data_9A2N # _entry.id 9A2N # loop_ _atom_type.symbol C H N O S # loop_ _audit_author.name _audit_author.pdbx_ordinal "Stahl, K." 1 "Graziadei, A." 2 "Dau, T." 3 "Brock, O." 4 "Rappsilber, J." 5 # loop_ _audit_conform.dict_location _audit_conform.dict_name _audit_conform.dict_version https://mmcif.wwpdb.org/dictionaries/ascii/mmcif_ihm_ext.dic mmcif_ihm_ext.dic 1.26 http://mmcif.wwpdb.org/dictionaries/ascii/mmcif_pdbx_v50.dic mmcif_pdbx.dic 5.395 # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB-Dev PDBDEV_00000172 PDBDEV_00000172 ? PDB 9A2N pdb_00009a2n 10.2210/pdb9a2n/pdb # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 9A2N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2023-02-03 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-02-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _ihm_entry_collection.id PDBDEV_G_1000001 _ihm_entry_collection.name . _ihm_entry_collection.details 'Collection of entries belonging to the publication: "Protein structure prediction with in-cell photo-crosslinking mass spectrometry and deep learning"' # _ihm_entry_collection_mapping.collection_id PDBDEV_G_1000001 _ihm_entry_collection_mapping.entry_id 9A2N # loop_ _chem_comp.formula _chem_comp.formula_weight _chem_comp.id _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.type "C3 H7 N O2" 89.094 ALA . ALANINE . "L-peptide linking" "C6 H15 N4 O2 1" 175.212 ARG . ARGININE . "L-peptide linking" "C4 H8 N2 O3" 132.119 ASN . ASPARAGINE . "L-peptide linking" "C4 H7 N O4" 133.103 ASP . "ASPARTIC ACID" . "L-peptide linking" "C3 H7 N O2 S" 121.154 CYS . CYSTEINE . "L-peptide linking" "C5 H10 N2 O3" 146.146 GLN . GLUTAMINE . "L-peptide linking" "C5 H9 N O4" 147.13 GLU . "GLUTAMIC ACID" . "L-peptide linking" "C2 H5 N O2" 75.067 GLY . GLYCINE . "peptide linking" "C6 H10 N3 O2 1" 156.165 HIS . HISTIDINE . "L-peptide linking" "C6 H13 N O2" 131.175 ILE . ISOLEUCINE . "L-peptide linking" "C6 H13 N O2" 131.175 LEU . LEUCINE . "L-peptide linking" "C6 H15 N2 O2 1" 147.198 LYS . LYSINE . "L-peptide linking" "C5 H11 N O2 S" 149.208 MET . METHIONINE . "L-peptide linking" "C9 H11 N O2" 165.192 PHE . PHENYLALANINE . "L-peptide linking" "C5 H9 N O2" 115.132 PRO . PROLINE . "L-peptide linking" "C3 H7 N O3" 105.093 SER . SERINE . "L-peptide linking" "C4 H9 N O3" 119.12 THR . THREONINE . "L-peptide linking" "C9 H11 N O3" 181.191 TYR . TYROSINE . "L-peptide linking" "C5 H11 N O2" 117.148 VAL . VALINE . "L-peptide linking" # _citation.country . _citation.id 1 _citation.journal_abbrev "Nature Biotechnology" _citation.journal_id_ASTM . _citation.journal_id_CSD . _citation.journal_id_ISSN . _citation.journal_issue . _citation.journal_volume . _citation.page_first . _citation.page_last . _citation.pdbx_database_id_DOI 10.1038/s41587-023-01704-z _citation.pdbx_database_id_PubMed 36941363 _citation.title "Protein structure prediction with in-cell photo-crosslinking mass spectrometry and deep learning" _citation.year 2023 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal 1 "Stahl, K." 1 1 "Graziadei, A." 2 1 "Dau, T." 3 1 "Brock, O." 4 1 "Rappsilber, J." 5 # _entity.details . _entity.formula_weight 21943.979 _entity.id 1 _entity.pdbx_description P0A912 _entity.pdbx_number_of_molecules 1 _entity.src_method NAT _entity.type polymer # _entity_poly.entity_id 1 _entity_poly.nstd_chirality . _entity_poly.nstd_linkage NO _entity_poly.nstd_monomer NO _entity_poly.pdbx_seq_one_letter_code MQLNKVLKGLMIALPVMAIAACSSNKNASNDGSEGMLGAGTGMDANGGNGNMSSEEQARLQMQQLQQNNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVY _entity_poly.pdbx_seq_one_letter_code_can MQLNKVLKGLMIALPVMAIAACSSNKNASNDGSEGMLGAGTGMDANGGNGNMSSEEQARLQMQQLQQNNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVY _entity_poly.pdbx_sequence_evidence_code . _entity_poly.pdbx_strand_id A _entity_poly.type polypeptide(L) # loop_ _entity_poly_seq.entity_id _entity_poly_seq.hetero _entity_poly_seq.mon_id _entity_poly_seq.num 1 . MET 1 1 . GLN 2 1 . LEU 3 1 . ASN 4 1 . LYS 5 1 . VAL 6 1 . LEU 7 1 . LYS 8 1 . GLY 9 1 . LEU 10 1 . MET 11 1 . ILE 12 1 . ALA 13 1 . LEU 14 1 . PRO 15 1 . VAL 16 1 . MET 17 1 . ALA 18 1 . ILE 19 1 . ALA 20 1 . ALA 21 1 . CYS 22 1 . SER 23 1 . SER 24 1 . ASN 25 1 . LYS 26 1 . ASN 27 1 . ALA 28 1 . SER 29 1 . ASN 30 1 . ASP 31 1 . GLY 32 1 . SER 33 1 . GLU 34 1 . GLY 35 1 . MET 36 1 . LEU 37 1 . GLY 38 1 . ALA 39 1 . GLY 40 1 . THR 41 1 . GLY 42 1 . MET 43 1 . ASP 44 1 . ALA 45 1 . ASN 46 1 . GLY 47 1 . GLY 48 1 . ASN 49 1 . GLY 50 1 . ASN 51 1 . MET 52 1 . SER 53 1 . SER 54 1 . GLU 55 1 . GLU 56 1 . GLN 57 1 . ALA 58 1 . ARG 59 1 . LEU 60 1 . GLN 61 1 . MET 62 1 . GLN 63 1 . GLN 64 1 . LEU 65 1 . GLN 66 1 . GLN 67 1 . ASN 68 1 . ASN 69 1 . ILE 70 1 . VAL 71 1 . TYR 72 1 . PHE 73 1 . ASP 74 1 . LEU 75 1 . ASP 76 1 . LYS 77 1 . TYR 78 1 . ASP 79 1 . ILE 80 1 . ARG 81 1 . SER 82 1 . ASP 83 1 . PHE 84 1 . ALA 85 1 . GLN 86 1 . MET 87 1 . LEU 88 1 . ASP 89 1 . ALA 90 1 . HIS 91 1 . ALA 92 1 . ASN 93 1 . PHE 94 1 . LEU 95 1 . ARG 96 1 . SER 97 1 . ASN 98 1 . PRO 99 1 . SER 100 1 . TYR 101 1 . LYS 102 1 . VAL 103 1 . THR 104 1 . VAL 105 1 . GLU 106 1 . GLY 107 1 . HIS 108 1 . ALA 109 1 . ASP 110 1 . GLU 111 1 . ARG 112 1 . GLY 113 1 . THR 114 1 . PRO 115 1 . GLU 116 1 . TYR 117 1 . ASN 118 1 . ILE 119 1 . SER 120 1 . LEU 121 1 . GLY 122 1 . GLU 123 1 . ARG 124 1 . ARG 125 1 . ALA 126 1 . ASN 127 1 . ALA 128 1 . VAL 129 1 . LYS 130 1 . MET 131 1 . TYR 132 1 . LEU 133 1 . GLN 134 1 . GLY 135 1 . LYS 136 1 . GLY 137 1 . VAL 138 1 . SER 139 1 . ALA 140 1 . ASP 141 1 . GLN 142 1 . ILE 143 1 . SER 144 1 . ILE 145 1 . VAL 146 1 . SER 147 1 . TYR 148 1 . GLY 149 1 . LYS 150 1 . GLU 151 1 . LYS 152 1 . PRO 153 1 . ALA 154 1 . VAL 155 1 . LEU 156 1 . GLY 157 1 . HIS 158 1 . ASP 159 1 . GLU 160 1 . ALA 161 1 . ALA 162 1 . TYR 163 1 . SER 164 1 . LYS 165 1 . ASN 166 1 . ARG 167 1 . ARG 168 1 . ALA 169 1 . VAL 170 1 . LEU 171 1 . VAL 172 1 . TYR 173 # _ihm_chemical_component_descriptor.auth_name L-Photo-Leucine _ihm_chemical_component_descriptor.chemical_name . _ihm_chemical_component_descriptor.common_name L-Photo-Leucine _ihm_chemical_component_descriptor.details . _ihm_chemical_component_descriptor.id 1 _ihm_chemical_component_descriptor.inchi 1S/C5H9N3O2/c1-5(7-8-5)2-3(6)4(9)10/h3H,2,6H2,1H3,(H,9,10)/t3-/m0/s1 _ihm_chemical_component_descriptor.inchi_key MJRDGTVDJKACQZ-VKHMYHEASA-N _ihm_chemical_component_descriptor.smiles CC1(C[C@H](N)C(O)=O)N=N1 _ihm_chemical_component_descriptor.smiles_canonical . # loop_ _ihm_cross_link_list.comp_id_1 _ihm_cross_link_list.comp_id_2 _ihm_cross_link_list.dataset_list_id _ihm_cross_link_list.details _ihm_cross_link_list.entity_description_1 _ihm_cross_link_list.entity_description_2 _ihm_cross_link_list.entity_id_1 _ihm_cross_link_list.entity_id_2 _ihm_cross_link_list.group_id _ihm_cross_link_list.id _ihm_cross_link_list.linker_chem_comp_descriptor_id _ihm_cross_link_list.linker_type _ihm_cross_link_list.seq_id_1 _ihm_cross_link_list.seq_id_2 LEU GLN 1 . P0A912 P0A912 1 1 1 1 1 L-Photo-Leucine 95 142 LEU GLU 1 . P0A912 P0A912 1 1 2 2 1 L-Photo-Leucine 75 111 TYR LEU 1 . P0A912 P0A912 1 1 3 3 1 L-Photo-Leucine 78 121 LEU ILE 1 . P0A912 P0A912 1 1 4 4 1 L-Photo-Leucine 95 143 LEU THR 1 . P0A912 P0A912 1 1 5 5 1 L-Photo-Leucine 75 114 LEU GLN 1 . P0A912 P0A912 1 1 6 6 1 L-Photo-Leucine 88 142 # loop_ _ihm_cross_link_restraint.asym_id_1 _ihm_cross_link_restraint.asym_id_2 _ihm_cross_link_restraint.atom_id_1 _ihm_cross_link_restraint.atom_id_2 _ihm_cross_link_restraint.comp_id_1 _ihm_cross_link_restraint.comp_id_2 _ihm_cross_link_restraint.conditional_crosslink_flag _ihm_cross_link_restraint.distance_threshold _ihm_cross_link_restraint.entity_id_1 _ihm_cross_link_restraint.entity_id_2 _ihm_cross_link_restraint.group_id _ihm_cross_link_restraint.id _ihm_cross_link_restraint.model_granularity _ihm_cross_link_restraint.pseudo_site_flag _ihm_cross_link_restraint.psi _ihm_cross_link_restraint.restraint_type _ihm_cross_link_restraint.seq_id_1 _ihm_cross_link_restraint.seq_id_2 _ihm_cross_link_restraint.sigma_1 _ihm_cross_link_restraint.sigma_2 A A . . LEU GLN . 