR CA HA sing N N 276 THR C O doub N N 277 THR C OXT sing N N 278 THR CB OG1 sing N N 279 THR CB CG2 sing N N 280 THR CB HB sing N N 281 THR OG1 HG1 sing N N 282 THR CG2 HG21 sing N N 283 THR CG2 HG22 sing N N 284 THR CG2 HG23 sing N N 285 THR OXT HXT sing N N 286 TYR N CA sing N N 287 TYR N H sing N N 288 TYR N H2 sing N N 289 TYR CA C sing N N 290 TYR CA CB sing N N 291 TYR CA HA sing N N 292 TYR C O doub N N 293 TYR C OXT sing N N 294 TYR CB CG sing N N 295 TYR CB HB2 sing N N 296 TYR CB HB3 sing N N 297 TYR CG CD1 doub Y N 298 TYR CG CD2 sing Y N 299 TYR CD1 CE1 sing Y N 300 TYR CD1 HD1 sing N N 301 TYR CD2 CE2 doub Y N 302 TYR CD2 HD2 sing N N 303 TYR CE1 CZ doub Y N 304 TYR CE1 HE1 sing N N 305 TYR CE2 CZ sing Y N 306 TYR CE2 HE2 sing N N 307 TYR CZ OH sing N N 308 TYR OH HH sing N N 309 TYR OXT HXT sing N N 310 VAL N CA sing N N 311 VAL N H sing N N 312 VAL N H2 sing N N 313 VAL CA C sing N N 314 VAL CA CB sing N N 315 VAL CA HA sing N N 316 VAL C O doub N N 317 VAL C OXT sing N N 318 VAL CB CG1 sing N N 319 VAL CB CG2 sing N N 320 VAL CB HB sing N N 321 VAL CG1 HG11 sing N N 322 VAL CG1 HG12 sing N N 323 VAL CG1 HG13 sing N N 324 VAL CG2 HG21 sing N N 325 VAL CG2 HG22 sing N N 326 VAL CG2 HG23 sing N N 327 VAL OXT HXT sing N N 328 # _pdbx_audit_support.funding_organization 'Howard Hughes Medical Institute (HHMI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'de novo designed model' # _space_group.name_H-M_alt 'P 43 21 2' _space_group.name_Hall 'P 4nw 2abw' _space_group.IT_number 96 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 9YOZ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.012948 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012948 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009526 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #