data_9A8R # _entry.id 9A8R # loop_ _atom_type.symbol C H N O S # loop_ _audit_author.name _audit_author.pdbx_ordinal "He, Y." 1 "Bhattacharya, S." 2 "Chen, Y." 3 "Mohanty, A." 4 "Grishaev, A." 5 "Kulkarni, P." 6 "Salgia, R." 7 Orban,J. 8 # loop_ _audit_conform.dict_location _audit_conform.dict_name _audit_conform.dict_version https://mmcif.wwpdb.org/dictionaries/ascii/mmcif_ihm_ext.dic mmcif_ihm_ext.dic 1.26 http://mmcif.wwpdb.org/dictionaries/ascii/mmcif_pdbx_v50.dic mmcif_pdbx.dic 5.395 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 9A8R _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2024-07-31 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2026-09-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9A8R pdb_00009a8r 10.2210/pdb9a8r/pdb PDB-Dev PDBDEV_00000391 PDBDEV_00000391 ? # loop_ _chem_comp.formula _chem_comp.formula_weight _chem_comp.id _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.type "C3 H7 N O2" 89.094 ALA . ALANINE . "L-peptide linking" "C6 H15 N4 O2 1" 175.212 ARG . ARGININE . "L-peptide linking" "C4 H8 N2 O3" 132.119 ASN . ASPARAGINE . "L-peptide linking" "C4 H7 N O4" 133.103 ASP . "ASPARTIC ACID" . "L-peptide linking" "C5 H10 N2 O3" 146.146 GLN . GLUTAMINE . "L-peptide linking" "C5 H9 N O4" 147.13 GLU . "GLUTAMIC ACID" . "L-peptide linking" "C2 H5 N O2" 75.067 GLY . GLYCINE . "peptide linking" "C6 H10 N3 O2 1" 156.165 HIS . HISTIDINE . "L-peptide linking" "C6 H13 N O2" 131.175 ILE . ISOLEUCINE . "L-peptide linking" "C6 H13 N O2" 131.175 LEU . LEUCINE . "L-peptide linking" "C6 H15 N2 O2 1" 147.198 LYS . LYSINE . "L-peptide linking" "C5 H11 N O2 S" 149.208 MET . METHIONINE . "L-peptide linking" "C5 H9 N O2" 115.132 PRO . PROLINE . "L-peptide linking" "C3 H7 N O3" 105.093 SER . SERINE . "L-peptide linking" "C4 H9 N O3" 119.12 THR . THREONINE . "L-peptide linking" "C9 H11 N O3" 181.191 TYR . TYROSINE . "L-peptide linking" "C5 H11 N O2" 117.148 VAL . VALINE . "L-peptide linking" # _citation.country . _citation.id 1 _citation.journal_abbrev "To be published" _citation.journal_id_ASTM . _citation.journal_id_CSD . _citation.journal_id_ISSN . _citation.journal_issue . _citation.journal_volume . _citation.page_first . _citation.page_last . _citation.pdbx_database_id_DOI . _citation.pdbx_database_id_PubMed . _citation.title "Integrative structure of focal adhesion kinase 1 from NMR data" _citation.year . # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal 1 "He, Y." 1 1 "Bhattacharya, S." 2 1 "Chen, Y." 3 1 "Mohanty, A." 4 1 "Grishaev, A." 5 1 "Kulkarni, P." 6 1 "Salgia, R." 7 1 "Orban, J." 8 # _entity.details . _entity.formula_weight 16007.008 _entity.id 1 _entity.pdbx_description "Focal adhesion kinase 1" _entity.pdbx_number_of_molecules 1 _entity.src_method