data_9A1C _entry.id 9A1C _struct.entry_id 9A1C _struct.title 'CS-Rosetta structure of engineered IgG-binding domain of protein G (GB) - model B1' _struct.pdbx_structure_determination_methodology integrative # # loop_ _audit_conform.dict_location _audit_conform.dict_name _audit_conform.dict_version https://mmcif.wwpdb.org/dictionaries/ascii/mmcif_ihm_ext.dic mmcif_ihm_ext.dic 1.26 http://mmcif.wwpdb.org/dictionaries/ascii/mmcif_pdbx_v50.dic mmcif_pdbx.dic 5.395 # # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB-Dev PDBDEV_00000084 PDBDEV_00000084 ? PDB 9A1C pdb_00009a1c 10.2210/pdb9a1c/pdb # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 9A1C _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2021-04-21 # # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-06-24 # # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # # loop_ _software.pdbx_ordinal _software.name _software.classification _software.description _software.version _software.type _software.location 1 "CS-Rosetta" "model building" "Chemical shift based modeling" ? program https://spin.niddk.nih.gov/bax/software/CSROSETTA/ # # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI 1 "Design and characterization of a protein fold switching network" "Nat Commun" 14 431 ? 2023 36702827 10.1038/s41467-023-36065-3 # # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal 1 "Ruan B" 1 1 "He Y" 2 1 "Chen Y" 3 1 "Choi EJ" 4 1 "Chen Y" 5 1 "Motabar D" 6 1 "Solomon T" 7 1 "Simmerman R" 8 1 "Kauffman T" 9 1 "Gallagher DT" 10 1 "Orban J" 11 1 "Bryan PN" 12 # # loop_ _audit_author.name _audit_author.pdbx_ordinal "He Y" 1 "Chen Y" 2 "Ruan B" 3 "Choi EJ" 4 "Chen Y" 5 "Motabar D" 6 "Solomon T" 7 "Simmerman R" 8 "Kauffman T" 9 "Gallagher DT" 10 "Bryan PN" 11 "Orban J" 12 # # loop_ _chem_comp.id _chem_comp.type _chem_comp.name _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' ALANINE 'C3 H7 N O2' 89.094 ASN 'L-peptide linking' ASPARAGINE 'C4 H8 N2 O3' 132.119 ASP 'L-peptide linking' 'ASPARTIC ACID' 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' GLUTAMINE 'C5 H10 N2 O3' 146.146 GLU 'L-peptide linking' 'GLUTAMIC ACID' 'C5 H9 N O4' 147.130 GLY 'peptide linking' GLYCINE 'C2 H5 N O2' 75.067 LEU 'L-peptide linking' LEUCINE 'C6 H13 N O2' 131.175 LYS 'L-peptide linking' LYSINE 'C6 H15 N2 O2 1' 147.198 PHE 'L-peptide linking' PHENYLALANINE 'C9 H11 N O2' 165.192 THR 'L-peptide linking' THREONINE 'C4 H9 N O3' 119.120 TRP 'L-peptide linking' TRYPTOPHAN 'C11 H12 N2 O2' 204.229 TYR 'L-peptide linking' TYROSINE 'C9 H11 N O3' 181.191 VAL 'L-peptide linking' VALINE 'C5 H11 N O2' 117.148 # # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.details 1 polymer man "Immunoglobulin G-binding protein G" 6869.354 1 ? # # loop_ _struct_ref.id _struct_ref.entity_id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_align_begin _struct_ref.pdbx_seq_one_letter_code _struct_ref.details 1 1 UNP SPG1_STRSG P06654 227 . . # # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.seq_align_beg _struct_ref_seq.seq_align_end _struct_ref_seq.db_align_beg _struct_ref_seq.db_align_end 1 1 1 56 227 282 # # loop_ _struct_ref_seq_dif.pdbx_ordinal _struct_ref_seq_dif.align_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.details 1 1 1 ASP ALA "engineered mutation" 2 1 3 TYR PHE "engineered