data_9ZZ4 # _entry.id 9ZZ4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.414 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9ZZ4 pdb_00009zz4 10.2210/pdb9zz4/pdb WWPDB D_1000304007 ? ? BMRB 51518 ? 10.13018/BMR51518 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2026-04-08 ? 2 'Structure model' 1 1 2026-05-27 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9ZZ4 _pdbx_database_status.recvd_initial_deposition_date 2026-01-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 51518 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 3 _pdbx_contact_author.email jbames@ucdavis.edu _pdbx_contact_author.name_first James _pdbx_contact_author.name_last Ames _pdbx_contact_author.name_mi B _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-0934-2595 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Salveson, I.' 1 ? 'Anderson, D.E.' 2 ? 'Bej, A.' 3 ? 'Ames, J.B.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 0006-2960 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 65 _citation.language ? _citation.page_first 1668 _citation.page_last 1676 _citation.title 'Structural Insights into L-Type Voltage-Gated Ca 2+ Channel (Ca V 1.2) Activation by CaBP1.' _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.6c00032 _citation.pdbx_database_id_PubMed 41859936 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Salveson, I.' 1 ? primary 'Anderson, D.E.' 2 ? primary 'Bej, A.' 3 ? primary 'Nieves-Cintron, M.' 4 ? primary 'Navedo, M.' 5 ? primary 'Hell, J.W.' 6 ? primary 'Ames, J.B.' 7 0000-0003-0934-2595 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Calcium-binding protein 1' 17823.076 1 ? ? ? ? 2 polymer syn 'Voltage-dependent L-type calcium channel subunit alpha-1C' 2920.431 1 ? ? 'IQ Motif (UNP residues 1587-1609)' ? 3 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 CaBP1,Calbrain,Caldendrin 2 'Calcium channel, L type, alpha-1 polypeptide, isoform 1, cardiac muscle, Voltage-gated calcium channel subunit alpha Cav1.2' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MDRSLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDFDDFVELMGPKLLAE TADMIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVRMMSR ; ;MDRSLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDFDDFVELMGPKLLAE TADMIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVRMMSR ; A ? 2 'polypeptide(L)' no no GKFYATFLIQEYFRKFKKRKEQG GKFYATFLIQEYFRKFKKRKEQG B ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 ARG n 1 4 SER n 1 5 LEU n 1 6 ARG n 1 7 PRO n 1 8 GLU n 1 9 GLU n 1 10 ILE n 1 11 GLU n 1 12 GLU n 1 13 LEU n 1 14 ARG n 1 15 GLU n 1 16 ALA n 1 17 PHE n 1 18 ARG n 1 19 GLU n 1 20 PHE n 1 21 ASP n 1 22 LYS n 1 23 ASP n 1 24 LYS n 1 25 ASP n 1 26 GLY n 1 27 TYR n 1 28 ILE n 1 29 ASN n 1 30 CYS n 1 31 ARG n 1 32 ASP n 1 33 LEU n 1 34 GLY n 1 35 ASN n 1 36 CYS n 1 37 MET n 1 38 ARG n 1 39 THR n 1 40 MET n 1 41 GLY n 1 42 TYR n 1 43 MET n 1 44 PRO n 1 45 THR n 1 46 GLU n 1 47 MET n 1 48 GLU n 1 49 LEU n 1 50 ILE n 1 51 GLU n 1 52 LEU n 1 53 SER n 1 54 GLN n 1 55 GLN n 1 56 ILE n 1 57 ASN n 1 58 MET n 1 59 ASN n 1 60 LEU n 1 61 GLY n 1 62 GLY n 1 63 HIS n 1 64 VAL n 1 65 ASP n 1 66 PHE n 1 67 ASP n 1 68 ASP n 1 69 PHE n 1 70 VAL n 1 71 GLU n 1 72 LEU n 1 73 MET n 1 74 GLY n 1 75 PRO n 1 76 LYS n 1 77 LEU n 1 78 LEU n 1 79 ALA n 1 80 GLU n 1 81 THR n 1 82 ALA n 1 83 ASP n 1 84 MET n 1 85 ILE n 1 86 GLY n 1 87 VAL n 1 88 LYS n 1 89 GLU n 1 90 LEU n 1 91 ARG n 1 92 ASP n 1 93 ALA n 1 94 PHE n 1 95 ARG n 1 96 GLU n 1 97 PHE n 1 98 ASP n 1 99 THR n 1 100 ASN n 1 101 GLY n 1 102 