MAN _entity.type POLYMER # _entity_name_com.entity_id 1 _entity_name_com.name "Focal Adhesion Targeting Domain " # _entity_poly.entity_id 1 _entity_poly.nstd_chirality . _entity_poly.nstd_linkage NO _entity_poly.nstd_monomer NO _entity_poly.pdbx_seq_one_letter_code DRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQA _entity_poly.pdbx_seq_one_letter_code_can DRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQA _entity_poly.pdbx_sequence_evidence_code . _entity_poly.pdbx_strand_id A _entity_poly.type polypeptide(L) # loop_ _entity_poly_seq.entity_id _entity_poly_seq.hetero _entity_poly_seq.mon_id _entity_poly_seq.num 1 . ASP 1 1 . ARG 2 1 . SER 3 1 . ASN 4 1 . ASP 5 1 . LYS 6 1 . VAL 7 1 . TYR 8 1 . GLU 9 1 . ASN 10 1 . VAL 11 1 . THR 12 1 . GLY 13 1 . LEU 14 1 . VAL 15 1 . LYS 16 1 . ALA 17 1 . VAL 18 1 . ILE 19 1 . GLU 20 1 . MET 21 1 . SER 22 1 . SER 23 1 . LYS 24 1 . ILE 25 1 . GLN 26 1 . PRO 27 1 . ALA 28 1 . PRO 29 1 . PRO 30 1 . GLU 31 1 . GLU 32 1 . TYR 33 1 . VAL 34 1 . PRO 35 1 . MET 36 1 . VAL 37 1 . LYS 38 1 . GLU 39 1 . VAL 40 1 . GLY 41 1 . LEU 42 1 . ALA 43 1 . LEU 44 1 . ARG 45 1 . THR 46 1 . LEU 47 1 . LEU 48 1 . ALA 49 1 . THR 50 1 . VAL 51 1 . ASP 52 1 . GLU 53 1 . THR 54 1 . ILE 55 1 . PRO 56 1 . LEU 57 1 . LEU 58 1 . PRO 59 1 . ALA 60 1 . SER 61 1 . THR 62 1 . HIS 63 1 . ARG 64 1 . GLU 65 1 . ILE 66 1 . GLU 67 1 . MET 68 1 . ALA 69 1 . GLN 70 1 . LYS 71 1 . LEU 72 1 . LEU 73 1 . ASN 74 1 . SER 75 1 . ASP 76 1 . LEU 77 1 . GLY 78 1 . GLU 79 1 . LEU 80 1 . ILE 81 1 . ASN 82 1 . LYS 83 1 . MET 84 1 . LYS 85 1 . LEU 86 1 . ALA 87 1 . GLN 88 1 . GLN 89 1 . TYR 90 1 . VAL 91 1 . MET 92 1 . THR 93 1 . SER 94 1 . LEU 95 1 . GLN 96 1 . GLN 97 1 . GLU 98 1 . TYR 99 1 . LYS 100 1 . LYS 101 1 . GLN 102 1 . MET 103 1 . LEU 104 1 . THR 105 1 . ALA 106 1 . ALA 107 1 . HIS 108 1 . ALA 109 1 . LEU 110 1 . ALA 111 1 . VAL 112 1 . ASP 113 1 . ALA 114 1 . LYS 115 1 . ASN 116 1 . LEU 117 1 . LEU 118 1 . ASP 119 1 . VAL 120 1 . ILE 121 1 . ASP 122 1 . GLN 123 1 . ALA 124 # _ihm_dataset_group.application modeling _ihm_dataset_group.details . _ihm_dataset_group.id 1 _ihm_dataset_group.name . # _ihm_dataset_group_link.dataset_list_id 1 _ihm_dataset_group_link.group_id 1 # _ihm_dataset_list.data_type "NMR data" _ihm_dataset_list.database_hosted YES _ihm_dataset_list.details "BMRB id 51556" _ihm_dataset_list.id 1 # _ihm_dataset_related_db_reference.accession_code 51556 _ihm_dataset_related_db_reference.dataset_list_id 1 _ihm_dataset_related_db_reference.db_name BMRB _ihm_dataset_related_db_reference.details . _ihm_dataset_related_db_reference.id 1 _ihm_dataset_related_db_reference.version . # _ihm_entity_poly_segment.comp_id_begin ASP _ihm_entity_poly_segment.comp_id_end ALA _ihm_entity_poly_segment.entity_id 1 _ihm_entity_poly_segment.id 1 _ihm_entity_poly_segment.seq_id_begin 1 _ihm_entity_poly_segment.seq_id_end 124 # _ihm_model_group.details . _ihm_model_group.id 1 _ihm_model_group.name . # loop_ _ihm_model_group_link.group_id _ihm_model_group_link.model_id 1 1 1 2 1 3 1 4 1 5 1 6 1 7 1 8 1 9 1 10 # loop_ _ihm_model_list.assembly_id _ihm_model_list.model_id _ihm_model_list.model_name _ihm_model_list.protocol_id _ihm_model_list.representation_id 1 1 . 1 1 1 2 . 1 1 1 3 . 1 1 1 4 . 1 1 1 5 . 1 1 1 6 . 1 1 1 7 . 1 1 1 8 . 1 1 1 9 . 1 1 1 10 . 1 1 # _ihm_model_representation.details "No starting models were used" _ihm_model_representation.id 1 _ihm_model_representation.name . # _ihm_model_representation_details.description . _ihm_model_representation_details.entity_asym_id A _ihm_model_representation_details.entity_description "Focal adhesion kinase 1" _ihm_model_representation_details.entity_id 1 _ihm_model_representation_details.entity_poly_segment_id 1 _ihm_model_representation_details.id 1 _ihm_model_representation_details.model_granularity by-atom _ihm_model_representation_details.model_mode flexible _ihm_model_representation_details.model_object_count . _ihm_model_representation_details.model_object_primitive atomistic _ihm_model_representation_details.representation_id 1 _ihm_model_representation_details.starting_model_id . # _ihm_model_representative.id 1 _ihm_model_representative.model_group_id 1 _ihm_model_representative.model_id 1 _ihm_model_representative.selection_criteria "lowest energy" # _ihm_modeling_protocol.details "Focal adhesion kinase 1 modeled using CS-Rosetta, guided by its experimentally determined chemical shift values" _ihm_modeling_protocol.id 1 _ihm_modeling_protocol.num_steps 1 _ihm_modeling_protocol.protocol_name modeling # _ihm_modeling_protocol_details.dataset_group_id 1 _ihm_modeling_protocol_details.description . _ihm_modeling_protocol_details.ensemble_flag YES _ihm_modeling_protocol_details.id 1 _ihm_modeling_protocol_details.multi_scale_flag NO _ihm_modeling_protocol_details.multi_state_flag NO _ihm_modeling_protocol_details.num_models_begin . _ihm_modeling_protocol_details.num_models_end . _ihm_modeling_protocol_details.ordered_flag NO _ihm_modeling_protocol_details.protocol_id 1 _ihm_modeling_protocol_details.script_file_id . _ihm_modeling_protocol_details.software_id 1 _ihm_modeling_protocol_details.step_id 1 _ihm_modeling_protocol_details.step_method . _ihm_modeling_protocol_details.step_name . _ihm_modeling_protocol_details.struct_assembly_description . _ihm_modeling_protocol_details.struct_assembly_id 1 # _ihm_struct_assembly.description "Focal adhesion kinase 1 modeled using CS-Rosetta, guided by its experimentally determined chemical shift