data_9YVZ # _entry.id 9YVZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.416 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9YVZ pdb_00009yvz 10.2210/pdb9yvz/pdb WWPDB D_1000301222 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2026-07-15 ? 2 'Structure model' 1 1 2026-07-22 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.title' 3 2 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9YVZ _pdbx_database_status.recvd_initial_deposition_date 2025-10-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email rchica@uottawa.ca _pdbx_contact_author.name_first Roberto _pdbx_contact_author.name_last Chica _pdbx_contact_author.name_mi A _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-3789-9841 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Damry, A.M.' 1 0000-0003-3596-3133 'Hunt, S.E.' 2 0000-0001-7258-6440 'Legault, S.' 3 0009-0005-6170-9149 'Thompson, M.C.' 4 0000-0002-6099-2027 'Goto, N.K.' 5 0000-0003-4877-4884 'Chica, R.A.' 6 0000-0003-3789-9841 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Protein Eng.Des.Sel.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1741-0134 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 39 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Mapping functional dynamics hotspots for protein engineering with NMR peak intensity analysis.' _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1093/protein/gzag014 _citation.pdbx_database_id_PubMed 42402021 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Damry, A.M.' 1 ? primary 'Hunt, S.E.' 2 ? primary 'Legault, S.' 3 ? primary 'Thompson, M.C.' 4 ? primary 'Goto, N.K.' 5 ? primary 'Chica, R.A.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Red fluorescent protein mScarlet' 27253.721 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 3 water nat water 18.015 186 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHGVSKGEAVIKEFMRFKVHMEGSMNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFSWDILSPQF(NRQ)SR AFTKHPADIPDYYKQSFPEGFKWERVMNFEDGGAVTVTQDTSLEDGTLIYKVKLRGTNFPPDGPVMQKKTMGWEASTERL YPEDGVLKGDIKMALRLKDGGRYLADFKTTYKAKKPVQMPGAYNVDRKLDITSHNEDYTVVEQYERSEGRHSTGGMDELY K ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHGVSKGEAVIKEFMRFKVHMEGSMNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFSWDILSPQFXSRAFTK HPADIPDYYKQSFPEGFKWERVMNFEDGGAVTVTQDTSLEDGTLIYKVKLRGTNFPPDGPVMQKKTMGWEASTERLYPED GVLKGDIKMALRLKDGGRYLADFKTTYKAKKPVQMPGAYNVDRKLDITSHNEDYTVVEQYERSEGRHSTGGMDELYK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 GLY n 1 9 VAL n 1 10 SER n 1 11 LYS n 1 12 GLY n 1 13 GLU n 1 14 ALA n 1 15 VAL n 1 16 ILE n 1 17 LYS n 1 18 GLU n 1 19 PHE n 1 20 MET n 1 21 ARG n 1 22 PHE n 1 23 LYS n 1 24 VAL n 1 25 HIS n 1 26 MET n 1 27 GLU n 1 28 GLY n 1 29 SER n 1 30 MET n 1 31 ASN n 1 32 GLY n 1 33 HIS n 1 34 GLU n 1 35 PHE n 1 36 GLU n 1 37 ILE n 1 38 GLU n 1 39 GLY n 1 40 GLU n 1 41 GLY n 1 42 GLU n 1 43 GLY n 1 44 ARG n 1 45 PRO n 1 46 TYR n 1 47 GLU n 1 48 GLY n 1 49 THR n 1 50 GLN n 1 51 THR n 1 52 ALA n 1 53 LYS n 1 54 LEU n 1 55 LYS n 1 56 VAL n 1 57 THR n 1 58 LYS n 1 59 GLY n 1 60 GLY n 1 61 PRO n 1 62 LEU n 1 63 PRO n 1 64 PHE n 1 65 SER n 1 66 TRP n 1 67 ASP n 1 68 ILE n 1 69 LEU n 1 70 SER n 1 71 PRO n 1 72 GLN n 1 73 PHE n 1 74 NRQ n 1 75 SER n 1 76 ARG n 1 77 ALA n 1 78 PHE n 1 79 THR n 1 80 LYS n 1 81 HIS n 1 82 PRO n 1 83 ALA n 1 84 ASP n 1 85 ILE n 1 86 PRO n 1 87 ASP n 1 88 TYR n 1 89 TYR n 1 90 LYS n 1 91 GLN n 1 92 SER n 1 93 PHE n 1 94 PRO n 1 95 GLU n 1 96 GLY n 1 97 PHE n 1 98 LYS n 1 99 TRP n 1 100 GLU n 1 101 ARG n 1 102 VAL n 1 103 MET n 1 104 ASN n 1 105 PHE n 1 106 GLU n 1 107 ASP n 1 108 GLY n 1 109 GLY n 1 110 ALA n 1 111 VAL n 1 112 THR n 1 113 VAL n 1 114 THR n 1 115 GLN n 1 116 ASP n 1 117 THR n 1 118 SER n 1 119 LEU n 1 120 GLU n 1 121 ASP n 1 122 GLY n 1 123 THR n 1 124 LEU n 1 125 ILE n 1 126 TYR n 1 127 LYS n 1 128 VAL n 1 129 LYS n 1 130 LEU n 1 131 ARG n 1 132 GLY n 1 133 THR n 1 134 ASN n 1 135 PHE n 1 136 PRO n 1 137 PRO n 1 138 ASP n 1 139 GLY n 1 140 PRO n 1 141 VAL n 1 142 MET n 1 143 GLN n 1 144 LYS n 1 145 LYS n 1 146 THR n 1 147 MET n 1 148 GLY n 1 149 TRP n 1 150 GLU n 1 151 ALA n 1 152 SER n 1 153 THR n 1 154 GLU n 1 155 ARG n 1 156 LEU n 1 157 TYR n 1 158 PRO n 1 159 GLU n 1 160 ASP n 1 161 GLY n 1 162 VAL n 1 163 LEU n 1 164 LYS n 1 165 GLY n 1 166 ASP n 1 167 ILE n 1 168 LYS n 1 169 MET n 1 170 ALA n 1 171 LEU n 1 172 ARG n 1 173 LEU n 1 174 LYS n 1 175 ASP n 1 176 GLY n 1 177 GLY n 1 178 ARG n 1 179 TYR n 1 180 LEU n 1 181 ALA n 1 182 ASP n 1 183 PHE n 1 184 LYS n 1 185 THR n 1 186 THR n 1 187 TYR n 1 188 LYS n 1 189 ALA n 1 190 LYS n 1 191 LYS n 1 192 PRO n 1 193 VAL n 1 194 GLN n 1 195 MET n 1 196 PRO n 1 197 GLY n 1 198 ALA n 1 199 TYR n 1 200 ASN n 1 201 VAL n 1 202 ASP n 1 203 ARG n 1 204 LYS n 1 205 LEU n 1 206 ASP n 1 207 ILE n 1 208 THR n 1 209 SER n 1 210 HIS n 1 211 ASN n 1 212 GLU n 1 213 ASP n 1 214 TYR n 1 215 THR n 1 216 VAL n 1 217 VAL n 1 218 GLU n 1 219 GLN n 1 220 TYR n 1 221 GLU n 1 222 ARG n 1 223 SER n 1 224 GLU n 1 225 GLY n 1 226 ARG n 1 227 HIS n 1 228 SER n 1 229 THR n 1 230 GLY n 1 231 GLY n 1 232 MET n 1 233 ASP n 1 234 GLU n 1 235 LEU n 1 236 TYR n 1 237 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 237 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Discosoma sp.' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 86600 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NRQ 'L-peptide linking' n '{(4Z)-4-(4-hydroxybenzylidene)-2-[3-(methylthio)propanimidoyl]-5-oxo-4,5-dihydro-1H-imidazol-1-yl}acetic acid' 'CHROMOPHORE (MET-TYR-GLY)' 'C16 H17 N3 O4 S' 347.389 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -6 ? ? ? A . n A 1 2 HIS 2 -5 ? ? ? A . n A 1 3 HIS 3 -4 ? ? ? A . n A 1 4 HIS 4 -3 ? ? ? A . n A 1 5 HIS 5 -2 ? ? ? A . n A 1 6 HIS 6 -1 ? ? ? A . n A 1 7 HIS 7 0 ? ? ? A . n A 1 8 GLY 8 1 ? ? ? A . n A 1 9 VAL 9 2 ? ? ? A . n A 1 10 SER 10 3 3 SER SER A . n A 1 11 LYS 11 4 4 LYS LYS A . n A 1 12 GLY 12 5 5 GLY GLY A . n A 1 13 GLU 13 6 6 GLU GLU A . n A 1 14 ALA 14 7 7 ALA ALA A . n A 1 15 VAL 15 8 8 VAL VAL A . n A 1 16 ILE 16 9 9 ILE ILE A . n A 1 17 LYS 17 10 10 LYS LYS A . n A 1 18 GLU 18 11 11 GLU GLU A . n A 1 19 PHE 19 12 12 PHE PHE A . n A 1 20 MET 20 13 13 MET MET A . n A 1 21 ARG 21 14 14 ARG ARG A . n A 1 22 PHE 22 15 15 PHE PHE A . n A 1 23 LYS 23 16 16 LYS LYS A . n A 1 24 VAL 24 17 17 VAL VAL A . n A 1 25 HIS 25 18 18 HIS HIS A . n A 1 26 MET 26 19 19 MET MET A . n A 1 27 GLU 27 20 20 GLU GLU A . n A 1 28 GLY 28 21 21 GLY GLY A . n A 1 29 SER 29 22 22 SER SER A . n A 1 30 MET 30 23 23 MET MET A . n A 1 31 ASN 31 24 24 ASN ASN A . n A 1 32 GLY 32 25 25 GLY GLY A . n A 1 33 HIS 33 26 26 HIS HIS A . n A 1 34 GLU 34 27 27 GLU GLU A . n A 1 35 PHE 35 28 28 PHE PHE A . n A 1 36 GLU 36 29 29 GLU GLU A . n A 1 37 ILE 37 30 30 ILE ILE A . n A 1 38 GLU 38 31 31 GLU GLU A . n A 1 39 GLY 39 32 32 GLY GLY A . n A 1 40 GLU 40 33 33 GLU GLU A . n A 1 41 GLY 41 34 34 GLY GLY A . n A 1 42 GLU 42 35 35 GLU GLU A . n A 1 43 GLY 43 36 36 GLY GLY A . n A 1 44 ARG 44 37 37 ARG ARG A . n A 1 45 PRO 45 38 38 PRO PRO A . n A 1 46 TYR 46 39 39 TYR TYR A . n A 1 47 GLU 47 40 40 GLU GLU A . n A 1 48 GLY 48 41 41 GLY GLY A . n A 1 49 THR 49 42 42 THR THR A . n A 1 50 GLN 50 43 43 GLN GLN A . n A 1 51 THR 51 44 44 THR THR A . n A 1 52 ALA 52 45 45 ALA ALA A . n A 1 53 LYS 53 46 46 LYS LYS A . n A 1 54 LEU 54 47 47 LEU LEU A . n A 1 55 LYS 55 48 48 LYS LYS A . n A 1 56 VAL 56 49 49 VAL VAL A . n A 1 57 THR 57 50 50 THR THR A . n A 1 58 LYS 58 51 51 LYS LYS A . n A 1 59 GLY 59 52 52 GLY GLY A . n A 1 60 GLY 60 53 53 GLY GLY A . n A 1 61 PRO 61 54 54 PRO PRO A . n A 1 62 LEU 62 55 55 LEU LEU A . n A 1 63 PRO 63 56 56 PRO PRO A . n A 1 64 PHE 64 57 57 PHE PHE A . n A 1 65 SER 65 58 58 SER SER A . n A 1 66 TRP 66 59 59 TRP TRP A . n A 1 67 ASP 67 60 60 ASP ASP A . n A 1 68 ILE 68 61 61 ILE ILE A . n A 1 69 LEU 69 62 62 LEU LEU A . n A 1 70 SER 70 63 63 SER SER A . n A 1 71 PRO 71 64 64 PRO PRO A . n A 1 72 GLN 72 65 65 GLN GLN A . n A 1 73 PHE 73 66 66 PHE PHE A . n A 1 74 NRQ 74 67 67 NRQ NRQ A . n A 1 75 SER 75 70 70 SER SER A . n A 1 76 ARG 76 71 71 ARG ARG A . n A 1 77 ALA 77 72 72 ALA ALA A . n A 1 78 PHE 78 73 73 PHE PHE A . n A 1 79 THR 79 74 74 THR THR A . n A 1 80 LYS 80 75 75 LYS LYS A . n A 1 81 HIS 81 76 76 HIS HIS A . n A 1 82 PRO 82 77 77 PRO PRO A . n A 1 83 ALA 83 78 78 ALA ALA A . n A 1 84 ASP 84 79 79 ASP ASP A . n A 1 85 ILE 85 80 80 ILE ILE A . n A 1 86 PRO 86 81 81 PRO PRO A . n A 1 87 ASP 87 82 82 ASP ASP A . n A 1 88 TYR 88 83 83 TYR TYR A . n A 1 89 TYR 89 84 84 TYR TYR A . n A 1 90 LYS 90 85 85 LYS LYS A . n A 1 91 GLN 91 86 86 GLN GLN A . n A 1 92 SER 92 87 87 SER SER A . n A 1 93 PHE 93 88 88 PHE PHE A . n A 1 94 PRO 94 89 89 PRO PRO A . n A 1 95 GLU 95 90 90 GLU GLU A . n A 1 96 GLY 96 91 91 GLY GLY A . n A 1 97 PHE 97 92 92 PHE PHE A . n A 1 98 LYS 98 93 93 LYS LYS A . n A 1 99 TRP 99 94 94 TRP TRP A . n A 1 100 GLU 100 95 95 GLU GLU A . n A 1 101 ARG 101 96 96 ARG ARG A . n A 1 102 VAL 102 97 97 VAL VAL A . n A 1 103 MET 103 98 98 MET MET A . n A 1 104 ASN 104 99 99 ASN ASN A . n A 1 105 PHE 105 100 100 PHE PHE A . n A 1 106 GLU 106 101 101 GLU GLU A . n A 1 107 ASP 107 102 102 ASP ASP A . n A 1 108 GLY 108 103 103 GLY GLY A . n A 1 109 GLY 109 104 104 GLY GLY A . n A 1 110 ALA 110 105 105 ALA ALA A . n A 1 111 VAL 111 106 106 VAL VAL A . n A 1 112 THR 112 107 107 THR THR A . n A 1 113 VAL 113 108 108 VAL VAL A . n A 1 114 THR 114 109 109 THR THR A . n A 1 115 GLN 115 110 110 GLN GLN A . n A 1 116 ASP 116 111 111 ASP ASP A . n A 1 117 THR 117 112 112 THR THR A . n A 1 118 SER 118 113 113 SER SER A . n A 1 119 LEU 119 114 114 LEU LEU A . n A 1 120 GLU 120 115 115 GLU GLU A . n A 1 121 ASP 121 116 116 ASP ASP A . n A 1 122 GLY 122 117 117 GLY GLY A . n A 1 123 THR 123 118 118 THR THR A . n A 1 124 LEU 124 119 119 LEU LEU A . n A 1 125 ILE 125 120 120 ILE ILE A . n A 1 126 TYR 126 121 121 TYR TYR A . n A 1 127 LYS 127 122 122 LYS LYS A . n A 1 128 VAL 128 123 123 VAL VAL A . n A 1 129 LYS 129 124 124 LYS LYS A . n A 1 130 LEU 130 125 125 LEU LEU A . n A 1 131 ARG 131 126 126 ARG ARG A . n A 1 132 GLY 132 127 127 GLY GLY A . n A 1 133 THR 133 128 128 THR THR A . n A 1 134 ASN 134 129 129 ASN ASN A . n A 1 135 PHE 135 130 130 PHE PHE A . n A 1 136 PRO 136 131 131 PRO PRO A . n A 1 137 PRO 137 132 132 PRO PRO A . n A 1 138 ASP 138 133 133 ASP ASP A . n A 1 139 GLY 139 134 134 GLY GLY A . n A 1 140 PRO 140 135 135 PRO PRO A . n A 1 141 VAL 141 136 136 VAL VAL A . n A 1 142 MET 142 137 137 MET MET A . n A 1 143 GLN 143 138 138 GLN GLN A . n A 1 144 LYS 144 139 139 LYS LYS A . n A 1 145 LYS 145 140 140 LYS LYS A . n A 1 146 THR 146 141 141 THR THR A . n A 1 147 MET 147 142 142 MET MET A . n A 1 148 GLY 148 143 143 GLY GLY A . n A 1 149 TRP 149 144 144 TRP TRP A . n A 1 150 GLU 150 145 145 GLU GLU A . n A 1 151 ALA 151 146 146 ALA ALA A . n A 1 152 SER 152 147 147 SER SER A . n A 1 153 THR 153 148 148 THR THR A . n A 1 154 GLU 154 149 149 GLU GLU A . n A 1 155 ARG 155 150 150 ARG ARG A . n A 1 156 LEU 156 151 151 LEU LEU A . n A 1 157 TYR 157 152 152 TYR TYR A . n A 1 158 PRO 158 153 153 PRO PRO A . n A 1 159 GLU 159 154 154 GLU GLU A . n A 1 160 ASP 160 155 155 ASP ASP A . n A 1 161 GLY 161 156 156 GLY GLY A . n A 1 162 VAL 162 157 157 VAL VAL A . n A 1 163 LEU 163 158 158 LEU LEU A . n A 1 164 LYS 164 159 159 LYS LYS A . n A 1 165 GLY 165 160 160 GLY GLY A . n A 1 166 ASP 166 161 161 ASP ASP A . n A 1 167 ILE 167 162 162 ILE ILE A . n A 1 168 LYS 168 163 163 LYS LYS A . n A 1 169 MET 169 164 164 MET MET A . n A 1 170 ALA 170 165 165 ALA ALA A . n A 1 171 LEU 171 166 166 LEU LEU A . n A 1 172 ARG 172 167 167 ARG ARG A . n A 1 173 LEU 173 168 168 LEU LEU A . n A 1 174 LYS 174 169 169 LYS LYS A . n A 1 175 ASP 175 170 170 ASP ASP A . n A 1 176 GLY 176 171 171 GLY GLY A . n A 1 177 GLY 177 172 172 GLY GLY A . n A 1 178 ARG 178 173 173 ARG ARG A . n A 1 179 TYR 179 174 174 TYR TYR A . n A 1 180 LEU 180 175 175 LEU LEU A . n A 1 181 ALA 181 176 176 ALA ALA A . n A 1 182 ASP 182 177 177 ASP ASP A . n A 1 183 PHE 183 178 178 PHE PHE A . n A 1 184 LYS 184 179 179 LYS LYS A . n A 1 185 THR 185 180 180 THR THR A . n A 1 186 THR 186 181 181 THR THR A . n A 1 187 TYR 187 182 182 TYR TYR A . n A 1 188 LYS 188 183 183 LYS LYS A . n A 1 189 ALA 189 184 184 ALA ALA A . n A 1 190 LYS 190 185 185 LYS LYS A . n A 1 191 LYS 191 186 186 LYS LYS A . n A 1 192 PRO 192 187 187 PRO PRO A . n A 1 193 VAL 193 188 188 VAL VAL A . n A 1 194 GLN 194 189 189 GLN GLN A . n A 1 195 MET 195 190 190 MET MET A . n A 1 196 PRO 196 191 191 PRO PRO A . n A 1 197 GLY 197 192 192 GLY GLY A . n A 1 198 ALA 198 193 193 ALA ALA A . n A 1 199 TYR 199 194 194 TYR TYR A . n A 1 200 ASN 200 195 195 ASN ASN A . n A 1 201 VAL 201 196 196 VAL VAL A . n A 1 202 ASP 202 197 197 ASP ASP A . n A 1 203 ARG 203 198 198 ARG ARG A . n A 1 204 LYS 204 199 199 LYS LYS A . n A 1 205 LEU 205 200 200 LEU LEU A . n A 1 206 ASP 206 201 201 ASP ASP A . n A 1 207 ILE 207 202 202 ILE ILE A . n A 1 208 THR 208 203 203 THR THR A . n A 1 209 SER 209 204 204 SER SER A . n A 1 210 HIS 210 205 205 HIS HIS A . n A 1 211 ASN 211 206 206 ASN ASN A . n A 1 212 GLU 212 207 207 GLU GLU A . n A 1 213 ASP 213 208 208 ASP ASP A . n A 1 214 TYR 214 209 209 TYR TYR A . n A 1 215 THR 215 210 210 THR THR A . n A 1 216 VAL 216 211 211 VAL VAL A . n A 1 217 VAL 217 212 212 VAL VAL A . n A 1 218 GLU 218 213 213 GLU GLU A . n A 1 219 GLN 219 214 214 GLN GLN A . n A 1 220 TYR 220 215 215 TYR TYR A . n A 1 221 GLU 221 216 216 GLU GLU A . n A 1 222 ARG 222 217 217 ARG ARG A . n A 1 223 SER 223 218 218 SER SER A . n A 1 224 GLU 224 219 219 GLU GLU A . n A 1 225 GLY 225 220 220 GLY GLY A . n A 1 226 ARG 226 221 221 ARG ARG A . n A 1 227 HIS 227 222 222 HIS HIS A . n A 1 228 SER 228 223 223 SER SER A . n A 1 229 THR 229 224 224 THR THR A . n A 1 230 GLY 230 225 225 GLY GLY A . n A 1 231 GLY 231 226 ? ? ? A . n A 1 232 MET 232 227 ? ? ? A . n A 1 233 ASP 233 228 ? ? ? A . n A 1 234 GLU 234 229 ? ? ? A . n A 1 235 LEU 235 230 ? ? ? A . n A 1 236 TYR 236 231 ? ? ? A . n A 1 237 LYS 237 232 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id NRQ _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id NRQ _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 301 1 SO4 SO4 A . C 2 SO4 1 302 2 SO4 SO4 A . D 3 HOH 1 401 126 HOH HOH A . D 3 HOH 2 402 132 HOH HOH A . D 3 HOH 3 403 57 HOH HOH A . D 3 HOH 4 404 192 HOH HOH A . D 3 HOH 5 405 147 HOH HOH A . D 3 HOH 6 406 183 HOH HOH A . D 3 HOH 7 407 68 HOH HOH A . D 3 HOH 8 408 25 HOH HOH A . D 3 HOH 9 409 179 HOH HOH A . D 3 HOH 10 410 109 HOH HOH A . D 3 HOH 11 411 197 HOH HOH A . D 3 HOH 12 412 150 HOH HOH A . D 3 HOH 13 413 62 HOH HOH A . D 3 HOH 14 414 187 HOH HOH A . D 3 HOH 15 415 43 HOH HOH A . D 3 HOH 16 416 46 HOH HOH A . D 3 HOH 17 417 174 HOH HOH A . D 3 HOH 18 418 60 HOH HOH A . D 3 HOH 19 419 180 HOH HOH A . D 3 HOH 20 420 194 HOH HOH A . D 3 HOH 21 421 48 HOH HOH A . D 3 HOH 22 422 138 HOH HOH A . D 3 HOH 23 423 164 HOH HOH A . D 3 HOH 24 424 104 HOH HOH A . D 3 HOH 25 425 18 HOH HOH A . D 3 HOH 26 426 71 HOH HOH A . D 3 HOH 27 427 113 HOH HOH A . D 3 HOH 28 428 31 HOH HOH A . D 3 HOH 29 429 84 HOH HOH A . D 3 HOH 30 430 161 HOH HOH A . D 3 HOH 31 431 12 HOH HOH A . D 3 HOH 32 432 139 HOH HOH A . D 3 HOH 33 433 115 HOH HOH A . D 3 HOH 34 434 72 HOH HOH A . D 3 HOH 35 435 28 HOH HOH A . D 3 HOH 36 436 66 HOH HOH A . D 3 HOH 37 437 198 HOH HOH A . D 3 HOH 38 438 108 HOH HOH A . D 3 HOH 39 439 67 HOH HOH A . D 3 HOH 40 440 14 HOH HOH A . D 3 HOH 41 441 171 HOH HOH A . D 3 HOH 42 442 153 HOH HOH A . D 3 HOH 43 443 130 HOH HOH A . D 3 HOH 44 444 135 HOH HOH A . D 3 HOH 45 445 97 HOH HOH A . D 3 HOH 46 446 19 HOH HOH A . D 3 HOH 47 447 193 HOH HOH A . D 3 HOH 48 448 122 HOH HOH A . D 3 HOH 49 449 61 HOH HOH A . D 3 HOH 50 450 177 HOH HOH A . D 3 HOH 51 451 24 HOH HOH A . D 3 HOH 52 452 38 HOH HOH A . D 3 HOH 53 453 75 HOH HOH A . D 3 HOH 54 454 155 HOH HOH A . D 3 HOH 55 455 10 HOH HOH A . D 3 HOH 56 456 63 HOH HOH A . D 3 HOH 57 457 112 HOH HOH A . D 3 HOH 58 458 5 HOH HOH A . D 3 HOH 59 459 16 HOH HOH A . D 3 HOH 60 460 3 HOH HOH A . D 3 HOH 61 461 158 HOH HOH A . D 3 HOH 62 462 79 HOH HOH A . D 3 HOH 63 463 21 HOH HOH A . D 3 HOH 64 464 37 HOH HOH A . D 3 HOH 65 465 83 HOH HOH A . D 3 HOH 66 466 6 HOH HOH A . D 3 HOH 67 467 27 HOH HOH A . D 3 HOH 68 468 33 HOH HOH A . D 3 HOH 69 469 11 HOH HOH A . D 3 HOH 70 470 45 HOH HOH A . D 3 HOH 71 471 13 HOH HOH A . D 3 HOH 72 472 210 HOH HOH A . D 3 HOH 73 473 99 HOH HOH A . D 3 HOH 74 474 53 HOH HOH A . D 3 HOH 75 475 9 HOH HOH A . D 3 HOH 76 476 80 HOH HOH A . D 3 HOH 77 477 74 HOH HOH A . D 3 HOH 78 478 196 HOH HOH A . D 3 HOH 79 479 144 HOH HOH A . D 3 HOH 80 480 117 HOH HOH A . D 3 HOH 81 481 15 HOH HOH A . D 3 HOH 82 482 65 HOH HOH A . D 3 HOH 83 483 32 HOH HOH A . D 3 HOH 84 484 110 HOH HOH A . D 3 HOH 85 485 200 HOH HOH A . D 3 HOH 86 486 125 HOH HOH A . D 3 HOH 87 487 50 HOH HOH A . D 3 HOH 88 488 56 HOH HOH A . D 3 HOH 89 489 167 HOH HOH A . D 3 HOH 90 490 51 HOH HOH A . D 3 HOH 91 491 90 HOH HOH A . D 3 HOH 92 492 7 HOH HOH A . D 3 HOH 93 493 121 HOH HOH A . D 3 HOH 94 494 101 HOH HOH A . D 3 HOH 95 495 128 HOH HOH A . D 3 HOH 96 496 73 HOH HOH A . D 3 HOH 97 497 163 HOH HOH A . D 3 HOH 98 498 129 HOH HOH A . D 3 HOH 99 499 8 HOH HOH A . D 3 HOH 100 500 189 HOH HOH A . D 3 HOH 101 501 98 HOH HOH A . D 3 HOH 102 502 106 HOH HOH A . D 3 HOH 103 503 59 HOH HOH A . D 3 HOH 104 504 157 HOH HOH A . D 3 HOH 105 505 152 HOH HOH A . D 3 HOH 106 506 123 HOH HOH A . D 3 HOH 107 507 42 HOH HOH A . D 3 HOH 108 508 22 HOH HOH A . D 3 HOH 109 509 205 HOH HOH A . D 3 HOH 110 510 185 HOH HOH A . D 3 HOH 111 511 105 HOH HOH A . D 3 HOH 112 512 114 HOH HOH A . D 3 HOH 113 513 54 HOH HOH A . D 3 HOH 114 514 52 HOH HOH A . D 3 HOH 115 515 40 HOH HOH A . D 3 HOH 116 516 36 HOH HOH A . D 3 HOH 117 517 81 HOH HOH A . D 3 HOH 118 518 111 HOH HOH A . D 3 HOH 119 519 34 HOH HOH A . D 3 HOH 120 520 213 HOH HOH A . D 3 HOH 121 521 20 HOH HOH A . D 3 HOH 122 522 39 HOH HOH A . D 3 HOH 123 523 162 HOH HOH A . D 3 HOH 124 524 55 HOH HOH A . D 3 HOH 125 525 17 HOH HOH A . D 3 HOH 126 526 70 HOH HOH A . D 3 HOH 127 527 215 HOH HOH A . D 3 HOH 128 528 93 HOH HOH A . D 3 HOH 129 529 58 HOH HOH A . D 3 HOH 130 530 168 HOH HOH A . D 3 HOH 131 531 204 HOH HOH A . D 3 HOH 132 532 146 HOH HOH A . D 3 HOH 133 533 209 HOH HOH A . D 3 HOH 134 534 118 HOH HOH A . D 3 HOH 135 535 100 HOH HOH A . D 3 HOH 136 536 41 HOH HOH A . D 3 HOH 137 537 159 HOH HOH A . D 3 HOH 138 538 173 HOH HOH A . D 3 HOH 139 539 87 HOH HOH A . D 3 HOH 140 540 103 HOH HOH A . D 3 HOH 141 541 77 HOH HOH A . D 3 HOH 142 542 127 HOH HOH A . D 3 HOH 143 543 208 HOH HOH A . D 3 HOH 144 544 191 HOH HOH A . D 3 HOH 145 545 29 HOH HOH A . D 3 HOH 146 546 156 HOH HOH A . D 3 HOH 147 547 91 HOH HOH A . D 3 HOH 148 548 137 HOH HOH A . D 3 HOH 149 549 140 HOH HOH A . D 3 HOH 150 550 182 HOH HOH A . D 3 HOH 151 551 175 HOH HOH A . D 3 HOH 152 552 184 HOH HOH A . D 3 HOH 153 553 136 HOH HOH A . D 3 HOH 154 554 119 HOH HOH A . D 3 HOH 155 555 23 HOH HOH A . D 3 HOH 156 556 149 HOH HOH A . D 3 HOH 157 557 120 HOH HOH A . D 3 HOH 158 558 181 HOH HOH A . D 3 HOH 159 559 64 HOH HOH A . D 3 HOH 160 560 212 HOH HOH A . D 3 HOH 161 561 195 HOH HOH A . D 3 HOH 162 562 160 HOH HOH A . D 3 HOH 163 563 85 HOH HOH A . D 3 HOH 164 564 145 HOH HOH A . D 3 HOH 165 565 178 HOH HOH A . D 3 HOH 166 566 211 HOH HOH A . D 3 HOH 167 567 142 HOH HOH A . D 3 HOH 168 568 206 HOH HOH A . D 3 HOH 169 569 203 HOH HOH A . D 3 HOH 170 570 176 HOH HOH A . D 3 HOH 171 571 169 HOH HOH A . D 3 HOH 172 572 166 HOH HOH A . D 3 HOH 173 573 202 HOH HOH A . D 3 HOH 174 574 102 HOH HOH A . D 3 HOH 175 575 188 HOH HOH A . D 3 HOH 176 576 214 HOH HOH A . D 3 HOH 177 577 49 HOH HOH A . D 3 HOH 178 578 89 HOH HOH A . D 3 HOH 179 579 124 HOH HOH A . D 3 HOH 180 580 151 HOH HOH A . D 3 HOH 181 581 107 HOH HOH A . D 3 HOH 182 582 141 HOH HOH A . D 3 HOH 183 583 134 HOH HOH A . D 3 HOH 184 584 170 HOH HOH A . D 3 HOH 185 585 86 HOH HOH A . D 3 HOH 186 586 148 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 102.770 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9YVZ _cell.details ? _cell.formula_units_Z ? _cell.length_a 84.128 _cell.length_a_esd ? _cell.length_b 48.543 _cell.length_b_esd ? _cell.length_c 59.860 _cell.length_c_esd ? _cell.volume 238409.755 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9YVZ _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall 'C 2y' _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9YVZ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.19 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 43.76 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Mother liquor 0.15 M (NH4)2SO4 24% PEG-3350 Soak 0.1 M HEPES, pH 7.5 0.15 M (NH4)2SO4 24% PEG-3350 ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 278 # _diffrn.ambient_environment ? _diffrn.ambient_temp 277 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 S 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-04-26 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.11 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.3.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.11 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.3.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 13.08 _reflns.entry_id 9YVZ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.35 _reflns.d_resolution_low 58.38 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 51150 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.2 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.985 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.35 _reflns_shell.d_res_low 1.37 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2130 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.714 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 18.83 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9YVZ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.35 _refine.ls_d_res_low 58.38 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 51144 _refine.ls_number_reflns_R_free 2511 _refine.ls_number_reflns_R_work 48633 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.72 _refine.ls_percent_reflns_R_free 4.91 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1217 _refine.ls_R_factor_R_free 0.1460 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1205 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.39 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 14.9160 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1298 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.35 _refine_hist.d_res_low 58.38 _refine_hist.number_atoms_solvent 186 _refine_hist.number_atoms_total 1975 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1779 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0079 ? 2336 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 1.0774 ? 3202 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0923 ? 311 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0081 ? 438 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 21.6248 ? 959 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.35 1.38 . . 119 2292 84.48 . . . . 0.2060 . . . . . . . . . . . . . . . 0.2558 'X-RAY DIFFRACTION' 1.38 1.40 . . 130 2624 97.07 . . . . 0.1892 . . . . . . . . . . . . . . . 0.2380 'X-RAY DIFFRACTION' 1.40 1.43 . . 139 2739 99.72 . . . . 0.1669 . . . . . . . . . . . . . . . 0.2120 'X-RAY DIFFRACTION' 1.43 1.47 . . 139 2703 99.75 . . . . 0.1525 . . . . . . . . . . . . . . . 0.2205 'X-RAY DIFFRACTION' 1.47 1.50 . . 144 2719 99.48 . . . . 0.1461 . . . . . . . . . . . . . . . 0.2016 'X-RAY DIFFRACTION' 1.50 1.55 . . 141 2692 99.51 . . . . 0.1318 . . . . . . . . . . . . . . . 0.1902 'X-RAY DIFFRACTION' 1.55 1.59 . . 128 2720 99.75 . . . . 0.1183 . . . . . . . . . . . . . . . 0.1607 'X-RAY DIFFRACTION' 1.59 1.64 . . 150 2714 99.79 . . . . 0.1178 . . . . . . . . . . . . . . . 0.1376 'X-RAY DIFFRACTION' 1.64 1.70 . . 147 2706 99.79 . . . . 0.1172 . . . . . . . . . . . . . . . 0.1507 'X-RAY DIFFRACTION' 1.70 1.77 . . 126 2732 99.55 . . . . 0.1169 . . . . . . . . . . . . . . . 0.1635 'X-RAY DIFFRACTION' 1.77 1.85 . . 145 2718 99.69 . . . . 0.1111 . . . . . . . . . . . . . . . 0.1613 'X-RAY DIFFRACTION' 1.85 1.95 . . 136 2758 99.83 . . . . 0.1037 . . . . . . . . . . . . . . . 0.1197 'X-RAY DIFFRACTION' 1.95 2.07 . . 166 2690 99.90 . . . . 0.1000 . . . . . . . . . . . . . . . 0.1264 'X-RAY DIFFRACTION' 2.07 2.23 . . 152 2730 99.65 . . . . 0.1026 . . . . . . . . . . . . . . . 0.1261 'X-RAY DIFFRACTION' 2.23 2.45 . . 123 2744 99.65 . . . . 0.1092 . . . . . . . . . . . . . . . 0.1582 'X-RAY DIFFRACTION' 2.45 2.81 . . 157 2743 99.62 . . . . 0.1234 . . . . . . . . . . . . . . . 0.1422 'X-RAY DIFFRACTION' 2.81 3.54 . . 126 2774 99.79 . . . . 0.1230 . . . . . . . . . . . . . . . 0.1294 'X-RAY DIFFRACTION' 3.54 58.38 . . 143 2835 99.87 . . . . 0.1204 . . . . . . . . . . . . . . . 0.1314 # _struct.entry_id 9YVZ _struct.title 'Crystal structure of red fluorescent protein mScarlet, 277 K' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9YVZ _struct_keywords.text 'Red fluorescent protein, FLUORESCENT PROTEIN' _struct_keywords.pdbx_keywords 'FLUORESCENT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 9YVZ _struct_ref.pdbx_db_accession 9YVZ _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9YVZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 237 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 9YVZ _struct_ref_seq.db_align_beg -6 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 232 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -6 _struct_ref_seq.pdbx_auth_seq_align_end 232 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 11 ? ILE A 16 ? LYS A 4 ILE A 9 5 ? 6 HELX_P HELX_P2 AA2 SER A 65 ? PHE A 73 ? SER A 58 PHE A 66 5 ? 9 HELX_P HELX_P3 AA3 TYR A 89 ? PHE A 93 ? TYR A 84 PHE A 88 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A PHE 73 C ? ? ? 1_555 A NRQ 74 N1 ? ? A PHE 66 A NRQ 67 1_555 ? ? ? ? ? ? ? 1.422 ? ? covale2 covale both ? A NRQ 74 C3 ? ? ? 1_555 A SER 75 N ? ? A NRQ 67 A SER 70 1_555 ? ? ? ? ? ? ? 1.412 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id NRQ _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 74 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id NRQ _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 67 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id 'MET, TYR, GLY' _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id NRQ _pdbx_modification_feature.type None _pdbx_modification_feature.category Chromophore/chromophore-like # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 60 A . ? GLY 53 A PRO 61 A ? PRO 54 A 1 -5.11 2 GLY 60 A . ? GLY 53 A PRO 61 A ? PRO 54 A 1 -11.73 3 PHE 93 A . ? PHE 88 A PRO 94 A ? PRO 89 A 1 6.37 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 13 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel AA1 10 11 ? anti-parallel AA1 11 12 ? anti-parallel AA1 12 13 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 146 ? TRP A 149 ? THR A 141 TRP A 144 AA1 2 VAL A 162 ? LEU A 173 ? VAL A 157 LEU A 168 AA1 3 ARG A 178 ? ALA A 189 ? ARG A 173 ALA A 184 AA1 4 PHE A 97 ? PHE A 105 ? PHE A 92 PHE A 100 AA1 5 ALA A 110 ? GLU A 120 ? ALA A 105 GLU A 115 AA1 6 THR A 123 ? THR A 133 ? THR A 118 THR A 128 AA1 7 MET A 20 ? MET A 30 ? MET A 13 MET A 23 AA1 8 HIS A 33 ? ARG A 44 ? HIS A 26 ARG A 37 AA1 9 THR A 49 ? LYS A 58 ? THR A 42 LYS A 51 AA1 10 VAL A 216 ? ARG A 226 ? VAL A 211 ARG A 221 AA1 11 TYR A 199 ? HIS A 210 ? TYR A 194 HIS A 205 AA1 12 SER A 152 ? GLU A 159 ? SER A 147 GLU A 154 AA1 13 VAL A 162 ? LEU A 173 ? VAL A 157 LEU A 168 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 148 ? N GLY A 143 O ARG A 172 ? O ARG A 167 AA1 2 3 N LEU A 163 ? N LEU A 158 O TYR A 187 ? O TYR A 182 AA1 3 4 O LYS A 188 ? O LYS A 183 N LYS A 98 ? N LYS A 93 AA1 4 5 N ARG A 101 ? N ARG A 96 O VAL A 113 ? O VAL A 108 AA1 5 6 N SER A 118 ? N SER A 113 O ILE A 125 ? O ILE A 120 AA1 6 7 O TYR A 126 ? O TYR A 121 N LYS A 23 ? N LYS A 16 AA1 7 8 N MET A 26 ? N MET A 19 O ILE A 37 ? O ILE A 30 AA1 8 9 N GLU A 40 ? N GLU A 33 O LYS A 53 ? O LYS A 46 AA1 9 10 N LEU A 54 ? N LEU A 47 O VAL A 217 ? O VAL A 212 AA1 10 11 O ARG A 226 ? O ARG A 221 N ASN A 200 ? N ASN A 195 AA1 11 12 O TYR A 199 ? O TYR A 194 N LEU A 156 ? N LEU A 151 AA1 12 13 N TYR A 157 ? N TYR A 152 O LYS A 164 ? O LYS A 159 # _pdbx_entry_details.entry_id 9YVZ _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD2 A ASP 197 ? ? HE A ARG 221 ? B 1.53 2 1 OD1 A ASP 177 ? B O A HOH 401 ? ? 1.98 3 1 OH A TYR 215 ? B O A HOH 402 ? ? 