ASP n 1 103 GLY n 1 104 GLU n 1 105 ILE n 1 106 SER n 1 107 THR n 1 108 SER n 1 109 GLU n 1 110 LEU n 1 111 ARG n 1 112 GLU n 1 113 ALA n 1 114 MET n 1 115 ARG n 1 116 LYS n 1 117 LEU n 1 118 LEU n 1 119 GLY n 1 120 HIS n 1 121 GLN n 1 122 VAL n 1 123 GLY n 1 124 HIS n 1 125 ARG n 1 126 ASP n 1 127 ILE n 1 128 GLU n 1 129 GLU n 1 130 ILE n 1 131 ILE n 1 132 ARG n 1 133 ASP n 1 134 VAL n 1 135 ASP n 1 136 LEU n 1 137 ASN n 1 138 GLY n 1 139 ASP n 1 140 GLY n 1 141 ARG n 1 142 VAL n 1 143 ASP n 1 144 PHE n 1 145 GLU n 1 146 GLU n 1 147 PHE n 1 148 VAL n 1 149 ARG n 1 150 MET n 1 151 MET n 1 152 SER n 1 153 ARG n 2 1 GLY n 2 2 LYS n 2 3 PHE n 2 4 TYR n 2 5 ALA n 2 6 THR n 2 7 PHE n 2 8 LEU n 2 9 ILE n 2 10 GLN n 2 11 GLU n 2 12 TYR n 2 13 PHE n 2 14 ARG n 2 15 LYS n 2 16 PHE n 2 17 LYS n 2 18 LYS n 2 19 ARG n 2 20 LYS n 2 21 GLU n 2 22 GLN n 2 23 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 153 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CABP1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 23 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 15 15 MET MET A . n A 1 2 ASP 2 16 16 ASP ASP A . n A 1 3 ARG 3 17 17 ARG ARG A . n A 1 4 SER 4 18 18 SER SER A . n A 1 5 LEU 5 19 19 LEU LEU A . n A 1 6 ARG 6 20 20 ARG ARG A . n A 1 7 PRO 7 21 21 PRO PRO A . n A 1 8 GLU 8 22 22 GLU GLU A . n A 1 9 GLU 9 23 23 GLU GLU A . n A 1 10 ILE 10 24 24 ILE ILE A . n A 1 11 GLU 11 25 25 GLU GLU A . n A 1 12 GLU 12 26 26 GLU GLU A . n A 1 13 LEU 13 27 27 LEU LEU A . n A 1 14 ARG 14 28 28 ARG ARG A . n A 1 15 GLU 15 29 29 GLU GLU A . n A 1 16 ALA 16 30 30 ALA ALA A . n A 1 17 PHE 17 31 31 PHE PHE A . n A 1 18 ARG 18 32 32 ARG ARG A . n A 1 19 GLU 19 33 33 GLU GLU A . n A 1 20 PHE 20 34 34 PHE PHE A . n A 1 21 ASP 21 35 35 ASP ASP A . n A 1 22 LYS 22 36 36 LYS LYS A . n A 1 23 ASP 23 37 37 ASP ASP A . n A 1 24 LYS 24 38 38 LYS LYS A . n A 1 25 ASP 25 39 39 ASP ASP A . n A 1 26 GLY 26 40 40 GLY GLY A . n A 1 27 TYR 27 41 41 TYR TYR A . n A 1 28 ILE 28 42 42 ILE ILE A . n A 1 29 ASN 29 43 43 ASN ASN A . n A 1 30 CYS 30 44 44 CYS CYS A . n A 1 31 ARG 31 45 45 ARG ARG A . n A 1 32 ASP 32 46 46 ASP ASP A . n A 1 33 LEU 33 47 47 LEU LEU A . n A 1 34 GLY 34 48 48 GLY GLY A . n A 1 35 ASN 35 49 49 ASN ASN A . n A 1 36 CYS 36 50 50 CYS CYS A . n A 1 37 MET 37 51 51 MET MET A . n A 1 38 ARG 38 52 52 ARG ARG A . n A 1 39 THR 39 53 53 THR THR A . n A 1 40 MET 40 54 54 MET MET A . n A 1 41 GLY 41 55 55 GLY GLY A . n A 1 42 TYR 42 56 56 TYR TYR A . n A 1 43 MET 43 57 57 MET MET A . n A 1 44 PRO 44 58 58 PRO PRO A . n A 1 45 THR 45 59 59 THR THR A . n A 1 46 GLU 46 60 60 GLU GLU A . n A 1 47 MET 47 61 61 MET MET A . n A 1 48 GLU 48 62 62 GLU GLU A . n A 1 49 LEU 49 63 63 LEU LEU A . n A 1 50 ILE 50 64 64 ILE ILE A . n A 1 51 GLU 51 65 65 GLU GLU A . n A 1 52 LEU 52 66 66 LEU LEU A . n A 1 53 SER 53 67 67 SER SER A . n A 1 54 GLN 54 68 68 GLN GLN A . n A 1 55 GLN 55 69 69 GLN GLN A . n A 1 56 ILE 56 70 70 ILE ILE A . n A 1 57 ASN 57 71 71 ASN ASN A . n A 1 58 MET 58 72 72 MET MET A . n A 1 59 ASN 59 73 73 ASN ASN A . n A 1 60 LEU 60 74 74 LEU LEU A . n A 1 61 GLY 61 75 75 GLY GLY A . n A 1 62 GLY 62 76 76 GLY GLY A . n A 1 63 HIS 63 77 77 HIS HIS A . n A 1 64 VAL 64 78 78 VAL VAL A . n A 1 65 ASP 65 79 79 ASP ASP A . n A 1 66 PHE 66 80 80 PHE PHE A . n A 1 67 ASP 67 81 81 ASP ASP A . n A 1 68 ASP 68 82 82 ASP ASP A . n A 1 69 PHE 69 83 83 PHE PHE A . n A 1 70 VAL 70 84 84 VAL VAL A . n A 1 71 GLU 71 85 85 GLU GLU A . n A 1 72 LEU 72 86 86 LEU LEU A . n A 1 73 MET 73 87 87 MET MET A . n A 1 74 GLY 74 88 88 GLY GLY A . n A 1 75 PRO 75 89 89 PRO PRO A . n A 1 76 LYS 76 90 90 LYS LYS A . n A 1 77 LEU 77 91 91 LEU LEU A . n A 1 78 LEU 78 92 92 LEU LEU A . n A 1 79 ALA 79 93 93 ALA ALA A . n A 1 80 GLU 80 94 94 GLU GLU A . n A 1 81 THR 81 95 95 THR THR A . n A 1 82 ALA 82 96 96 ALA ALA A . n A 1 83 ASP 83 97 97 ASP ASP A . n A 1 84 MET 84 98 98 MET MET A . n A 1 85 ILE 85 99 99 ILE ILE A . n A 1 86 GLY 86 100 100 GLY GLY A . n A 1 87 VAL 87 101 101 VAL VAL A . n A 1 88 LYS 88 102 102 LYS LYS A . n A 1 89 GLU 89 103 103 GLU GLU A . n A 1 90 LEU 90 104 104 LEU LEU A . n A 1 91 ARG 91 105 105 ARG ARG A . n A 1 92 ASP 92 106 106 ASP ASP A . n A 1 93 ALA 93 107 107 ALA ALA A . n A 1 94 PHE 94 108 108 PHE PHE A . n A 1 95 ARG 95 109 109 ARG ARG A . n A 1 96 GLU 96 110 110 GLU GLU A . n A 1 97 PHE 97 111 111 PHE PHE A . n A 1 98 ASP 98 112 112 ASP ASP A . n A 1 99 THR 99 113 113 THR THR A . n A 1 100 ASN 100 114 114 ASN ASN A . n A 1 101 GLY 101 115 115 GLY GLY A . n A 1 102 ASP 102 116 116 ASP ASP A . n A 1 103 GLY 103 117 117 GLY GLY A . n A 1 104 GLU 104 118 118 GLU GLU A . n A 1 105 ILE 105 119 119 ILE ILE A . n A 1 106 SER 106 120 120 SER SER A . n A 1 107 THR 107 121 121 THR THR A . n A 1 108 SER 108 122 122 SER SER A . n A 1 109 GLU 109 123 123 GLU GLU A . n A 1 110 LEU 110 124 124 LEU LEU A . n A 1 111 ARG 111 125 125 ARG ARG A . n A 1 112 GLU 112 126 126 GLU GLU A . n A 1 113 ALA 113 127 127 ALA ALA A . n A 1 114 MET 114 128 128 MET MET A . n A 1 115 ARG 115 129 129 ARG ARG A . n A 1 116 LYS 116 130 130 LYS LYS A . n A 1 117 LEU 117 131 131 LEU LEU A . n A 1 118 LEU 118 132 132 LEU LEU A . n A 1 119 GLY 119 133 133 GLY GLY A . n A 1 120 HIS 120 134 134 HIS HIS A . n A 1 121 GLN 121 135 135 GLN GLN A . n A 1 122 VAL 122 136 136 VAL VAL A . n A 1 123 GLY 123 137 137 GLY GLY A . n A 1 124 HIS 124 138 138 HIS HIS A . n A 1 125 ARG 125 139 139 ARG ARG A . n A 1 126 ASP 126 140 140 ASP ASP A . n A 1 127 ILE 127 141 141 ILE ILE A . n A 1 128 GLU 128 142 142 GLU GLU A . n A 1 129 GLU 129 143 143 GLU GLU A . n A 1 130 ILE 130 144 144 ILE ILE A . n A 1 131 ILE 131 145 145 ILE ILE A . n A 1 132 ARG 132 146 146 ARG ARG A . n A 1 133 ASP 133 147 147 ASP ASP A . n A 1 134 VAL 134 148 148 VAL VAL A . n A 1 135 ASP 135 149 149 ASP ASP A . n A 1 136 LEU 136 150 150 LEU LEU A . n A 1 137 ASN 137 151 151 ASN ASN A . n A 1 138 GLY 138 152 152 GLY GLY A . n A 1 139 ASP 139 153 153 ASP ASP A . n A 1 140 GLY 140 154 154 GLY GLY A . n A 1 141 ARG 141 155 155 ARG ARG A . n A 1 142 VAL 142 156 156 VAL VAL A . n A 1 143 ASP 143 157 157 ASP ASP A . n A 1 144 PHE 144 158 158 PHE PHE A . n A 1 145 GLU 145 159 159 GLU GLU A . n A 1 146 GLU 146 160 160 GLU GLU A . n A 1 147 PHE 147 161 161 PHE PHE A . n A 1 148 VAL 148 162 162 VAL VAL A . n A 1 149 ARG 149 163 163 ARG ARG A . n A 1 150 MET 150 164 164 MET MET A . n A 1 151 MET 151 165 165 MET MET A . n A 1 152 SER 152 166 166 SER SER A . n A 1 153 ARG 153 167 167 ARG ARG A . n B 2 1 GLY 1 1646 1646 GLY GLY B . n B 2 2 LYS 2 1647 1647 LYS LYS B . n B 2 3 PHE 3 1648 1648 PHE PHE B . n B 2 4 TYR 4 1649 1649 TYR TYR B . n B 2 5 ALA 5 1650 1650 ALA ALA B . n B 2 6 THR 6 1651 1651 THR THR B . n B 2 7 PHE 7 1652 1652 PHE PHE B . n B 2 8 LEU 8 1653 1653 LEU LEU B . n B 2 9 ILE 9 1654 1654 ILE ILE B . n B 2 10 GLN 10 1655 1655 GLN GLN B . n B 2 11 GLU 11 1656 1656 GLU GLU B . n B 2 12 TYR 12 1657 1657 TYR TYR B . n B 2 13 PHE 13 1658 1658 PHE PHE B . n B 2 14 ARG 14 1659 1659 ARG ARG B . n B 2 15 LYS 15 1660 1660 LYS LYS B . n B 2 16 PHE 16 1661 1661 PHE PHE B . n B 2 17 LYS 17 1662 1662 LYS LYS B . n B 2 18 LYS 18 1663 1663 LYS LYS B . n B 2 19 ARG 19 1664 1664 ARG ARG B . n B 2 20 LYS 20 1665 1665 LYS LYS B . n B 2 21 GLU 21 1666 1666 GLU GLU B . n B 2 22 GLN 22 1667 1667 GLN GLN B . n B 2 23 GLY 23 1668 1668 GLY GLY B . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id CA _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id CA _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 CA 1 501 501 CA CA2 A . D 3 CA 1 502 502 CA CA2 A . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9ZZ4 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9ZZ4 _struct.title 'NMR structure of CaBP1 bound to the IQ motif of Cav1.2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9ZZ4 _struct_keywords.text 'METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP CABP1_HUMAN Q9NZU7 ? 1 ;DRSLRPEEIEELREAFREFDKDKDGYINCRDLGNCMRTMGYMPTEMELIELSQQINMNLGGHVDFDDFVELMGPKLLAET ADMIGVKELRDAFREFDTNGDGEISTSELREAMRKLLGHQVGHRDIEEIIRDVDLNGDGRVDFEEFVRMMSR ; 219 2 UNP CAC1C_HUMAN Q13936 Q13936-17 2 GKFYATFLIQEYFRKFKKRKEQG 1587 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9ZZ4 A 2 ? 153 ? Q9NZU7 219 ? 370 ? 16 167 2 2 9ZZ4 B 1 ? 23 ? Q13936 1587 ? 1609 ? 1646 1668 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 9ZZ4 _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q9NZU7 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 15 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 6 ? ASP A 21 ? ARG A 20 ASP A 35 1 ? 16 HELX_P HELX_P2 AA2 ASN A 29 ? MET A 37 ? ASN A 43 MET A 51 1 ? 9 HELX_P HELX_P3 AA3 THR A 45 ? MET A 58 ? THR A 59 MET A 72 1 ? 14 HELX_P HELX_P4 AA4 ASP A 65 ? LEU A 78 ? ASP A 79 LEU A 92 1 ? 14 HELX_P HELX_P5 AA5 THR A 81 ? GLY A 86 ? THR A 95 GLY A 100 1 ? 6 HELX_P HELX_P6 AA6 GLY A 86 ? ASP A 98 ? GLY A 100 ASP A 112 1 ? 13 HELX_P HELX_P7 AA7 SER A 106 ? GLY A 119 ? SER A 120 GLY A 133 1 ? 14 HELX_P HELX_P8 AA8 GLY A 123 ? ASP A 135 ? GLY A 137 ASP A 149 1 ? 13 HELX_P HELX_P9 AA9 ASP A 143 ? MET A 151 ? ASP A 157 MET A 165 1 ? 9 HELX_P HELX_P10 AB1 LYS B 2 ? GLN B 22 ? LYS B 1647 GLN B 1667 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 98 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 112 A CA 501 1_555 ? ? ? ? ? ? ? 2.166 ? ? metalc2 metalc ? ? A ASN 100 OD1 ? ? ? 1_555 C CA . CA ? ? A ASN 114 A CA 501 1_555 ? ? ? ? ? ? ? 2.256 ? ? metalc3 metalc ? ? A ASP 102 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 116 A CA 501 1_555 ? ? ? ? ? ? ? 2.208 ? ? metalc4 metalc ? ? A GLU 104 O ? ? ? 1_555 C CA . CA ? ? A GLU 118 A CA 501 1_555 ? ? ? ? ? ? ? 2.251 ? ? metalc5 metalc ? ? A GLU 109 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 123 A CA 501 1_555 ? ? ? ? ? ? ? 2.313 ? ? metalc6 metalc ? ? A GLU 109 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 123 A CA 501 1_555 ? ? ? ? ? ? ? 2.409 ? ? metalc7 metalc ? ? A ASP 135 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 149 A CA 502 1_555 ? ? ? ? ? ? ? 2.316 ? ? metalc8 metalc ? ? A ASN 137 OD1 ? ? ? 1_555 D CA . CA ? ? A ASN 151 A CA 502 1_555 ? ? ? ? ? ? ? 2.368 ? ? metalc9 metalc ? ? A ASP 139 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 153 A CA 502 1_555 ? ? ? ? ? ? ? 2.215 ? ? metalc10 metalc ? ? A ARG 141 O ? ? ? 1_555 D CA . CA ? ? A ARG 155 A CA 502 1_555 ? ? ? ? ? ? ? 2.359 ? ? metalc11 metalc ? ? A GLU 146 OE1 ? ? ? 1_555 D CA . CA ? ? A GLU 160 A CA 502 1_555 ? ? ? ? ? ? ? 2.345 ? ? metalc12 metalc ? ? A GLU 146 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 160 A CA 502 1_555 ? ? ? ? ? ? ? 