values" _ihm_struct_assembly.id 1 _ihm_struct_assembly.name "Focal adhesion kinase 1" # _ihm_struct_assembly_details.assembly_id 1 _ihm_struct_assembly_details.asym_id A _ihm_struct_assembly_details.entity_description "Focal adhesion kinase 1" _ihm_struct_assembly_details.entity_id 1 _ihm_struct_assembly_details.entity_poly_segment_id 1 _ihm_struct_assembly_details.id 1 _ihm_struct_assembly_details.parent_assembly_id 1 # _software.citation_id . _software.classification "structure calculation" _software.description . _software.location https://www.rosettacommons.org/docs/latest/CS-Rosetta _software.name CS-Rosetta _software.pdbx_ordinal 1 _software.type program _software.version . # _struct.entry_id 9A8R _struct.pdbx_CASP_flag . _struct.pdbx_descriptor . _struct.pdbx_details . _struct.pdbx_model_details . _struct.pdbx_model_type_details . _struct.pdbx_structure_determination_methodology integrative _struct.title "Integrative structure of focal adhesion kinase 1 from NMR data" # _struct_asym.details . _struct_asym.entity_id 1 _struct_asym.id A _struct_asym.pdbx_PDB_id . _struct_asym.pdbx_alt_id . _struct_asym.pdbx_blank_PDB_chainid_flag . _struct_asym.pdbx_modified . _struct_asym.pdbx_order . _struct_asym.pdbx_type . # _struct_ref.db_code FAK1_HUMAN _struct_ref.db_name UNP _struct_ref.details . _struct_ref.entity_id 1 _struct_ref.id 1 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_align_end . _struct_ref.pdbx_db_accession Q05397 _struct_ref.pdbx_db_isoform . _struct_ref.pdbx_seq_one_letter_code DRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQA # _struct_ref_seq.align_id 1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.db_align_end 124 _struct_ref_seq.ref_id 1 _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.seq_align_end 124 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code A 1 1 ASP 1 1 ASP ASP A . A 1 2 ARG 2 2 ARG ARG A . A 1 3 SER 3 3 SER SER A . A 1 4 ASN 4 4 ASN ASN A . A 1 5 ASP 5 5 ASP ASP A . A 1 6 LYS 6 6 LYS LYS A . A 1 7 VAL 7 7 VAL VAL A . A 1 8 TYR 8 8 TYR TYR A . A 1 9 GLU 9 9 GLU GLU A . A 1 10 ASN 10 10 ASN ASN A . A 1 11 VAL 11 11 VAL VAL A . A 1 12 THR 12 12 THR THR A . A 1 13 GLY 13 13 GLY GLY A . A 1 14 LEU 14 14 LEU LEU A . A 1 15 VAL 15 15 VAL VAL A . A 1 16 LYS 16 16 LYS LYS A . A 1 17 ALA 17 17 ALA ALA A . A 1 18 VAL 18 18 VAL VAL A . A 1 19 ILE 19 19 ILE ILE A . A 1 20 GLU 20 20 GLU GLU A . A 1 21 MET 21 21 MET MET A . A 1 22 SER 22 22 SER SER A . A 1 23 SER 23 23 SER SER A . A 1 24 LYS 24 24 LYS LYS A . A 1 25 ILE 25 25 ILE ILE A . A 1 26 GLN 26 26 GLN GLN A . A 1 27 PRO 27 27 PRO PRO A . A 1 28 ALA 28 28 ALA ALA A . A 1 29 PRO 29 29 PRO PRO A . A 1 30 PRO 30 30 PRO PRO A . A 1 31 GLU 31 31 GLU GLU A . A 1 32 GLU 32 32 GLU GLU A . A 1 33 