2.08 4 1 OD1 A ASP 177 ? B O A HOH 403 ? ? 2.09 5 1 O A HOH 497 ? ? O A HOH 548 ? ? 2.15 6 1 O A HOH 512 ? ? O A HOH 559 ? ? 2.16 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 56 ? ? -89.53 30.36 2 1 PHE A 73 ? ? -107.00 66.25 3 1 MET A 142 ? ? -144.93 49.79 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 428 ? D HOH . 2 1 A HOH 577 ? D HOH . 3 1 A HOH 583 ? D HOH . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -x,y,-z 3 x+1/2,y+1/2,z 4 -x+1/2,y+1/2,-z # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -6 ? A MET 1 2 1 Y 1 A HIS -5 ? A HIS 2 3 1 Y 1 A HIS -4 ? A HIS 3 4 1 Y 1 A HIS -3 ? A HIS 4 5 1 Y 1 A HIS -2 ? A HIS 5 6 1 Y 1 A HIS -1 ? A HIS 6 7 1 Y 1 A HIS 0 ? A HIS 7 8 1 Y 1 A GLY 1 ? A GLY 8 9 1 Y 1 A VAL 2 ? A VAL 9 10 1 Y 1 A GLY 226 ? A GLY 231 11 1 Y 1 A MET 227 ? A MET 232 12 1 Y 1 A ASP 228 ? A ASP 233 13 1 Y 1 A GLU 229 ? A GLU 234 14 1 Y 1 A LEU 230 ? A LEU 235 15 1 Y 1 A TYR 231 ? A TYR 236 16 1 Y 1 A LYS 232 ? A LYS 237 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 NRQ N1 N N N 236 NRQ CE C N N 237 NRQ SD S N N 238 NRQ CG1 C N N 239 NRQ CB1 C N N 240 NRQ CA1 C N N 241 NRQ C1 C N N 242 NRQ N2 N N N 243 NRQ OH O N N 244 NRQ CD2 C Y N 245 NRQ CE2 C Y N 246 NRQ CZ C Y N 247 NRQ CE1 C Y N 248 NRQ CD1 C Y N 249 NRQ CG2 C Y N 250 NRQ CB2 C N N 251 NRQ CA2 C N N 252 NRQ C2 C N N 253 NRQ O2 O N N 254 NRQ N3 N N N 255 NRQ CA3 C N N 256 NRQ C3 C N N 257 NRQ O3 O N N 258 NRQ OXT O N N 259 NRQ H H N N 260 NRQ HE1A H N N 261 NRQ HE2A H N N 262 NRQ HE3 H N N 263 NRQ HG11 H N N 264 NRQ HG12 H N N 265 NRQ HB11 H N N 266 NRQ HB12 H N N 267 NRQ HOH H N N 268 NRQ HD2 H N N 269 NRQ HE2 H N N 270 NRQ HE1 H N N 271 NRQ HD1 H N N 272 NRQ HB2 H N N 273 NRQ HA31 H N N 274 NRQ HA32 H N N 275 NRQ HXT H N N 276 PHE N N N N 277 PHE CA C N S 278 PHE C C N N 279 PHE O O N N 280 PHE CB C N N 281 PHE CG C Y N 282 PHE CD1 C Y N 283 PHE CD2 C Y N 284 PHE CE1 C Y N 285 PHE CE2 C Y N 286 PHE CZ C Y N 287 PHE OXT O N N 288 PHE H H N N 289 PHE H2 H N N 290 PHE HA H N N 291 PHE HB2 H N N 292 PHE HB3 H N N 293 PHE HD1 H N N 294 PHE HD2 H N N 295 PHE HE1 H N N 296 PHE HE2 H N N 297 PHE HZ H N N 298 PHE HXT H N N 299 PRO N N N N 300 PRO CA C N S 301 PRO C C N N 302 PRO O O N N 303 PRO CB C N N 304 PRO CG C N N 305 PRO CD C N N 306 PRO OXT O N N 307 PRO H H N N 308 PRO HA H N N 309 PRO HB2 H N N 310 PRO HB3 H N N 311 PRO HG2 H N N 312 PRO HG3 H N N 313 PRO HD2 H N N 314 PRO HD3 H N N 315 PRO HXT H N N 316 SER N N N N 317 SER CA C N S 318 SER C C N N 319 SER O O N N 320 SER CB C N N 321 SER OG O N N 322 SER OXT O N N 323 SER H H N N 324 SER H2 H N N 325 SER HA H N N 326 SER HB2 H N N 327 SER HB3 H N N 328 SER HG H N N 329 SER HXT H N N 330 SO4 S S N N 331 SO4 O1 O N N 332 SO4 O2 O N N 333 SO4 O3 O N N 334 SO4 O4 O N N 335 THR N N N N 336 THR CA C N S 337 THR C C N N 338 THR O O N N 339 THR CB C N R 340 THR OG1 O N N 341 THR CG2 C N N 342 THR OXT O N N 343 THR H H N N 344 THR H2 H N N 345 THR HA H N N 346 THR HB H N N 347 THR HG1 H N N 348 THR HG21 H N N 349 THR HG22 H N N 350 THR HG23 H N N 351 THR HXT H N N 352 TRP N N N N 353 TRP CA C N S 354 TRP C C N N 355 TRP O O N N 356 TRP CB C N N 357 TRP CG C Y N 358 TRP CD1 C Y N 359 TRP CD2 C Y N 360 TRP NE1 N Y N 361 TRP CE2 C Y N 362 TRP CE3 C Y N 363 TRP CZ2 C Y N 364 TRP CZ3 C Y N 365 TRP CH2 C Y N 366 TRP OXT O N N 367 TRP H H N N 368 TRP H2 H N N 369 TRP HA H N N 370 TRP HB2 H N N 371 TRP HB3 H N N 372 TRP HD1 H N N 373 TRP HE1 H N N 374 TRP HE3 H N N 375 TRP HZ2 H N N 376 TRP HZ3 H N N 377 TRP HH2 H N N 378 TRP HXT H N N 379 TYR N N N N 380 TYR CA C N S 381 TYR C C N N 382 TYR O O N N 383 TYR CB C N N 384 TYR CG C Y N 385 TYR CD1 C Y N 386 TYR CD2 C Y N 387 TYR CE1 C Y N 388 TYR CE2 C Y N 389 TYR CZ C Y N 390 TYR OH O N N 391 TYR OXT O N N 392 TYR H H N N 393 TYR H2 H N N 394 TYR HA H N N 395 TYR HB2 H N N 396 TYR HB3 H N N 397 TYR HD1 H N N 398 TYR HD2 H N N 399 TYR HE1 H N N 400 TYR HE2 H N N 401 TYR HH H N N 402 TYR HXT H N N 403 VAL N N N N 404 VAL CA C N S 405 VAL C C N N 406 VAL O O N N 407 VAL CB C N N 408 VAL CG1 C N N 409 VAL CG2 C N N 410 VAL OXT O N N 411 VAL H H N N 412 VAL H2 H N N 413 VAL HA H N N 414 VAL HB H N N 415 VAL HG11 H N N 416 VAL HG12 H N N 417 VAL HG13 H N N 418 VAL HG21 H N N 419 VAL HG22 H N N 420 VAL HG23 H N N 421 VAL HXT H N N 422 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 NRQ OXT C3 sing N N 224 NRQ CE SD sing N N 225 NRQ SD CG1 sing N N 226 NRQ CG1 CB1 sing N N 227 NRQ C3 O3 doub N N 228 NRQ C3 CA3 sing N N 229 NRQ O2 C2 doub N N 230 NRQ C2 CA2 sing N N 231 NRQ C2 N3 sing N N 232 NRQ CA2 CB2 doub N N 233 NRQ CA2 N2 sing N N 234 NRQ CB2 CG2 sing N N 235 NRQ CD2 CG2 doub Y N 236 NRQ CD2 CE2 sing Y N 237 NRQ N3 C1 sing N N 238 NRQ N3 CA3 sing N N 239 NRQ CG2 CD1 sing Y N 240 NRQ CE2 CZ doub