2.443 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 98 ? A ASP 112 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OD1 ? A ASN 100 ? A ASN 114 ? 1_555 85.0 ? 2 OD1 ? A ASP 98 ? A ASP 112 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OD1 ? A ASP 102 ? A ASP 116 ? 1_555 82.3 ? 3 OD1 ? A ASN 100 ? A ASN 114 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OD1 ? A ASP 102 ? A ASP 116 ? 1_555 84.9 ? 4 OD1 ? A ASP 98 ? A ASP 112 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O ? A GLU 104 ? A GLU 118 ? 1_555 123.2 ? 5 OD1 ? A ASN 100 ? A ASN 114 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O ? A GLU 104 ? A GLU 118 ? 1_555 143.7 ? 6 OD1 ? A ASP 102 ? A ASP 116 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 O ? A GLU 104 ? A GLU 118 ? 1_555 77.8 ? 7 OD1 ? A ASP 98 ? A ASP 112 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OE1 ? A GLU 109 ? A GLU 123 ? 1_555 91.9 ? 8 OD1 ? A ASN 100 ? A ASN 114 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OE1 ? A GLU 109 ? A GLU 123 ? 1_555 76.0 ? 9 OD1 ? A ASP 102 ? A ASP 116 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OE1 ? A GLU 109 ? A GLU 123 ? 1_555 160.4 ? 10 O ? A GLU 104 ? A GLU 118 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OE1 ? A GLU 109 ? A GLU 123 ? 1_555 120.4 ? 11 OD1 ? A ASP 98 ? A ASP 112 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OE2 ? A GLU 109 ? A GLU 123 ? 1_555 145.3 ? 12 OD1 ? A ASN 100 ? A ASN 114 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OE2 ? A GLU 109 ? A GLU 123 ? 1_555 94.5 ? 13 OD1 ? A ASP 102 ? A ASP 116 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OE2 ? A GLU 109 ? A GLU 123 ? 1_555 132.4 ? 14 O ? A GLU 104 ? A GLU 118 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OE2 ? A GLU 109 ? A GLU 123 ? 1_555 75.1 ? 15 OE1 ? A GLU 109 ? A GLU 123 ? 1_555 CA ? C CA . ? A CA 501 ? 1_555 OE2 ? A GLU 109 ? A GLU 123 ? 1_555 54.8 ? 16 OD1 ? A ASP 135 ? A ASP 149 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 OD1 ? A ASN 137 ? A ASN 151 ? 1_555 81.4 ? 17 OD1 ? A ASP 135 ? A ASP 149 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 OD1 ? A ASP 139 ? A ASP 153 ? 1_555 94.2 ? 18 OD1 ? A ASN 137 ? A ASN 151 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 OD1 ? A ASP 139 ? A ASP 153 ? 1_555 79.5 ? 19 OD1 ? A ASP 135 ? A ASP 149 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O ? A ARG 141 ? A ARG 155 ? 1_555 94.8 ? 20 OD1 ? A ASN 137 ? A ASN 151 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O ? A ARG 141 ? A ARG 155 ? 1_555 156.5 ? 21 OD1 ? A ASP 139 ? A ASP 153 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 O ? A ARG 141 ? A ARG 155 ? 1_555 77.7 ? 22 OD1 ? A ASP 135 ? A ASP 149 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 OE1 ? A GLU 146 ? A GLU 160 ? 1_555 101.9 ? 23 OD1 ? A ASN 137 ? A ASN 151 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 OE1 ? A GLU 146 ? A GLU 160 ? 1_555 124.8 ? 24 OD1 ? A ASP 139 ? A ASP 153 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 OE1 ? A GLU 146 ? A GLU 160 ? 1_555 152.4 ? 25 O ? A ARG 141 ? A ARG 155 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 OE1 ? A GLU 146 ? A GLU 160 ? 1_555 78.7 ? 26 OD1 ? A ASP 135 ? A ASP 149 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 OE2 ? A GLU 146 ? A GLU 160 ? 1_555 66.3 ? 27 OD1 ? A ASN 137 ? A ASN 151 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 OE2 ? A GLU 146 ? A GLU 160 ? 1_555 79.9 ? 28 OD1 ? A ASP 139 ? A ASP 153 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 OE2 ? A GLU 146 ? A GLU 160 ? 1_555 153.4 ? 29 O ? A ARG 141 ? A ARG 155 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 OE2 ? A GLU 146 ? A GLU 160 ? 1_555 120.0 ? 30 OE1 ? A GLU 146 ? A GLU 160 ? 1_555 CA ? D CA . ? A CA 502 ? 1_555 OE2 ? A GLU 146 ? A GLU 160 ? 1_555 53.8 ? # _pdbx_entry_details.entry_id 9ZZ4 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 126 ? ? HZ3 A LYS 130 ? ? 1.55 2 1 OE1 B GLU 1656 ? ? HH21 B ARG 1659 ? ? 1.56 3 1 OD1 A ASP 147 ? ? HH21 A ARG 163 ? ? 1.57 4 1 OE1 A GLU 126 ? ? HH11 A ARG 129 ? ? 1.58 5 2 HZ1 A LYS 102 ? ? OE1 A GLU 103 ? ? 1.52 6 2 HZ3 B LYS 1663 ? ? OE2 B GLU 1666 ? ? 1.52 7 2 OE2 A GLU 126 ? ? HZ3 A LYS 130 ? ? 1.55 8 2 OE1 B GLU 1656 ? ? HH21 B ARG 1659 ? ? 1.56 9 2 OE1 A GLU 142 ? ? HH12 A ARG 146 ? ? 1.56 10 2 OD1 A ASP 147 ? ? HH21 A ARG 163 ? ? 1.58 11 2 OD2 A ASP 106 ? ? HH21 A ARG 109 ? ? 1.58 12 2 OE1 A GLU 126 ? ? HH11 A ARG 129 ? ? 1.59 13 2 OD1 A ASP 16 ? ? HZ1 B LYS 1660 ? ? 1.59 14 2 OD2 A ASP 16 ? ? HH22 A ARG 167 ? ? 1.59 15 3 HZ3 B LYS 1663 ? ? OE2 B GLU 1666 ? ? 1.52 16 3 OE2 A GLU 126 ? ? HZ3 A LYS 130 ? ? 1.53 17 3 OD2 A ASP 16 ? ? HH12 A ARG 167 ? ? 1.53 18 3 OD1 A ASP 147 ? ? HH21 A ARG 163 ? ? 1.56 19 3 OE1 B GLU 1656 ? ? HH21 B ARG 1659 ? ? 1.58 20 3 OE1 A GLU 143 ? ? HH21 A ARG 146 ? ? 1.60 21 4 OE1 B GLU 1656 ? ? HH21 B ARG 1659 ? ? 1.52 22 4 HZ3 B LYS 1663 ? ? OE2 B GLU 1666 ? ? 1.53 23 4 OE2 A GLU 126 ? ? HZ3 A LYS 130 ? ? 1.53 24 4 OE2 A GLU 29 ? ? HH22 A ARG 32 ? ? 1.56 25 4 OD1 A ASP 140 ? ? HZ2 B LYS 1662 ? ? 1.56 26 4 HH22 A ARG 17 ? ? OE2 A GLU 23 ? ? 1.58 27 4 OE1 A GLU 29 ? ? HE A ARG 32 ? ? 1.59 28 4 OD1 A ASP 147 ? ? HH21 A ARG 163 ? ? 1.59 29 4 HZ1 B LYS 1662 ? ? OE1 B GLU 1666 ? ? 1.59 30 4 OD2 A ASP 16 ? ? HH12 A ARG 167 ? ? 1.60 31 5 HZ3 A LYS 102 ? ? OE1 A GLU 103 ? ? 1.48 32 5 OE2 A GLU 126 ? ? HZ3 A LYS 130 ? ? 1.54 33 5 OD2 A ASP 16 ? ? HH12 A ARG 167 ? ? 1.55 34 5 OE1 B GLU 1656 ? ? HH21 B ARG 1659 ? ? 1.56 35 5 OD2 A ASP 106 ? ? HZ2 B LYS 1647 ? ? 1.57 36 5 HH22 A ARG 17 ? ? OE2 A GLU 23 ? ? 1.58 37 5 OE1 A GLU 143 ? ? HH21 A ARG 146 ? ? 1.58 38 5 OE2 A GLU 29 ? ? HH22 A ARG 32 ? ? 1.59 39 5 HZ1 B LYS 1663 ? ? OE2 B GLU 1666 ? ? 1.59 40 5 OE1 A GLU 142 ? ? HH12 A ARG 146 ? ? 1.60 41 5 OE1 A GLU 126 ? ? HH11 A ARG 129 ? ? 1.60 42 6 HH21 A ARG 20 ? ? OE1 A GLU 22 ? ? 1.53 43 6 OE2 A GLU 126 ? ? HZ3 A LYS 130 ? ? 1.53 44 6 OE1 B GLU 1656 ? ? HH21 B ARG 1659 ? ? 1.54 45 6 OE2 A GLU 29 ? ? HH22 A ARG 32 ? ? 1.57 46 6 OE1 A GLU 126 ? ? HH11 A ARG 129 ? ? 1.58 47 6 OD2 A ASP 16 ? ? HH12 A ARG 167 ? ? 1.58 48 6 HZ1 B LYS 1663 ? ? OE2 B GLU 1666 ? ? 1.59 49 6 OE1 A GLU 143 ? ? HH21 A ARG 146 ? ? 1.59 50 6 HH22 A ARG 17 ? ? OE2 A GLU 23 ? ? 1.60 51 6 OD2 A ASP 106 ? ? HH11 A ARG 109 ? ? 1.60 52 7 OE1 B GLU 1656 ? ? HH21 B ARG 1659 ? ? 1.54 53 7 HZ3 A LYS 102 ? ? OE1 A GLU 103 ? ? 1.54 54 7 OE2 A GLU 126 ? ? HZ3 A LYS 130 ? ? 1.54 55 7 HH22 A ARG 17 ? ? OE2 A GLU 23 ? ? 1.57 56 7 OD2 A ASP 16 ? ? HH12 A ARG 167 ? ? 1.57 57 7 OE1 A GLU 94 ? ? HZ3 B LYS 1660 ? ? 1.58 58 7 OE1 A GLU 143 ? ? HH21 A ARG 146 ? ? 1.59 59 7 OD1 A ASP 147 ? ? HH21 A ARG 163 ? ? 1.60 60 7 O A ASP 147 ? ? HH12 A ARG 163 ? ? 1.60 61 8 OE2 A GLU 126 ? ? HZ3 A LYS 130 ? ? 1.54 62 8 OE1 A GLU 142 ? ? HH12 A ARG 146 ? ? 1.55 63 8 OE2 A GLU 29 ? ? HH22 A ARG 32 ? ? 1.57 64 8 OE1 A GLU 143 ? ? HH21 A ARG 146 ? ? 1.58 65 8 OE1 A GLU 29 ? ? HE A ARG 32 ? ? 1.59 66 8 OE1 A GLU 126 ? ? HH11 A ARG 129 ? ? 1.60 67 9 OE2 A GLU 126 ? ? HZ3 A LYS 130 ? ? 1.54 68 9 OE1 B GLU 1656 ? ? HH21 B ARG 1659 ? ? 1.56 69 9 OD1 A ASP 147 ? ? HH21 A ARG 163 ? ? 1.59 70 9 OD2 A ASP 16 ? ? HH12 A ARG 167 ? ? 1.59 71 9 OD1 A ASP 106 ? ? HH11 A ARG 109 ? ? 1.60 72 10 HZ1 A LYS 102 ? ? OE1 A GLU 103 ? ? 1.49 73 10 HZ3 B LYS 1663 ? ? OE2 B GLU 1666 ? ? 1.51 74 10 OE2 A GLU 110 ? ? HZ2 B LYS 1647 ? ? 1.52 75 10 OD2 A ASP 106 ? ? HH11 A ARG 109 ? ? 1.53 76 10 OE2 A GLU 126 ? ? HZ3 A LYS 130 ? ? 1.53 77 10 OE1 B GLU 1656 ? ? HH21 B ARG 1659 ? ? 1.53 78 10 OD1 A ASP 16 ? ? HZ1 B LYS 1660 ? ? 1.55 79 10 OE2 A GLU 29 ? ? HH22 A ARG 32 ? ? 1.57 80 10 OD1 A ASP 147 ? ? HH21 A ARG 163 ? ? 1.58 81 10 HH22 A ARG 17 ? ? OE2 A GLU 23 ? ? 1.58 82 10 OE1 A GLU 126 ? ? HH11 A ARG 129 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 72 ? ? -97.81 -64.65 2 1 LEU A 92 ? ? -81.48 32.97 3 1 THR A 95 ? ? -129.04 -159.14 4 1 ASP A 147 ? ? -131.01 -38.32 5 2 MET A 72 ? ? -97.64 -64.89 6 2 LEU A 92 ? ? -80.26 34.15 7 2 THR A 95 ? ? -101.29 -169.31 8 3 MET A 72 ? ? -97.99 -63.37 9 3 LEU A 92 ? ? -78.44 38.75 10 4 MET A 72 ? ? -97.68 -63.01 11 4 LEU A 92 ? ? -80.60 32.96 12 5 MET A 72 ? ? -97.54 -63.00 13 5 LEU A 92 ? ? -80.56 36.68 14 5 MET A 165 ? ? -95.69 31.68 15 6 MET A 72 ? ? -96.99 -62.29 16 6 LEU A 92 ? ? -79.45 33.10 17 6 MET A 165 ? ? -102.70 49.58 18 7 ARG A 17 ? ? -178.21 -175.50 19 7 MET A 72 ? ? -97.27 -64.27 20 7 LEU A 92 ? ? -79.39 41.69 21 7 THR A 95 ? ? -129.62 -155.30 22 8 MET A 72 ? ? -98.01 -63.84 23 8 LEU A 92 ? ? -80.62 35.60 24 8 MET A 165 ? ? -103.61 62.40 25 9 MET A 72 ? ? -97.69 -64.16 26 9 LEU A 92 ? ? -78.64 46.88 27 9 MET A 165 ? ? -104.69 45.96 28 10 MET A 72 ? ? -97.02 -62.29 29 10 LEU A 92 ? ? -79.68 30.95 30 10 THR A 95 ? ? -115.18 -168.33 # _pdbx_nmr_ensemble.entry_id 9ZZ4 _pdbx_nmr_ensemble.conformers_calculated_total_number 400 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9ZZ4 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '0.5 mM [U-100% 15N] CaBP1 C-Lobe, 0.75 mM CaV1.2 IQ motif, 1 mM Ca2+, 10 mM [U-100% 2H] Tris, 90% H2O/10% D2O' '90% H2O/10% D2O' sample_1 solution ? 2 '0.6 mM [U-100% 13C; U-100% 15N] CaBP1 C-Lobe, 0.9 mM CaV1.2 IQ motif, 1 mM Ca2+, 10 mM [U-100% 2H] Tris, 90% H2O/10% D2O' '90% H2O/10% D2O' sample_2 solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'CaBP1 C-Lobe' 0.5 ? mM '[U-100% 15N]' 1 'CaV1.2 IQ motif' 0.75 ? mM 'natural abundance' 1 Ca2+ 1 ? mM 'natural abundance' 1 Tris 10 ? mM '[U-100% 2H]' 2 'CaBP1 C-Lobe' 0.6 ? mM '[U-100% 13C; U-100% 15N]' 2 'CaV1.2 IQ motif' 0.9 ? mM 'natural abundance' 2 Ca2+ 1 ? mM 'natural abundance' 2 Tris 10 ? mM '[U-100% 2H]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 10 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label sample_conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 2 isotropic 2 1 2 '3D CBCA(CO)NH' 2 isotropic 3 1 2 '3D HNCACB' 2 isotropic 4 1 2 '3D HCCH-TOCSY' 1 isotropic 5 1 2 '3D HBHA(CO)NH' 2 isotropic 6 1 2 '3D HNCO' 2 isotropic 7 1 2 '3D HNCA' 1 isotropic 8 1 2 '2D 1H-13C HSQC aliphatic' 2 isotropic # _pdbx_nmr_refine.entry_id 9ZZ4 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 4 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing NMRFx ? Norris 2 'chemical shift assignment' NMRFAM-SPARKY ? Lee 3 'structure calculation' HADDOCK ? Bonvin 4 refinement HADDOCK ? Bonvin 5 'peak picking' NMRFAM-SPARKY ? Lee # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 ILE N N N N 159 ILE CA C N S 160 ILE C C N N 161 ILE O O N N 162 ILE CB C N S 163 ILE CG1 C N N 164 ILE CG2 C N N 165 ILE CD1 C N N 166 ILE OXT O N N 167 ILE H H N N 168 ILE H2 H N N 169 ILE HA H N N 170 ILE HB H N N 171 ILE HG12 H N N 172 ILE HG13 H N N 173 ILE HG21 H N N 174 ILE HG22 H N N 175 ILE HG23 H N N 176 ILE HD11 H N N 177 ILE HD12 H N N 178 ILE HD13 H N N 179 ILE HXT H N N 180 LEU N N N N 181 LEU CA C N S 182 LEU C C N N 183 LEU O O N N 184 LEU CB C N N 185 LEU CG C N N 186 LEU CD1 C N N 187 LEU CD2 C N N 188 LEU OXT O N N 189 LEU H H N N 190 LEU H2 H N N 191 LEU HA H N N 192 LEU HB2 H N N 193 LEU HB3 H N N 194 LEU HG H N N 195 LEU HD11 H N N 196 LEU HD12 H N N 197 LEU HD13 H N N 198 LEU HD21 H N N 199 LEU HD22 H N N 200 LEU HD23 H N N 201 LEU HXT H N N 202 LYS N N N N 203 LYS CA C N S 204 LYS C C N N 205 LYS O O N N 206 LYS CB C N N 207 LYS CG C N N 208 LYS CD C N N 209 LYS CE C N N 210 LYS NZ N N N 211 LYS OXT O N N 212 LYS H H N N 213 LYS H2 H N N 214 LYS HA H N N 215 LYS HB2 H N N 216 LYS HB3 H N N 217 LYS HG2 H N N 218 LYS HG3 H N N 219 LYS HD2 H N N 220 LYS HD3 H N N 221 LYS HE2 H N N 222 LYS HE3 H N N 223 LYS HZ1 H N N 224 LYS HZ2 H N N 225 LYS HZ3 H N N 226 LYS HXT H N N 227 MET N N N N 228 MET CA C N S 229 MET C C N N 230 MET O O N N 231 MET CB C N N 232 MET CG C N N 233 MET SD S N N 234 MET CE C N N 235 MET OXT O N N 236 MET H H N N 237 MET H2 H N N 238 MET HA H N N 239 MET HB2 H N N 240 MET HB3 H N N 241 MET HG2 H N N 242 MET HG3 H N N 243 MET HE1 H N N 244 MET HE2 H N N 245 MET HE3 H N N 246 MET HXT H N N 247 PHE N N N N 248 PHE CA C N S 249 PHE C C N N 250 PHE O O N N 251 PHE CB C N N 252 PHE CG C Y N 253 PHE CD1 C Y N 254 PHE CD2 C Y N 255 PHE CE1 C Y N 256 PHE CE2 C Y N 257 PHE CZ C Y N 258 PHE OXT O N N 259 PHE H H N N 260 PHE H2 H N N 261 PHE HA H N N 262 PHE HB2 H N N 263 PHE HB3 H N N 264 PHE HD1 H N N 265 PHE HD2 H N N 266 PHE HE1 H N N 267 PHE HE2 H N N 268 PHE HZ H N N 269 PHE HXT H N N 270 PRO N N N N 271 PRO CA C N S 272 PRO C C N N 273 PRO O O N N 274 PRO CB C N N 275 PRO CG C N N 276 PRO CD C N N 277 PRO OXT O N N 278 PRO H H N N 279 PRO HA H N N 280 PRO HB2 H N N 281 PRO HB3 H N N 282 PRO HG2 H N N 283 PRO HG3 H N N 284 PRO HD2 H N N 285 PRO HD3 H N N 286 PRO HXT H N N 287 SER N N N N 288 SER CA C N S 289 SER C C N N 290 SER O O N N 291 SER CB C N N 292 SER OG O N N 293 SER OXT O N N 294 SER H H N N 295 SER H2 H N N 296 SER HA H N N 297 SER HB2 H N N 298 SER HB3 H N N 299 SER HG H N N 300 SER HXT H N N 301 THR N N N N 302 THR CA C N S 303 THR C C N N 304 THR O O N N 305 THR CB C N R 306 THR OG1 O N N 307 THR CG2 C N N 308 THR OXT O N N 309 THR H H N N 310 THR H2 H N N 311 THR HA H N N 312 THR HB H N N 313 THR HG1 H N N 314 THR HG21 H N N 315 THR HG22 H N N 316 THR HG23 H N N 317 THR HXT H N N 318 TYR N N N N 319 TYR CA C N S 320 TYR C C N N 321 TYR O O N N 322 TYR CB C N N 323 TYR CG C Y N 324 TYR CD1 C Y N 325 TYR CD2 C Y N 326 TYR CE1 C Y N 327 TYR CE2 C Y N 328 TYR CZ C Y N 329 TYR OH O N N 330 TYR OXT O N N 331 TYR H H N N 332 TYR H2 H N N 333 TYR HA H N N 334 TYR HB2 H N N 335 TYR HB3 H N N 336 TYR HD1 H N N 337 TYR HD2 H N N 338 TYR HE1 H N N 339 TYR HE2 H N N 340 TYR HH H N N 341 TYR HXT H N N 342 VAL N N N N 343 VAL CA C N S 344 VAL C C N N 345 VAL O O N N 346 VAL CB C N N 347 VAL CG1 C N N 348 VAL CG2 C N N 349 VAL OXT O N N 350 VAL H H N N 351 VAL H2 H N N 352 VAL HA H N N 353 VAL HB H N N 354 VAL HG11 H N N 355 VAL HG12 H N N 356 VAL HG13 H N N 357 VAL HG21 H N N 358 VAL HG22 H N N 359 VAL HG23 H N N 360 VAL HXT H N N 361 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 'NIH R01 GM130925' _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE III' ? Bruker 600 ? 2 'AVANCE III' ? Bruker 800 ? # _atom_sites.entry_id 9ZZ4 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CA H N O S # loop_ #