mutation" 3 1 6 ILE VAL "engineered mutation" 4 1 27 GLU LEU "engineered mutation" 5 1 29 VAL ASN "engineered mutation" 6 1 31 LYS GLY "engineered mutation" 7 1 32 GLN ALA "engineered mutation" 8 1 35 ASN GLN "engineered mutation" 9 1 37 ASN VAL "engineered mutation" 10 1 42 GLU ALA "engineered mutation" 11 1 55 THR GLY "engineered mutation" # # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_strand_id _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can 1 polypeptide(L) no no A ATFKLVLNGKTLKGETTTEAVDAATALKNFGAYAQDVGVDGAWTYDDATKTFTVGE ATFKLVLNGKTLKGETTTEAVDAATALKNFGAYAQDVGVDGAWTYDDATKTFTVGE # # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA . 1 2 THR . 1 3 PHE . 1 4 LYS . 1 5 LEU . 1 6 VAL . 1 7 LEU . 1 8 ASN . 1 9 GLY . 1 10 LYS . 1 11 THR . 1 12 LEU . 1 13 LYS . 1 14 GLY . 1 15 GLU . 1 16 THR . 1 17 THR . 1 18 THR . 1 19 GLU . 1 20 ALA . 1 21 VAL . 1 22 ASP . 1 23 ALA . 1 24 ALA . 1 25 THR . 1 26 ALA . 1 27 LEU . 1 28 LYS . 1 29 ASN . 1 30 PHE . 1 31 GLY . 1 32 ALA . 1 33 TYR . 1 34 ALA . 1 35 GLN . 1 36 ASP . 1 37 VAL . 1 38 GLY . 1 39 VAL . 1 40 ASP . 1 41 GLY . 1 42 ALA . 1 43 TRP . 1 44 THR . 1 45 TYR . 1 46 ASP . 1 47 ASP . 1 48 ALA . 1 49 THR . 1 50 LYS . 1 51 THR . 1 52 PHE . 1 53 THR . 1 54 VAL . 1 55 GLY . 1 56 GLU . # # loop_ _ihm_entity_poly_segment.id _ihm_entity_poly_segment.entity_id _ihm_entity_poly_segment.seq_id_begin _ihm_entity_poly_segment.seq_id_end _ihm_entity_poly_segment.comp_id_begin _ihm_entity_poly_segment.comp_id_end 1 1 1 56 ALA GLU # # loop_ _struct_asym.id _struct_asym.entity_id _struct_asym.details A 1 ? # # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id A 1 1 ALA 1 1 ALA ALA A A 1 2 THR 2 2 THR THR A A 1 3 PHE 3 3 PHE PHE A A 1 4 LYS 4 4 LYS LYS A A 1 5 LEU 5 5 LEU LEU A A 1 6 VAL 6 6 VAL VAL A A 1 7 LEU 7 7 LEU LEU A A 1 8 ASN 8 8 ASN ASN A A 1 9 GLY 9 9 GLY GLY A A 1 10 LYS 10 10 LYS LYS A A 1 11 THR 11 11 THR THR A A 1 12 LEU 12 12 LEU LEU A A 1 13 LYS 13 13 LYS LYS A A 1 14 GLY 14 14 GLY GLY A A 1 15 GLU 15 15 GLU GLU A A 1 16 THR 16 16 THR THR A A 1 17 THR 17 17 THR THR A A 1 18 THR 18 18 THR THR A A 1 19 GLU 19 19 GLU GLU A A 1 20 ALA 20 20 ALA ALA A A 1 21 VAL 21 21 VAL VAL A A 1 22 ASP 22 22 ASP ASP A A 1 23 ALA 23 23 ALA ALA A A 1 24 ALA 24 24 ALA ALA A A 1 25 THR 25 25 THR THR A A 1 26 ALA 26 26 ALA ALA A A 1 27 LEU 27 27 LEU LEU A A 1 28 LYS 28 28 LYS LYS A A 1 29 ASN 29 29 ASN ASN A A 1 30 PHE 30 30 PHE PHE A A 1 31 GLY 31 31 GLY GLY A A 1 32 ALA 32 32 ALA ALA A A 1 33 TYR 33 33 TYR TYR A A 1 34 ALA 34 34 ALA ALA A A 1 35 GLN 35 35 GLN GLN A A 1 36 ASP 36 36 ASP ASP A A 1 37 VAL 37 37 VAL VAL A A 1 38 GLY 38 38 GLY GLY A A 1 39 VAL 39 39 VAL VAL A A 1 40 ASP 40 40 ASP ASP A A 1 41 GLY 41 41 GLY GLY A A 1 42 ALA 42 42 ALA ALA A A 1 43 TRP 43 43 TRP TRP A A 1 44 THR 44 44 THR THR A A 1 45 TYR 45 45 TYR TYR A A 1 46 ASP 46 46 ASP ASP A A 1 47 ASP 47 47 ASP ASP A A 1 48 ALA 48 48 ALA ALA A A 1 49 THR 49 49 THR THR A A 1 50 LYS 50 50 LYS LYS A A 1 51 THR 51 51 THR THR A A 1 52 PHE 52 52 PHE PHE A A 1 53 THR 53 53 THR THR A A 1 54 VAL 54 54 VAL VAL A A 1 55 GLY 55 55 GLY GLY A A 1 56 GLU 56 56 GLU GLU A # # loop_ _ihm_struct_assembly.id _ihm_struct_assembly.name _ihm_struct_assembly.description 1 'Immunoglobulin G-binding protein G' ; Integrative structure of IgG-binding domain of protein G (model B1) modeled using CS-Rosetta based on NMR chemical shifts. ; # # loop_ _ihm_struct_assembly_details.id _ihm_struct_assembly_details.assembly_id _ihm_struct_assembly_details.parent_assembly_id _ihm_struct_assembly_details.entity_description _ihm_struct_assembly_details.entity_id _ihm_struct_assembly_details.asym_id _ihm_struct_assembly_details.entity_poly_segment_id 1 1 1 ? 1 A 1 # # loop_ _ihm_dataset_list.id _ihm_dataset_list.data_type _ihm_dataset_list.database_hosted _ihm_dataset_list.details 1 "NMR data" YES "NMR chemical shifts" # # loop_ _ihm_dataset_group.id _ihm_dataset_group.name _ihm_dataset_group.application _ihm_dataset_group.details 1 . . . # # loop_ _ihm_dataset_group_link.group_id _ihm_dataset_group_link.dataset_list_id 1 1 # # loop_ _ihm_dataset_related_db_reference.id _ihm_dataset_related_db_reference.dataset_list_id _ihm_dataset_related_db_reference.db_name _ihm_dataset_related_db_reference.accession_code _ihm_dataset_related_db_reference.version _ihm_dataset_related_db_reference.details 1 1 BMRB 50910 . . # # loop_ _ihm_model_representation.id _ihm_model_representation.name _ihm_model_representation.details 1 . . # # loop_ _ihm_model_representation_details.id _ihm_model_representation_details.representation_id _ihm_model_representation_details.entity_id _ihm_model_representation_details.entity_description _ihm_model_representation_details.entity_asym_id _ihm_model_representation_details.entity_poly_segment_id _ihm_model_representation_details.model_object_primitive _ihm_model_representation_details.starting_model_id _ihm_model_representation_details.model_mode _ihm_model_representation_details.model_granularity _ihm_model_representation_details.model_object_count _ihm_model_representation_details.description 1 1 1 ? A 1 atomistic . flexible by-atom . . # # loop_ _ihm_modeling_protocol.id _ihm_modeling_protocol.protocol_name _ihm_modeling_protocol.num_steps 1 modeling 1 # # loop_ _ihm_modeling_protocol_details.id _ihm_modeling_protocol_details.protocol_id _ihm_modeling_protocol_details.step_id _ihm_modeling_protocol_details.struct_assembly_id _ihm_modeling_protocol_details.dataset_group_id _ihm_modeling_protocol_details.struct_assembly_description _ihm_modeling_protocol_details.step_name _ihm_modeling_protocol_details.step_method _ihm_modeling_protocol_details.num_models_begin _ihm_modeling_protocol_details.num_models_end _ihm_modeling_protocol_details.multi_scale_flag _ihm_modeling_protocol_details.multi_state_flag _ihm_modeling_protocol_details.ordered_flag _ihm_modeling_protocol_details.ensemble_flag _ihm_modeling_protocol_details.software_id _ihm_modeling_protocol_details.script_file_id _ihm_modeling_protocol_details.description 1 1 1 1 1 ? 'CS-Rosetta modeling' ? ? ? NO NO NO YES 1 ? ? # # loop_ _ihm_model_list.model_id _ihm_model_list.model_name _ihm_model_list.assembly_id _ihm_model_list.protocol_id _ihm_model_list.representation_id 1 . 1 1 1 2 . 1 1 1 3 . 1 1 1 4 . 1 1 1 5 . 1 1 1 6 . 1 1 1 7 . 1 1 1 8 . 1 1 1 9 . 1 1 1 10 . 1 1 1 # # loop_ _ihm_model_group.id _ihm_model_group.name _ihm_model_group.details 1 . . # # loop_ _ihm_model_group_link.group_id _ihm_model_group_link.model_id 1 1 1 2 1 3 1 4 1 5 1 6 1 7 1 8 1 9 1 10 # # loop_ # # loop_ _atom_type.symbol C H N O #