Y N 241 NRQ N2 C1 doub N N 242 NRQ C1 CA1 sing N N 243 NRQ CZ OH sing N N 244 NRQ CZ CE1 sing Y N 245 NRQ CA1 CB1 sing N N 246 NRQ CA1 N1 doub N N 247 NRQ CD1 CE1 doub Y N 248 NRQ N1 H sing N N 249 NRQ CE HE1A sing N N 250 NRQ CE HE2A sing N N 251 NRQ CE HE3 sing N N 252 NRQ CG1 HG11 sing N Z 253 NRQ CG1 HG12 sing N N 254 NRQ CB1 HB11 sing N N 255 NRQ CB1 HB12 sing N N 256 NRQ OH HOH sing N N 257 NRQ CD2 HD2 sing N N 258 NRQ CE2 HE2 sing N N 259 NRQ CE1 HE1 sing N N 260 NRQ CD1 HD1 sing N N 261 NRQ CB2 HB2 sing N N 262 NRQ CA3 HA31 sing N N 263 NRQ CA3 HA32 sing N N 264 NRQ OXT HXT sing N N 265 PHE N CA sing N N 266 PHE N H sing N N 267 PHE N H2 sing N N 268 PHE CA C sing N N 269 PHE CA CB sing N N 270 PHE CA HA sing N N 271 PHE C O doub N N 272 PHE C OXT sing N N 273 PHE CB CG sing N N 274 PHE CB HB2 sing N N 275 PHE CB HB3 sing N N 276 PHE CG CD1 doub Y N 277 PHE CG CD2 sing Y N 278 PHE CD1 CE1 sing Y N 279 PHE CD1 HD1 sing N N 280 PHE CD2 CE2 doub Y N 281 PHE CD2 HD2 sing N N 282 PHE CE1 CZ doub Y N 283 PHE CE1 HE1 sing N N 284 PHE CE2 CZ sing Y N 285 PHE CE2 HE2 sing N N 286 PHE CZ HZ sing N N 287 PHE OXT HXT sing N N 288 PRO N CA sing N N 289 PRO N CD sing N N 290 PRO N H sing N N 291 PRO CA C sing N N 292 PRO CA CB sing N N 293 PRO CA HA sing N N 294 PRO C O doub N N 295 PRO C OXT sing N N 296 PRO CB CG sing N N 297 PRO CB HB2 sing N N 298 PRO CB HB3 sing N N 299 PRO CG CD sing N N 300 PRO CG HG2 sing N N 301 PRO CG HG3 sing N N 302 PRO CD HD2 sing N N 303 PRO CD HD3 sing N N 304 PRO OXT HXT sing N N 305 SER N CA sing N N 306 SER N H sing N N 307 SER N H2 sing N N 308 SER CA C sing N N 309 SER CA CB sing N N 310 SER CA HA sing N N 311 SER C O doub N N 312 SER C OXT sing N N 313 SER CB OG sing N N 314 SER CB HB2 sing N N 315 SER CB HB3 sing N N 316 SER OG HG sing N N 317 SER OXT HXT sing N N 318 SO4 S O1 doub N N 319 SO4 S O2 doub N N 320 SO4 S O3 sing N N 321 SO4 S O4 sing N N 322 THR N CA sing N N 323 THR N H sing N N 324 THR N H2 sing N N 325 THR CA C sing N N 326 THR CA CB sing N N 327 THR CA HA sing N N 328 THR C O doub N N 329 THR C OXT sing N N 330 THR CB OG1 sing N N 331 THR CB CG2 sing N N 332 THR CB HB sing N N 333 THR OG1 HG1 sing N N 334 THR CG2 HG21 sing N N 335 THR CG2 HG22 sing N N 336 THR CG2 HG23 sing N N 337 THR OXT HXT sing N N 338 TRP N CA sing N N 339 TRP N H sing N N 340 TRP N H2 sing N N 341 TRP CA C sing N N 342 TRP CA CB sing N N 343 TRP CA HA sing N N 344 TRP C O doub N N 345 TRP C OXT sing N N 346 TRP CB CG sing N N 347 TRP CB HB2 sing N N 348 TRP CB HB3 sing N N 349 TRP CG CD1 doub Y N 350 TRP CG CD2 sing Y N 351 TRP CD1 NE1 sing Y N 352 TRP CD1 HD1 sing N N 353 TRP CD2 CE2 doub Y N 354 TRP CD2 CE3 sing Y N 355 TRP NE1 CE2 sing Y N 356 TRP NE1 HE1 sing N N 357 TRP CE2 CZ2 sing Y N 358 TRP CE3 CZ3 doub Y N 359 TRP CE3 HE3 sing N N 360 TRP CZ2 CH2 doub Y N 361 TRP CZ2 HZ2 sing N N 362 TRP CZ3 CH2 sing Y N 363 TRP CZ3 HZ3 sing N N 364 TRP CH2 HH2 sing N N 365 TRP OXT HXT sing N N 366 TYR N CA sing N N 367 TYR N H sing N N 368 TYR N H2 sing N N 369 TYR CA C sing N N 370 TYR CA CB sing N N 371 TYR CA HA sing N N 372 TYR C O doub N N 373 TYR C OXT sing N N 374 TYR CB CG sing N N 375 TYR CB HB2 sing N N 376 TYR CB HB3 sing N N 377 TYR CG CD1 doub Y N 378 TYR CG CD2 sing Y N 379 TYR CD1 CE1 sing Y N 380 TYR CD1 HD1 sing N N 381 TYR CD2 CE2 doub Y N 382 TYR CD2 HD2 sing N N 383 TYR CE1 CZ doub Y N 384 TYR CE1 HE1 sing N N 385 TYR CE2 CZ sing Y N 386 TYR CE2 HE2 sing N N 387 TYR CZ OH sing N N 388 TYR OH HH sing N N 389 TYR OXT HXT sing N N 390 VAL N CA sing N N 391 VAL N H sing N N 392 VAL N H2 sing N N 393 VAL CA C sing N N 394 VAL CA CB sing N N 395 VAL CA HA sing N N 396 VAL C O doub N N 397 VAL C OXT sing N N 398 VAL CB CG1 sing N N 399 VAL CB CG2 sing N N 400 VAL CB HB sing N N 401 VAL CG1 HG11 sing N N 402 VAL CG1 HG12 sing N N 403 VAL CG1 HG13 sing N N 404 VAL CG2 HG21 sing N N 405 VAL CG2 HG22 sing N N 406 VAL CG2 HG23 sing N N 407 VAL OXT HXT sing N N 408 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Natural Sciences and Engineering Research Council (NSERC, Canada)' Canada RGPIN-2016-04831 1 'Canada Foundation for Innovation' Canada 26503 2 'Human Frontier Science Program (HFSP)' France RGP0041/2016 3 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5lk4 _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'C 1 2 1' _space_group.name_Hall 'C 2y' _space_group.IT_number 5 _space_group.crystal_system monoclinic _space_group.id 1 # _atom_sites.entry_id 9YVZ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.011887 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002694 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020600 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017129 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #