data_9A2J # _entry.id 9A2J # loop_ _atom_type.symbol C H N O S # loop_ _audit_author.name _audit_author.pdbx_ordinal "Stahl, K." 1 "Graziadei, A." 2 "Dau, T." 3 "Brock, O." 4 "Rappsilber, J." 5 # loop_ _audit_conform.dict_location _audit_conform.dict_name _audit_conform.dict_version https://mmcif.wwpdb.org/dictionaries/ascii/mmcif_ihm_ext.dic mmcif_ihm_ext.dic 1.26 http://mmcif.wwpdb.org/dictionaries/ascii/mmcif_pdbx_v50.dic mmcif_pdbx.dic 5.395 # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB-Dev PDBDEV_00000168 PDBDEV_00000168 ? PDB 9A2J pdb_00009a2j 10.2210/pdb9a2j/pdb # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 9A2J _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2023-02-03 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-02-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _ihm_entry_collection.id PDBDEV_G_1000001 _ihm_entry_collection.name . _ihm_entry_collection.details 'Collection of entries belonging to the publication: "Protein structure prediction with in-cell photo-crosslinking mass spectrometry and deep learning"' # _ihm_entry_collection_mapping.collection_id PDBDEV_G_1000001 _ihm_entry_collection_mapping.entry_id 9A2J # loop_ _chem_comp.formula _chem_comp.formula_weight _chem_comp.id _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.type "C3 H7 N O2" 89.094 ALA . ALANINE . "L-peptide linking" "C6 H15 N4 O2 1" 175.212 ARG . ARGININE . "L-peptide linking" "C4 H8 N2 O3" 132.119 ASN . ASPARAGINE . "L-peptide linking" "C4 H7 N O4" 133.103 ASP . "ASPARTIC ACID" . "L-peptide linking" "C3 H7 N O2 S" 121.154 CYS . CYSTEINE . "L-peptide linking" "C5 H10 N2 O3" 146.146 GLN . GLUTAMINE . "L-peptide linking" "C5 H9 N O4" 147.13 GLU . "GLUTAMIC ACID" . "L-peptide linking" "C2 H5 N O2" 75.067 GLY . GLYCINE . "peptide linking" "C6 H10 N3 O2 1" 156.165 HIS . HISTIDINE . "L-peptide linking" "C6 H13 N O2" 131.175 ILE . ISOLEUCINE . "L-peptide linking" "C6 H13 N O2" 131.175 LEU . LEUCINE . "L-peptide linking" "C6 H15 N2 O2 1" 147.198 LYS . LYSINE . "L-peptide linking" "C5 H11 N O2 S" 149.208 MET . METHIONINE . "L-peptide linking" "C9 H11 N O2" 165.192 PHE . PHENYLALANINE . "L-peptide linking" "C5 H9 N O2" 115.132 PRO . PROLINE . "L-peptide linking" "C3 H7 N O3" 105.093 SER . SERINE . "L-peptide linking" "C4 H9 N O3" 119.12 THR . THREONINE . "L-peptide linking" "C9 H11 N O3" 181.191 TYR . TYROSINE . "L-peptide linking" "C5 H11 N O2" 117.148 VAL . VALINE . "L-peptide linking" # _citation.country . _citation.id 1 _citation.journal_abbrev "Nature Biotechnology" _citation.journal_id_ASTM . _citation.journal_id_CSD . _citation.journal_id_ISSN . _citation.journal_issue . _citation.journal_volume . _citation.page_first . _citation.page_last . _citation.pdbx_database_id_DOI 10.1038/s41587-023-01704-z _citation.pdbx_database_id_PubMed 36941363 _citation.title "Protein structure prediction with in-cell photo-crosslinking mass spectrometry and deep learning" _citation.year 2023 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal 1 "Stahl, K." 1 1 "Graziadei, A." 2 1 "Dau, T." 3 1 "Brock, O." 4 1 "Rappsilber, J." 5 # _entity.details . _entity.formula_weight 20691.299 _entity.id 1 _entity.pdbx_description P0A7J3 _entity.pdbx_number_of_molecules 1 _entity.src_method NAT _entity.type polymer # _entity_poly.entity_id 1 _entity_poly.nstd_chirality . _entity_poly.nstd_linkage NO _entity_poly.nstd_monomer NO _entity_poly.pdbx_seq_one_letter_code MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPASQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA _entity_poly.pdbx_seq_one_letter_code_can MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPASQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA _entity_poly.pdbx_sequence_evidence_code . _entity_poly.pdbx_strand_id A _entity_poly.type polypeptide(L) # loop_ _entity_poly_seq.entity_id _entity_poly_seq.hetero _entity_poly_seq.mon_id _entity_poly_seq.num 1 . MET 1 1 . ALA 2 1 . LEU 3 1 . ASN 4 1 . LEU 5 1 . GLN 6 1 . ASP 7 1 . LYS 8 1 . GLN 9 1 . ALA 10 1 . ILE 11 1 . VAL 12 1 . ALA 13 1 . GLU 14 1 . VAL 15 1 . SER 16 1 . GLU 17 1 . VAL 18 1 . ALA 19 1 . LYS 20 1 . GLY 21 1 . ALA 22 1 . LEU 23 1 . SER 24 1 . ALA 25 1 . VAL 26 1 . VAL 27 1 . ALA 28 1 . ASP 29 1 . SER 30 1 . ARG 31 1 . GLY 32 1 . VAL 33 1 . THR 34 1 . VAL 35 1 . ASP 36 1 . LYS 37 1 . MET 38 1 . THR 39 1 . GLU 40 1 . LEU 41 1 . ARG 42 1 . LYS 43 1 . ALA 44 1 . GLY 45 1 . ARG 46 1 . GLU 47 1 . ALA 48 1 . GLY 49 1 . VAL 50 1 . TYR 51 1 . MET 52 1 . ARG 53 1 . VAL 54 1 . VAL 55 1 . ARG 56 1 . ASN 57 1 . THR 58 1 . LEU 59 1 . LEU 60 1 . ARG 61 1 . ARG 62 1 . ALA 63 1 . VAL 64 1 . GLU 65 1 . GLY 66 1 . THR 67 1 . PRO 68 1 . PHE 69 1 . GLU 70 1 . CYS 71 1 . LEU 72 1 . LYS 73 1 . ASP 74 1 . ALA 75 1 . PHE 76 1 . VAL 77 1 . GLY 78 1 . PRO 79 1 . THR 80 1 . LEU 81 1 . ILE 82 1 . ALA 83 1 . TYR 84 1 . SER 85 1 . MET 86 1 . GLU 87 1 . HIS 88 1 . PRO 89 1 . GLY 90 1 . ALA 91 1 . ALA 92 1 . ALA 93 1 . ARG 94 1 . LEU 95 1 . PHE 96 1 . LYS 97 1 . GLU 98 1 . PHE 99 1 . ALA 100 1 . LYS 101 1 . ALA 102 1 . ASN 103 1 . ALA 104 1 . LYS 105 1 . PHE 106 1 . GLU 107 1 . VAL 108 1 . LYS 109 1 . ALA 110 1 . ALA 111 1 . ALA 112 1 . PHE 113 1 . GLU 114 1 . GLY 115 1 . GLU 116 1 . LEU 117 1 . ILE 118 1 . PRO 119 1 . ALA 120 1 . SER 121 1 . GLN 122 1 . ILE 123 1 . ASP 124 1 . ARG 125 1 . LEU 126 1 . ALA 127 1 . THR 128 1 . LEU 129 1 . PRO 130 1 . THR 131 1 . TYR 132 1 . GLU 133 1 . GLU 134 1 . ALA 135 1 . ILE 136 1 . ALA 137 1 . ARG 138 1 . LEU 139 1 . MET 140 1 . ALA 141 1 . THR 142 1 . MET 143 1 . LYS 144 1 . GLU 145 1 . ALA 146 1 . SER 147 1 . ALA 148 1 . GLY 149 1 . LYS 150 1 . LEU 151 1 . VAL 152 1 . ARG 153 1 . THR 154 1 . LEU 155 1 . ALA 156 1 . ALA 157 1 . VAL 158 1 . ARG 159 1 . ASP 160 1 . ALA 161 1 . LYS 162 1 . GLU 163 1 . ALA 164 1 . ALA 165 # _ihm_chemical_component_descriptor.auth_name L-Photo-Leucine _ihm_chemical_component_descriptor.chemical_name . _ihm_chemical_component_descriptor.common_name L-Photo-Leucine _ihm_chemical_component_descriptor.details . _ihm_chemical_component_descriptor.id 1 _ihm_chemical_component_descriptor.inchi 1S/C5H9N3O2/c1-5(7-8-5)2-3(6)4(9)10/h3H,2,6H2,1H3,(H,9,10)/t3-/m0/s1 _ihm_chemical_component_descriptor.inchi_key MJRDGTVDJKACQZ-VKHMYHEASA-N _ihm_chemical_component_descriptor.smiles CC1(C[C@H](N)C(O)=O)N=N1 _ihm_chemical_component_descriptor.smiles_canonical . # loop_ _ihm_cross_link_list.comp_id_1 _ihm_cross_link_list.comp_id_2 _ihm_cross_link_list.dataset_list_id _ihm_cross_link_list.details _ihm_cross_link_list.entity_description_1 _ihm_cross_link_list.entity_description_2 _ihm_cross_link_list.entity_id_1 _ihm_cross_link_list.entity_id_2 _ihm_cross_link_list.group_id _ihm_cross_link_list.id _ihm_cross_link_list.linker_chem_comp_descriptor_id _ihm_cross_link_list.linker_type _ihm_cross_link_list.seq_id_1 _ihm_cross_link_list.seq_id_2 ALA LEU 1 . P0A7J3 P0A7J3 1 1 1 1 1 L-Photo-Leucine 22 117 LEU GLU 1 . P0A7J3 P0A7J3 1 1 2 2 1 L-Photo-Leucine 23 114 # loop_ _ihm_cross_link_restraint.asym_id_1 _ihm_cross_link_restraint.asym_id_2 _ihm_cross_link_restraint.atom_id_1 _ihm_cross_link_restraint.atom_id_2 _ihm_cross_link_restraint.comp_id_1 _ihm_cross_link_restraint.comp_id_2 _ihm_cross_link_restraint.conditional_crosslink_flag _ihm_cross_link_restraint.distance_threshold _ihm_cross_link_restraint.entity_id_1 _ihm_cross_link_restraint.entity_id_2 _ihm_cross_link_restraint.group_id _ihm_cross_link_restraint.id _ihm_cross_link_restraint.model_granularity _ihm_cross_link_restraint.pseudo_site_flag _ihm_cross_link_restraint.psi _ihm_cross_link_restraint.restraint_type _ihm_cross_link_restraint.seq_id_1 _ihm_cross_link_restraint.seq_id_2 _ihm_cross_link_restraint.sigma_1 _ihm_cross_link_restraint.sigma_2 A A . . ALA LEU . 10 1 1 1 1 by-residue NO 0.05 "upper bound" 22 117 . . A A . . LEU GLU . 10 1 1 2 2 by-residue NO 0.05 "upper bound" 23 114 . . # _ihm_dataset_group.application . _ihm_dataset_group.details . _ihm_dataset_group.id 1 _ihm_dataset_group.name . # _ihm_dataset_group_link.dataset_list_id 1 _ihm_dataset_group_link.group_id 1 # _ihm_dataset_list.data_type "Crosslinking-MS data" _ihm_dataset_list.database_hosted YES _ihm_dataset_list.details . _ihm_dataset_list.id 1 # _ihm_dataset_related_db_reference.accession_code JPST001851 _ihm_dataset_related_db_reference.dataset_list_id 1 _ihm_dataset_related_db_reference.db_name jPOSTrepo _ihm_dataset_related_db_reference.details . _ihm_dataset_related_db_reference.id 1 _ihm_dataset_related_db_reference.version . # _ihm_entity_poly_segment.comp_id_begin MET _ihm_entity_poly_segment.comp_id_end ALA _ihm_entity_poly_segment.entity_id 1 _ihm_entity_poly_segment.id 1 _ihm_entity_poly_segment.seq_id_begin 1 _ihm_entity_poly_segment.seq_id_end 165 # _ihm_model_group.details . _ihm_model_group.id 1 _ihm_model_group.name . # loop_ _ihm_model_group_link.group_id _ihm_model_group_link.model_id 1 1 1 2 1 3 1 4 1 5 1 6 1 7 1 8 1 9 1 10 # loop_ _ihm_model_list.assembly_id _ihm_model_list.model_id _ihm_model_list.model_name _ihm_model_list.protocol_id _ihm_model_list.representation_id 1 1 . 1 1 1 2 . 1 1 1 3 . 1 1 1 4 . 1 1 1 5 . 1 1 1 6 . 1 1 1 7 . 1 1 1 8 . 1 1 1 9 . 1 1 1 10 . 1 1 # _ihm_model_representation.details . _ihm_model_representation.id 1 _ihm_model_representation.name . # _ihm_model_representation_details.description . _ihm_model_representation_details.entity_asym_id A _ihm_model_representation_details.entity_description P0A7J3 _ihm_model_representation_details.entity_id 1 _ihm_model_representation_details.entity_poly_segment_id 1 _ihm_model_representation_details.id 1 _ihm_model_representation_details.model_granularity by-atom _ihm_model_representation_details.model_mode flexible _ihm_model_representation_details.model_object_count . _ihm_model_representation_details.model_object_primitive atomistic _ihm_model_representation_details.representation_id 1 _ihm_model_representation_details.starting_model_id . # _ihm_modeling_protocol.details . _ihm_modeling_protocol.id 1 _ihm_modeling_protocol.num_steps 1 _ihm_modeling_protocol.protocol_name AlphaLink # _ihm_modeling_protocol_details.dataset_group_id 1 _ihm_modeling_protocol_details.description . _ihm_modeling_protocol_details.ensemble_flag YES _ihm_modeling_protocol_details.id 1 _ihm_modeling_protocol_details.multi_scale_flag NO _ihm_modeling_protocol_details.multi_state_flag NO _ihm_modeling_protocol_details.num_models_begin 0 _ihm_modeling_protocol_details.num_models_end 10 _ihm_modeling_protocol_details.ordered_flag NO _ihm_modeling_protocol_details.protocol_id 1 _ihm_modeling_protocol_details.script_file_id . _ihm_modeling_protocol_details.software_id . _ihm_modeling_protocol_details.step_id 1 _ihm_modeling_protocol_details.step_method "AlphaLink with 10 msa subsamples" _ihm_modeling_protocol_details.step_name AlphaLink _ihm_modeling_protocol_details.struct_assembly_description . _ihm_modeling_protocol_details.struct_assembly_id 1 # _ihm_struct_assembly.description "Integrative modeling using in-cell photo-crosslinking mass spectrometry and deep learning" _ihm_struct_assembly.id 1 _ihm_struct_assembly.name "Integrative model" # _ihm_struct_assembly_details.assembly_id 1 _ihm_struct_assembly_details.asym_id A _ihm_struct_assembly_details.entity_description P0A7J3 _ihm_struct_assembly_details.entity_id 1 _ihm_struct_assembly_details.entity_poly_segment_id 1 _ihm_struct_assembly_details.id 1 _ihm_struct_assembly_details.parent_assembly_id 1 # _software.citation_id 1 _software.classification "model building" _software.description "protein structure prediction by deep learning assisted by experimental distance restraints" _software.location https://github.com/lhatsk/AlphaLink _software.name AlphaLink _software.pdbx_ordinal 1 _software.type program _software.version 1.0 # _struct.entry_id 9A2J _struct.pdbx_CASP_flag . _struct.pdbx_descriptor . _struct.pdbx_details . _struct.pdbx_model_details . _struct.pdbx_model_type_details . _struct.title "Model of E. coli RplJ by in-cell photo-crosslinking MS and deep learning" _struct.pdbx_structure_determination_methodology