TYR 33 33 TYR TYR A . A 1 34 VAL 34 34 VAL VAL A . A 1 35 PRO 35 35 PRO PRO A . A 1 36 MET 36 36 MET MET A . A 1 37 VAL 37 37 VAL VAL A . A 1 38 LYS 38 38 LYS LYS A . A 1 39 GLU 39 39 GLU GLU A . A 1 40 VAL 40 40 VAL VAL A . A 1 41 GLY 41 41 GLY GLY A . A 1 42 LEU 42 42 LEU LEU A . A 1 43 ALA 43 43 ALA ALA A . A 1 44 LEU 44 44 LEU LEU A . A 1 45 ARG 45 45 ARG ARG A . A 1 46 THR 46 46 THR THR A . A 1 47 LEU 47 47 LEU LEU A . A 1 48 LEU 48 48 LEU LEU A . A 1 49 ALA 49 49 ALA ALA A . A 1 50 THR 50 50 THR THR A . A 1 51 VAL 51 51 VAL VAL A . A 1 52 ASP 52 52 ASP ASP A . A 1 53 GLU 53 53 GLU GLU A . A 1 54 THR 54 54 THR THR A . A 1 55 ILE 55 55 ILE ILE A . A 1 56 PRO 56 56 PRO PRO A . A 1 57 LEU 57 57 LEU LEU A . A 1 58 LEU 58 58 LEU LEU A . A 1 59 PRO 59 59 PRO PRO A . A 1 60 ALA 60 60 ALA ALA A . A 1 61 SER 61 61 SER SER A . A 1 62 THR 62 62 THR THR A . A 1 63 HIS 63 63 HIS HIS A . A 1 64 ARG 64 64 ARG ARG A . A 1 65 GLU 65 65 GLU GLU A . A 1 66 ILE 66 66 ILE ILE A . A 1 67 GLU 67 67 GLU GLU A . A 1 68 MET 68 68 MET MET A . A 1 69 ALA 69 69 ALA ALA A . A 1 70 GLN 70 70 GLN GLN A . A 1 71 LYS 71 71 LYS LYS A . A 1 72 LEU 72 72 LEU LEU A . A 1 73 LEU 73 73 LEU LEU A . A 1 74 ASN 74 74 ASN ASN A . A 1 75 SER 75 75 SER SER A . A 1 76 ASP 76 76 ASP ASP A . A 1 77 LEU 77 77 LEU LEU A . A 1 78 GLY 78 78 GLY GLY A . A 1 79 GLU 79 79 GLU GLU A . A 1 80 LEU 80 80 LEU LEU A . A 1 81 ILE 81 81 ILE ILE A . A 1 82 ASN 82 82 ASN ASN A . A 1 83 LYS 83 83 LYS LYS A . A 1 84 MET 84 84 MET MET A . A 1 85 LYS 85 85 LYS LYS A . A 1 86 LEU 86 86 LEU LEU A . A 1 87 ALA 87 87 ALA ALA A . A 1 88 GLN 88 88 GLN GLN A . A 1 89 GLN 89 89 GLN GLN A . A 1 90 TYR 90 90 TYR TYR A . A 1 91 VAL 91 91 VAL VAL A . A 1 92 MET 92 92 MET MET A . A 1 93 THR 93 93 THR THR A . A 1 94 SER 94 94 SER SER A . A 1 95 LEU 95 95 LEU LEU A . A 1 96 GLN 96 96 GLN GLN A . A 1 97 GLN 97 97 GLN GLN A . A 1 98 GLU 98 98 GLU GLU A . A 1 99 TYR 99 99 TYR TYR A . A 1 100 LYS 100 100 LYS LYS A . A 1 101 LYS 101 101 LYS LYS A . A 1 102 GLN 102 102 GLN GLN A . A 1 103 MET 103 103 MET MET A . A 1 104 LEU 104 104 LEU LEU A . A 1 105 THR 105 105 THR THR A . A 1 106 ALA 106 106 ALA ALA A . A 1 107 ALA 107 107 ALA ALA A . A 1 108 HIS 108 108 HIS HIS A . A 1 109 ALA 109 109 ALA ALA A . A 1 110 LEU 110 110 LEU LEU A . A 1 111 ALA 111 111 ALA ALA A . A 1 112 VAL 112 112 VAL VAL A . A 1 113 ASP 113 113 ASP ASP A . A 1 114 ALA 114 114 ALA ALA A . A 1 115 LYS 115 115 LYS LYS A . A 1 116 ASN 116 116 ASN ASN A . A 1 117 LEU 117 117 LEU LEU A . A 1 118 LEU 118 118 LEU LEU A . A 1 119 ASP 119 119 ASP ASP A . A 1 120 VAL 120 120 VAL VAL A . A 1 121 ILE 121 121 ILE ILE A . A 1 122 ASP 122 122 ASP ASP A . A 1 123 GLN 123 123 GLN GLN A . A 1 124 ALA 124 124 ALA ALA A . # # loop_ # #