10 1 1 1 1 by-residue NO 0.05 "upper bound" 95 142 . . A A . . LEU GLU . 10 1 1 2 2 by-residue NO 0.05 "upper bound" 75 111 . . A A . . TYR LEU . 10 1 1 3 3 by-residue NO 0.05 "upper bound" 78 121 . . A A . . LEU ILE . 10 1 1 4 4 by-residue NO 0.05 "upper bound" 95 143 . . A A . . LEU THR . 10 1 1 5 5 by-residue NO 0.05 "upper bound" 75 114 . . A A . . LEU GLN . 10 1 1 6 6 by-residue NO 0.05 "upper bound" 88 142 . . # _ihm_dataset_group.application . _ihm_dataset_group.details . _ihm_dataset_group.id 1 _ihm_dataset_group.name . # _ihm_dataset_group_link.dataset_list_id 1 _ihm_dataset_group_link.group_id 1 # _ihm_dataset_list.data_type "Crosslinking-MS data" _ihm_dataset_list.database_hosted YES _ihm_dataset_list.details . _ihm_dataset_list.id 1 # _ihm_dataset_related_db_reference.accession_code JPST001851 _ihm_dataset_related_db_reference.dataset_list_id 1 _ihm_dataset_related_db_reference.db_name jPOSTrepo _ihm_dataset_related_db_reference.details . _ihm_dataset_related_db_reference.id 1 _ihm_dataset_related_db_reference.version . # _ihm_entity_poly_segment.comp_id_begin MET _ihm_entity_poly_segment.comp_id_end TYR _ihm_entity_poly_segment.entity_id 1 _ihm_entity_poly_segment.id 1 _ihm_entity_poly_segment.seq_id_begin 1 _ihm_entity_poly_segment.seq_id_end 173 # _ihm_model_group.details . _ihm_model_group.id 1 _ihm_model_group.name . # loop_ _ihm_model_group_link.group_id _ihm_model_group_link.model_id 1 1 1 2 1 3 1 4 1 5 1 6 1 7 1 8 1 9 1 10 # loop_ _ihm_model_list.assembly_id _ihm_model_list.model_id _ihm_model_list.model_name _ihm_model_list.protocol_id _ihm_model_list.representation_id 1 1 . 1 1 1 2 . 1 1 1 3 . 1 1 1 4 . 1 1 1 5 . 1 1 1 6 . 1 1 1 7 . 1 1 1 8 . 1 1 1 9 . 1 1 1 10 . 1 1 # _ihm_model_representation.details . _ihm_model_representation.id 1 _ihm_model_representation.name . # _ihm_model_representation_details.description . _ihm_model_representation_details.entity_asym_id A _ihm_model_representation_details.entity_description P0A912 _ihm_model_representation_details.entity_id 1 _ihm_model_representation_details.entity_poly_segment_id 1 _ihm_model_representation_details.id 1 _ihm_model_representation_details.model_granularity by-atom _ihm_model_representation_details.model_mode flexible _ihm_model_representation_details.model_object_count . _ihm_model_representation_details.model_object_primitive atomistic _ihm_model_representation_details.representation_id 1 _ihm_model_representation_details.starting_model_id . # _ihm_modeling_protocol.details . _ihm_modeling_protocol.id 1 _ihm_modeling_protocol.num_steps 1 _ihm_modeling_protocol.protocol_name AlphaLink # _ihm_modeling_protocol_details.dataset_group_id 1 _ihm_modeling_protocol_details.description . _ihm_modeling_protocol_details.ensemble_flag YES _ihm_modeling_protocol_details.id 1 _ihm_modeling_protocol_details.multi_scale_flag NO _ihm_modeling_protocol_details.multi_state_flag NO _ihm_modeling_protocol_details.num_models_begin 0 _ihm_modeling_protocol_details.num_models_end 10 _ihm_modeling_protocol_details.ordered_flag NO _ihm_modeling_protocol_details.protocol_id 1 _ihm_modeling_protocol_details.script_file_id . _ihm_modeling_protocol_details.software_id . _ihm_modeling_protocol_details.step_id 1 _ihm_modeling_protocol_details.step_method "AlphaLink with 10 msa subsamples" _ihm_modeling_protocol_details.step_name AlphaLink _ihm_modeling_protocol_details.struct_assembly_description . _ihm_modeling_protocol_details.struct_assembly_id 1 # _ihm_struct_assembly.description "Integrative modeling using in-cell photo-crosslinking mass spectrometry and deep learning" _ihm_struct_assembly.id 1 _ihm_struct_assembly.name "Integrative model" # _ihm_struct_assembly_details.assembly_id 1 _ihm_struct_assembly_details.asym_id A _ihm_struct_assembly_details.entity_description P0A912 _ihm_struct_assembly_details.entity_id 1 _ihm_struct_assembly_details.entity_poly_segment_id 1 _ihm_struct_assembly_details.id 1 _ihm_struct_assembly_details.parent_assembly_id 1 # _software.citation_id 1 _software.classification "model building" _software.description "protein structure prediction by deep learning assisted by experimental distance restraints" _software.location https://github.com/lhatsk/AlphaLink _software.name AlphaLink _software.pdbx_ordinal 1 _software.type program _software.version 1.0 # _struct.entry_id 9A2N _struct.pdbx_CASP_flag . _struct.pdbx_descriptor . _struct.pdbx_details . _struct.pdbx_model_details . _struct.pdbx_model_type_details . _struct.title "Model of E. coli Pal by in-cell photo-crosslinking MS and deep learning" _struct.pdbx_structure_determination_methodology integrative # _struct_asym.details P0A912 _struct_asym.entity_id 1 _struct_asym.id A _struct_asym.pdbx_PDB_id . _struct_asym.pdbx_alt_id . _struct_asym.pdbx_blank_PDB_chainid_flag . _struct_asym.pdbx_modified . _struct_asym.pdbx_order . _struct_asym.pdbx_type . # _struct_ref.db_code PAL_ECOLI _struct_ref.db_name UNP _struct_ref.details "Peptidoglycan-associated lipoprotein OS=Escherichia coli (strain K12) OX=83333 GN=pal PE=1 SV=1" _struct_ref.entity_id 1 _struct_ref.id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_accession P0A912 _struct_ref.pdbx_seq_one_letter_code MQLNKVLKGLMIALPVMAIAACSSNKNASNDGSEGMLGAGTGMDANGGNGNMSSEEQARLQMQQLQQNNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVY # _struct_ref_seq.align_id 1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.db_align_end 173 _struct_ref_seq.ref_id 1 _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.seq_align_end 173 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code A 1 1 MET 1 1 MET MET A . A 1 2 GLN 2 2 GLN GLN A . A 1 3 LEU 3 3 LEU LEU A . A 1 4 ASN 4 4 ASN ASN A . A 1 5 LYS 5 5 LYS LYS A . A 1 6 VAL 6 6 VAL VAL A . A 1 7 LEU 7 7 LEU LEU A . A 1 8 LYS 8 8 LYS LYS A . A 1 9 GLY 9 9 GLY GLY A . A 1 10 LEU 10 10 LEU LEU A . A 1 11 MET 11 11 MET MET A . A 1 12 ILE 12 12 ILE ILE A . A 1 13 ALA 13 13 ALA ALA A . A 1 14 LEU 14 14 LEU LEU A . A 1 15 PRO 15 15 PRO PRO A . A 1 16 VAL 16 16 VAL VAL A . A 1 17 MET 17 17 MET MET A . A 1 18 ALA 18 18 ALA ALA A . A 1 19 ILE 19 19 ILE ILE A . A 1 20 ALA 20 20 ALA ALA A . A 1 21 ALA 21 21 ALA ALA A . A 1 22 CYS 22 22 CYS CYS A . A 1 23 SER 23 23 SER SER A . A 1 24 SER 24 24 SER SER A . A 1 25 ASN 25 25 ASN ASN A . A 1 26 LYS 26 26 LYS LYS A . A 1 27 ASN 27 27 ASN ASN A . A 1 28 ALA 28 28 ALA ALA A . A 1 29 SER 29 29 SER SER A . A 1 30 ASN 30 30 ASN ASN A . A 1 31 ASP 31 31 ASP ASP A . A 1 32 GLY 32 32 GLY GLY A . A 1 33 SER 33 33 SER SER A . A 1 34 GLU 34 34 GLU GLU A . A 1 35 GLY 35 35 GLY GLY A . A 1 36 MET 36 36 MET MET A . A 1 37 LEU 37 37 LEU LEU A . A 1 38 GLY 38 38 GLY GLY A . A 1 39 ALA 39 39 ALA ALA A . A 1 40 GLY 40 40 GLY GLY A . A 1 41 THR 41 41 THR THR A . A 1 42 GLY 42 42 GLY GLY A . A 1 43 MET 43 43 MET MET A . A 1 44 ASP 44 44 ASP ASP A . A 1 45 ALA 45 45 ALA ALA A . A 1 46 ASN 46 46 ASN ASN A . A 1 47 GLY 47 47 GLY GLY A . A 1 48 GLY 48 48 GLY GLY A . A 1 49 ASN 49 49 ASN ASN A . A 1 50 GLY 50 50 GLY GLY A . A 1 51 ASN 51 51 ASN ASN A . A 1 52 MET 52 52 MET MET A . A 1 53 SER 53 53 SER SER A . A 1 54 SER 54 54 SER SER A . A 1 55 GLU 55 55 GLU GLU A . A 1 56 GLU 56 56 GLU GLU A . A 1 57 GLN 57 57 GLN GLN A . A 1 58 ALA 58 58 ALA ALA A . A 1 59 ARG 59 59 ARG ARG A . A 1 60 LEU 60 60 LEU LEU A . A 1 61 GLN 61 61 GLN GLN A . A 1 62 MET 62 62 MET MET A . A 1 63 GLN 63 63 GLN GLN A . A 1 64 GLN 64 64 GLN GLN A . A 1 65 LEU 65 65 LEU LEU A . A 1 66 GLN 66 66 GLN GLN A . A 1 67 GLN 67 67 GLN GLN A . A 1 68 ASN 68 68 ASN ASN A . A 1 69 ASN 69 69 ASN ASN A . A 1 70 ILE 70 70 ILE ILE A . A 1 71 VAL 71 71 VAL VAL A . A 1 72 TYR 72 72 TYR TYR A . A 1 73 PHE 73 73 PHE PHE A . A 1 74 ASP 74 74 ASP ASP A . A 1 75 LEU 75 75 LEU LEU A . A 1 76 ASP 76 76 ASP ASP A . A 1 77 LYS 77 77 LYS LYS A . A 1 78 TYR 78 78 TYR TYR A . A 1 79 ASP 79 79 ASP ASP A . A 1 80 ILE 80 80 ILE ILE A . A 1 81 ARG 81 81 ARG ARG A . A 1 82 SER 82 82 SER SER A . A 1 83 ASP 83 83 ASP ASP A . A 1 84 PHE 84 84 PHE PHE A . A 1 85 ALA 85 85 ALA ALA A . A 1 86 GLN 86 86 GLN GLN A . A 1 87 MET 87 87 MET MET A . A 1 88 LEU 88 88 LEU LEU A . A 1 