integrative # _struct_asym.details P0A7J3 _struct_asym.entity_id 1 _struct_asym.id A _struct_asym.pdbx_PDB_id . _struct_asym.pdbx_alt_id . _struct_asym.pdbx_blank_PDB_chainid_flag . _struct_asym.pdbx_modified . _struct_asym.pdbx_order . _struct_asym.pdbx_type . # _struct_ref.db_code RL10_ECOLI _struct_ref.db_name UNP _struct_ref.details "50S ribosomal protein L10 OS=Escherichia coli (strain K12) OX=83333 GN=rplJ PE=1 SV=2" _struct_ref.entity_id 1 _struct_ref.id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession P0A7J3 _struct_ref.pdbx_seq_one_letter_code MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGVYMRVVRNTLLRRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFAKANAKFEVKAAAFEGELIPASQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKEAA # _struct_ref_seq.align_id 1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.db_align_end 165 _struct_ref_seq.ref_id 1 _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.seq_align_end 165 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code A 1 1 MET 1 1 MET MET A . A 1 2 ALA 2 2 ALA ALA A . A 1 3 LEU 3 3 LEU LEU A . A 1 4 ASN 4 4 ASN ASN A . A 1 5 LEU 5 5 LEU LEU A . A 1 6 GLN 6 6 GLN GLN A . A 1 7 ASP 7 7 ASP ASP A . A 1 8 LYS 8 8 LYS LYS A . A 1 9 GLN 9 9 GLN GLN A . A 1 10 ALA 10 10 ALA ALA A . A 1 11 ILE 11 11 ILE ILE A . A 1 12 VAL 12 12 VAL VAL A . A 1 13 ALA 13 13 ALA ALA A . A 1 14 GLU 14 14 GLU GLU A . A 1 15 VAL 15 15 VAL VAL A . A 1 16 SER 16 16 SER SER A . A 1 17 GLU 17 17 GLU GLU A . A 1 18 VAL 18 18 VAL VAL A . A 1 19 ALA 19 19 ALA ALA A . A 1 20 LYS 20 20 LYS LYS A . A 1 21 GLY 21 21 GLY GLY A . A 1 22 ALA 22 22 ALA ALA A . A 1 23 LEU 23 23 LEU LEU A . A 1 24 SER 24 24 SER SER A . A 1 25 ALA 25 25 ALA ALA A . A 1 26 VAL 26 26 VAL VAL A . A 1 27 VAL 27 27 VAL VAL A . A 1 28 ALA 28 28 ALA ALA A . A 1 29 ASP 29 29 ASP ASP A . A 1 30 SER 30 30 SER SER A . A 1 31 ARG 31 31 ARG ARG A . A 1 32 GLY 32 32 GLY GLY A . A 1 33 VAL 33 33 VAL VAL A . A 1 34 THR 34 34 THR THR A . A 1 35 VAL 35 35 VAL VAL A . A 1 36 ASP 36 36 ASP ASP A . A 1 37 LYS 37 37 LYS LYS A . A 1 38 MET 38 38 MET MET A . A 1 39 THR 39 39 THR THR A . A 1 40 GLU 40 40 GLU GLU A . A 1 41 LEU 41 41 LEU LEU A . A 1 42 ARG 42 42 ARG ARG A . A 1 43 LYS 43 43 LYS LYS A . A 1 44 ALA 44 44 ALA ALA A . A 1 45 GLY 45 45 GLY GLY A . A 1 46 ARG 46 46 ARG ARG A . A 1 47 GLU 47 47 GLU GLU A . A 1 48 ALA 48 48 ALA ALA A . A 1 49 GLY 49 49 GLY GLY A . A 1 50 VAL 50 50 VAL VAL A . A 1 51 TYR 51 51 TYR TYR A . A 1 52 MET 52 52 MET MET A . A 1 53 ARG 53 53 ARG ARG A . A 1 54 VAL 54 54 VAL VAL A . A 1 55 VAL 55 55 VAL VAL A . A 1 56 ARG 56 56 ARG ARG A . A 1 57 ASN 57 57 ASN ASN A . A 1 58 THR 58 58 THR THR A . A 1 59 LEU 59 59 LEU LEU A . A 1 60 LEU 60 60 LEU LEU A . A 1 61 ARG 61 61 ARG ARG A . A 1 62 ARG 62 62 ARG ARG A . A 1 63 ALA 63 63 ALA ALA A . A 1 64 VAL 64 64 VAL VAL A . A 1 65 GLU 65 65 GLU GLU A . A 1 66 GLY 66 66 GLY GLY A . A 1 67 THR 67 67 THR THR A . A 1 68 PRO 68 68 PRO PRO A . A 1 69 PHE 69 69 PHE PHE A . A 1 70 GLU 70 70 GLU GLU A . A 1 71 CYS 71 71 CYS CYS A . A 1 72 LEU 72 72 LEU LEU A . A 1 73 LYS 73 73 LYS LYS A . A 1 74 ASP 74 74 ASP ASP A . A 1 75 ALA 75 75 ALA ALA A . A 1 76 PHE 76 76 PHE PHE A . A 1 77 VAL 77 77 VAL VAL A . A 1 78 GLY 78 78 GLY GLY A . A 1 79 PRO 79 79 PRO PRO A . A 1 80 THR 80 80 THR THR A . A 1 81 LEU 81 81 LEU LEU A . A 1 82 ILE 82 82 ILE ILE A . A 1 83 ALA 83 83 ALA ALA A . A 1 84 TYR 84 84 TYR TYR A . A 1 85 SER 85 85 SER SER A . A 1 86 MET 86 86 MET MET A . A 1 87 GLU 87 87 GLU GLU A . A 1 88 HIS 88 88 HIS HIS A . A 1 89 PRO 89 89 PRO PRO A . A 1 90 GLY 90 90 GLY GLY A . A 1 91 ALA 91 91 ALA ALA A . A 1 92 ALA 92 92 ALA ALA A . A 1 93 ALA 93 93 ALA ALA A . A 1 94 ARG 94 94 ARG ARG A . A 1 95 LEU 95 95 LEU LEU A . A 1 96 PHE 96 96 PHE PHE A . A 1 97 LYS 97 97 LYS LYS A . A 1 98 GLU 98 98 GLU GLU A . A 1 99 PHE 99 99 PHE PHE A . A 1 100 ALA 100 100 ALA ALA A . A 1 101 LYS 101 101 LYS LYS A . A 1 102 ALA 102 102 ALA ALA A . A 1 103 ASN 103 103 ASN ASN A . A 1 104 ALA 104 104 ALA ALA A . A 1 105 LYS 105 105 LYS LYS A . A 1 106 PHE 106 106 PHE PHE A . A 1 107 GLU 107 107 GLU GLU A . A 1 108 VAL 108 108 VAL VAL A . A 1 109 LYS 109 109 LYS LYS A . A 1 110 ALA 110 110 ALA ALA A . A 1 111 ALA 111 111 ALA ALA A . A 1 112 ALA 112 112 ALA ALA A . A 1 113 PHE 113 113 PHE PHE A . A 1 114 GLU 114 114 GLU GLU A . A 1 115 GLY 115 115 GLY GLY A . A 1 116 GLU 116 116 GLU GLU A . A 1 117 LEU 117 117 LEU LEU A . A 1 118 ILE 118 118 ILE ILE A . A 1 119 PRO 119 119 PRO PRO A . A 1 120 ALA 120 120 ALA ALA A . A 1 121 SER 121 121 SER SER A . A 1 122 GLN 122 122 GLN GLN A . A 1 123 ILE 123 123 ILE ILE A . A 1 124 ASP 124 124 ASP ASP A . A 1 125 ARG 125 125 ARG ARG A . A 1 126 LEU 126 126 LEU LEU A . A 1 127 ALA 127 127 ALA ALA A . A 1 128 THR 128 128 THR THR A . A 1 129 LEU 129 129 LEU LEU A . A 1 130 PRO 130 130 PRO PRO A . A 1 131 THR 131 131 THR THR A . A 1 132 TYR 132 132 TYR TYR A . A 1 133 GLU 133 133 GLU GLU A . A 1 134 GLU 134 134 GLU GLU A . A 1 135 ALA 135 135 ALA ALA A . A 1 136 ILE 136 136 ILE ILE A . A 1 137 ALA 137 137 ALA ALA A . A 1 138 ARG 138 138 ARG ARG A . A 1 139 LEU 139 139 LEU LEU A . A 1 140 MET 140 140 MET MET A . A 1 141 ALA 141 141 ALA ALA A . A 1 142 THR 142 142 THR THR A . A 1 143 MET 143 143 MET MET A . A 1 144 LYS 144 144 LYS LYS A . A 1 145 GLU 145 145 GLU GLU A . A 1 146 ALA 146 146 ALA ALA A . A 1 147 SER 147 147 SER SER A . A 1 148 ALA 148 148 ALA ALA A . A 1 149 GLY 149 149 GLY GLY A . A 1 150 LYS 150 150 LYS LYS A . A 1 151 LEU 151 151 LEU LEU A . A 1 152 VAL 152 152 VAL VAL A . A 1 153 ARG 153 153 ARG ARG A . A 1 154 THR 154 154 THR THR A . A 1 155 LEU 155 155 LEU LEU A . A 1 156 ALA 156 156 ALA ALA A . A 1 157 ALA 157 157 ALA ALA A . A 1 158 VAL 158 158 VAL VAL A . A 1 159 ARG 159 159 ARG ARG A . A 1 160 ASP 160 160 ASP ASP A . A 1 161 ALA 161 161 ALA ALA A . A 1 162 LYS 162 162 LYS LYS A . A 1 163 GLU 163 163 GLU GLU A . A 1 164 ALA 164 164 ALA ALA A . A 1 165 ALA 165 165 ALA ALA A . # # loop_ # #