89 ASP 89 89 ASP ASP A . A 1 90 ALA 90 90 ALA ALA A . A 1 91 HIS 91 91 HIS HIS A . A 1 92 ALA 92 92 ALA ALA A . A 1 93 ASN 93 93 ASN ASN A . A 1 94 PHE 94 94 PHE PHE A . A 1 95 LEU 95 95 LEU LEU A . A 1 96 ARG 96 96 ARG ARG A . A 1 97 SER 97 97 SER SER A . A 1 98 ASN 98 98 ASN ASN A . A 1 99 PRO 99 99 PRO PRO A . A 1 100 SER 100 100 SER SER A . A 1 101 TYR 101 101 TYR TYR A . A 1 102 LYS 102 102 LYS LYS A . A 1 103 VAL 103 103 VAL VAL A . A 1 104 THR 104 104 THR THR A . A 1 105 VAL 105 105 VAL VAL A . A 1 106 GLU 106 106 GLU GLU A . A 1 107 GLY 107 107 GLY GLY A . A 1 108 HIS 108 108 HIS HIS A . A 1 109 ALA 109 109 ALA ALA A . A 1 110 ASP 110 110 ASP ASP A . A 1 111 GLU 111 111 GLU GLU A . A 1 112 ARG 112 112 ARG ARG A . A 1 113 GLY 113 113 GLY GLY A . A 1 114 THR 114 114 THR THR A . A 1 115 PRO 115 115 PRO PRO A . A 1 116 GLU 116 116 GLU GLU A . A 1 117 TYR 117 117 TYR TYR A . A 1 118 ASN 118 118 ASN ASN A . A 1 119 ILE 119 119 ILE ILE A . A 1 120 SER 120 120 SER SER A . A 1 121 LEU 121 121 LEU LEU A . A 1 122 GLY 122 122 GLY GLY A . A 1 123 GLU 123 123 GLU GLU A . A 1 124 ARG 124 124 ARG ARG A . A 1 125 ARG 125 125 ARG ARG A . A 1 126 ALA 126 126 ALA ALA A . A 1 127 ASN 127 127 ASN ASN A . A 1 128 ALA 128 128 ALA ALA A . A 1 129 VAL 129 129 VAL VAL A . A 1 130 LYS 130 130 LYS LYS A . A 1 131 MET 131 131 MET MET A . A 1 132 TYR 132 132 TYR TYR A . A 1 133 LEU 133 133 LEU LEU A . A 1 134 GLN 134 134 GLN GLN A . A 1 135 GLY 135 135 GLY GLY A . A 1 136 LYS 136 136 LYS LYS A . A 1 137 GLY 137 137 GLY GLY A . A 1 138 VAL 138 138 VAL VAL A . A 1 139 SER 139 139 SER SER A . A 1 140 ALA 140 140 ALA ALA A . A 1 141 ASP 141 141 ASP ASP A . A 1 142 GLN 142 142 GLN GLN A . A 1 143 ILE 143 143 ILE ILE A . A 1 144 SER 144 144 SER SER A . A 1 145 ILE 145 145 ILE ILE A . A 1 146 VAL 146 146 VAL VAL A . A 1 147 SER 147 147 SER SER A . A 1 148 TYR 148 148 TYR TYR A . A 1 149 GLY 149 149 GLY GLY A . A 1 150 LYS 150 150 LYS LYS A . A 1 151 GLU 151 151 GLU GLU A . A 1 152 LYS 152 152 LYS LYS A . A 1 153 PRO 153 153 PRO PRO A . A 1 154 ALA 154 154 ALA ALA A . A 1 155 VAL 155 155 VAL VAL A . A 1 156 LEU 156 156 LEU LEU A . A 1 157 GLY 157 157 GLY GLY A . A 1 158 HIS 158 158 HIS HIS A . A 1 159 ASP 159 159 ASP ASP A . A 1 160 GLU 160 160 GLU GLU A . A 1 161 ALA 161 161 ALA ALA A . A 1 162 ALA 162 162 ALA ALA A . A 1 163 TYR 163 163 TYR TYR A . A 1 164 SER 164 164 SER SER A . A 1 165 LYS 165 165 LYS LYS A . A 1 166 ASN 166 166 ASN ASN A . A 1 167 ARG 167 167 ARG ARG A . A 1 168 ARG 168 168 ARG ARG A . A 1 169 ALA 169 169 ALA ALA A . A 1 170 VAL 170 170 VAL VAL A . A 1 171 LEU 171 171 LEU LEU A . A 1 172 VAL 172 172 VAL VAL A . A 1 173 TYR 173 173 TYR TYR A . # # loop_ # #