data_9A8Z # _entry.id 9A8Z # loop_ _atom_type.symbol C H N O S # loop_ _audit_author.name _audit_author.pdbx_ordinal "Huang, Y.J." 1 "Ramelot, T.A." 2 "Spaman, L.E." 3 "Montelione, G.T." 4 # loop_ _audit_conform.dict_location _audit_conform.dict_name _audit_conform.dict_version https://mmcif.wwpdb.org/dictionaries/ascii/mmcif_ihm_ext.dic mmcif_ihm_ext.dic 1.28 http://mmcif.wwpdb.org/dictionaries/ascii/mmcif_pdbx_v50.dic mmcif_pdbx.dic 5.403 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 9A8Z _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2025-01-24 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2026-05-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9A8Z pdb_00009a8z 10.2210/pdb9a8z/pdb # loop_ _chem_comp.formula _chem_comp.formula_weight _chem_comp.id _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.type "C3 H7 N O2" 89.094 ALA . ALANINE . "L-peptide linking" "C6 H15 N4 O2 1" 175.212 ARG . ARGININE . "L-peptide linking" "C4 H8 N2 O3" 132.119 ASN . ASPARAGINE . "L-peptide linking" "C3 H7 N O2 S" 121.154 CYS . CYSTEINE . "L-peptide linking" "C5 H9 N O4" 147.13 GLU . "GLUTAMIC ACID" . "L-peptide linking" "C2 H5 N O2" 75.067 GLY . GLYCINE . "peptide linking" "C6 H10 N3 O2 1" 156.165 HIS . HISTIDINE . "L-peptide linking" "C6 H13 N O2" 131.175 ILE . ISOLEUCINE . "L-peptide linking" "C6 H13 N O2" 131.175 LEU . LEUCINE . "L-peptide linking" "C6 H15 N2 O2 1" 147.198 LYS . LYSINE . "L-peptide linking" "C5 H11 N O2 S" 149.208 MET . METHIONINE . "L-peptide linking" "C5 H9 N O2" 115.132 PRO . PROLINE . "L-peptide linking" "C3 H7 N O3" 105.093 SER . SERINE . "L-peptide linking" "C4 H9 N O3" 119.12 THR . THREONINE . "L-peptide linking" "C9 H11 N O3" 181.191 TYR . TYROSINE . "L-peptide linking" "C5 H11 N O2" 117.148 VAL . VALINE . "L-peptide linking" # loop_ _citation.country _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_issue _citation.journal_volume _citation.page_first _citation.page_last _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.title _citation.year . 1 "Nat Commun" . . . . . . . 10.1038/s41467-026-71997-6 42045216 "Hidden Structural States of Proteins Revealed by Conformer Selection" 2026 . 2 "J. Am. Chem. Soc." . . . 6 127 1665 1674 10.1021/ja047109h . "Protein NMR Recall, Precision, and F-measure Scores (RPF Scores): Structure Quality Assessment Measures Based on Information Retrieval Statistics" 2005 . 3 Proteins . . . . 66 778 795 10.1002/prot.21165 . "Evaluating protein structures determined by structural genomics consortia" 2007 . 4 Nature . . . . 596 583 589 10.1038/s41586-021-03819-2 . "Highly accurate protein structure prediction with AlphaFold" 2021 . 5 Bioinformatics . . . 9 39 . . 10.1093/bioinformatics/btad573 . "AFsample: improving multimer prediction with AlphaFold using massive sampling" 2023 . 6 "Nucleic Acids Research" . . . suppl_2 35 W531 W537 10.1093/nar/gkm328 . "The RCI server: rapid and accurate calculation of protein flexibility using chemical shifts" 2007 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal 1 "Huang, Y.J." 1 1 "Ramelot, T.A." 2 1 "Spaman, L.E." 3 1 "Kobayashi, N." 4 1 "Montelione, G.T." 5 2 "Huang, Y.J." 6 2 "Powers, R." 7 2 "Montelione, G.T." 8 3 "Bhattacharya, A." 9 3 "Tejero, R." 10 3 "Montelione, G.T." 11 4 "Jumper, J." 12 4 "Evans, R." 13 4 "Pritzel, A." 14 4 "Green, T." 15 4 "Figurnov, M." 16 4 "Ronneberger, O." 17 4 "Tunyasuvunakool, K." 18 4 "Bates, R." 19 4 "Zidek, A." 20 4 "Potapenko, A." 21 4 "Bridgland, A." 22 4 "Meyer, C." 23 4 "Kohl, S.A.A" 24 4 "Ballard, A.J." 25 4 "Cowie, A." 26 4 "Romera-Paredes, B." 27 4 "Nikolov, S." 28 4 "Jain, R." 29 4 "Adler, J." 30 4 "Back, T." 31 4 "Petersen, S." 32 4 "Reiman, D." 33 4 "Clancy, E." 34 4 "Zielinski, M." 35 4 "Steinegger, M." 36 4 "Pacholska, M." 37 4 "Berghammer, T." 38 4 "Bodenstein, S." 39 4 "Silver, D." 40 4 "Vinyals, O." 41 4 "Senior, A.W." 42 4 "Kavukcuoglu, K." 43 4 "Kohli, P." 44 4 "Hassabis, D." 45 5 "Wallner, B." 46 6 "Berjanskii, M.V." 47 6 "Wishart, D.S." 48 # _entity.details . _entity.formula_weight 7171.087 _entity.id 1 _entity.pdbx_description "Cyclin-dependent kinase 2-associated protein 1" _entity.pdbx_number_of_molecules 2 _entity.src_method MAN _entity.type POLYMER # _entity_poly.entity_id 1 _entity_poly.nstd_chirality . _entity_poly.nstd_linkage NO _entity_poly.nstd_monomer NO _entity_poly.pdbx_seq_one_letter_code SKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS _entity_poly.pdbx_seq_one_letter_code_can SKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS _entity_poly.pdbx_sequence_evidence_code . _entity_poly.pdbx_strand_id A,B _entity_poly.type polypeptide(L) # loop_ _entity_poly_seq.entity_id _entity_poly_seq.hetero _entity_poly_seq.mon_id _entity_poly_seq.num 1 . SER 1 1 . LYS 2 1 . TYR 3 1 . ALA 4 1 . GLU 5 1 . LEU 6 1 . LEU 7 1 . ALA 8 1 . ILE 9 1 . ILE 10 1 . GLU 11 1 . GLU 12 1 . LEU 13 1 . GLY 14 1 . LYS 15 1 . GLU 16 1 . ILE 17 1 . ARG 18 1 . PRO 19 1 . THR 20 1 . TYR 21 1 . ALA 22 1 . GLY 23 1 . SER 24 1 . LYS 25 1 . SER 26 1 . ALA 27 1 . MET 28 1 . GLU 29 1 . ARG 30 1 . LEU 31 1 . LYS 32 1 . ARG 33 1 . GLY 34 1 . ILE 35 1 . ILE 36 1 . HIS 37 1 . ALA 38 1 . ARG 39 1 . GLY 40 1 . LEU 41 1 . VAL 42 1 . ARG 43 1 . GLU 44 1 . CYS 45 1 . LEU 46 1 . ALA 47 1 . GLU 48 1 . THR 49 1 . GLU 50 1 . ARG 51 1 . ASN 52 1 . ALA 53 1 . ARG 54 1 . SER 55 # _ihm_dataset_group.application modeling _ihm_dataset_group.details . _ihm_dataset_group.id 1 _ihm_dataset_group.name . # _ihm_dataset_group_link.dataset_list_id 1 _ihm_dataset_group_link.group_id 1 # _ihm_dataset_list.data_type "NMR data" _ihm_dataset_list.database_hosted YES _ihm_dataset_list.details "NOESY peak list C13 aliphatic and N15, and chemical shift assignments" _ihm_dataset_list.id 1 # _ihm_dataset_related_db_reference.accession_code 16808 _ihm_dataset_related_db_reference.dataset_list_id 1 _ihm_dataset_related_db_reference.db_name BMRB _ihm_dataset_related_db_reference.details "NMR data" _ihm_dataset_related_db_reference.id 1 _ihm_dataset_related_db_reference.version . # _ihm_entity_poly_segment.comp_id_begin SER _ihm_entity_poly_segment.comp_id_end SER _ihm_entity_poly_segment.entity_id 1 _ihm_entity_poly_segment.id 1 _ihm_entity_poly_segment.seq_id_begin 1 _ihm_entity_poly_segment.seq_id_end 55 # loop_ _ihm_model_group.details _ihm_model_group.id _ihm_model_group.name . 1 "State 1" . 2 "State 2" # loop_ _ihm_model_group_link.group_id _ihm_model_group_link.model_id 1 1 1 2 1 3 1 4 1 5 2 6 2 7 2 8 2 9 2 10 # loop_ _ihm_model_list.assembly_id _ihm_model_list.model_id _ihm_model_list.model_name _ihm_model_list.protocol_id _ihm_model_list.representation_id 1 1 "State 1 Model 1" 1 1 1 2 "State 1 Model 2" 1 1 1 3 "State 1 Model 3" 1 1 1 4 "State 1 Model 4" 1 1 1 5 "State 1 Model 5" 1 1 1 6 "State 2 Model 1" 1 1 1 7 "State 2 Model 2" 1 1 1 8 "State 2 Model 3" 1 1 1 9 "State 2 Model 4" 1 1 1 10 "State 2 Model 5" 1 1 # _ihm_model_representation.details "No starting models were used" _ihm_model_representation.id 1 _ihm_model_representation.name . # loop_ _ihm_model_representation_details.description _ihm_model_representation_details.entity_asym_id _ihm_model_representation_details.entity_description _ihm_model_representation_details.entity_id _ihm_model_representation_details.entity_poly_segment_id _ihm_model_representation_details.id _ihm_model_representation_details.model_granularity _ihm_model_representation_details.model_mode _ihm_model_representation_details.model_object_count _ihm_model_representation_details.model_object_primitive _ihm_model_representation_details.representation_id _ihm_model_representation_details.starting_model_id . A "Cyclin-dependent kinase 2-associated protein 1" 1 1 1 by-atom flexible . atomistic 1 . . B "Cyclin-dependent kinase 2-associated protein 1" 1 1 2 by-atom flexible . atomistic 1 . # loop_ _ihm_model_representative.id _ihm_model_representative.model_group_id _ihm_model_representative.model_id _ihm_model_representative.selection_criteria 1 1 1 "best scoring model" 2 1 2 "other selction criteria" 3 2 6 "best scoring model" # loop_ _ihm_modeling_post_process.analysis_id _ihm_modeling_post_process.dataset_group_id _ihm_modeling_post_process.details _ihm_modeling_post_process.feature _ihm_modeling_post_process.feature_name _ihm_modeling_post_process.id _ihm_modeling_post_process.num_models_begin _ihm_modeling_post_process.num_models_end _ihm_modeling_post_process.protocol_id _ihm_modeling_post_process.script_file_id _ihm_modeling_post_process.software_id _ihm_modeling_post_process.step_id _ihm_modeling_post_process.struct_assembly_id _ihm_modeling_post_process.type 1 1 "PSVS runs a suite of knowledge-based software tools including ProCheck (ver 3.5.4) and MolProbity (mage ver 6.35.040409)" energy/score PSVS 1 . . 2 . 1 3 1 validation 1 1 "RPF server was used to compute RPF-DP scores (a set of fast and sensitive structure quality assessment measures used to evaluate how well a 3D structure model fits with NOESY peak and resonance assignment lists, and hence to assess the accuracy of the structure)." other RPF 2 . . 2 . 3 1 1 validation 1 1 "NMR NOESY Double Recall analysis: This method compares two ensembles of conformers, A and B, and identifies 3D 15N/13C-resolved NOESY peaks (from provided peak lists) explained by short 1H-1H distances present in one conformer ensemble (e.g. in the A ensemble) but not by the other (e.g. in the B ensemble)." other DoubleRecall 3 . . 2 . 6 2 1 validation 1 1 . other "Conformation Selection based on NOESY and RCI data" 4 . . 2 . 7 4 1 filter # loop_ _ihm_modeling_protocol.details _ihm_modeling_protocol.id _ihm_modeling_protocol.num_steps _ihm_modeling_protocol.protocol_name "AFsample modeling calculations were carried out using modified version of AlphaFold v2.2.0. AF2 was trained using the PDB database of 2018-04-30 and did not include any NMR structures in the training data. AFsample calculations, which use six different settings with network dropouts to create conformational heterogeneity, were carried out to generate ~6000 models" 1 2 modeling "Conformation Selection based on NOESY and RCI data" 2 1 AISAR # loop_ _ihm_modeling_protocol_details.dataset_group_id _ihm_modeling_protocol_details.description _ihm_modeling_protocol_details.ensemble_flag _ihm_modeling_protocol_details.id _ihm_modeling_protocol_details.multi_scale_flag _ihm_modeling_protocol_details.multi_state_flag _ihm_modeling_protocol_details.num_models_begin _ihm_modeling_protocol_details.num_models_end _ihm_modeling_protocol_details.ordered_flag _ihm_modeling_protocol_details.protocol_id _ihm_modeling_protocol_details.script_file_id _ihm_modeling_protocol_details.software_id _ihm_modeling_protocol_details.step_id _ihm_modeling_protocol_details.step_method _ihm_modeling_protocol_details.step_name _ihm_modeling_protocol_details.struct_assembly_description _ihm_modeling_protocol_details.struct_assembly_id 1 "AFsample modeling calculations were carried out using modified version of AlphaFold v2.2.0. AFsample calculations, which use six different settings with network dropouts to create conformational heterogeneity, were carried out to generate ~6000 models" YES 1 NO YES . 6000 NO 1 . 5 2 . modeling . 1 1 "A modified version of AlphaFold v2.2.0 used by AFsample. AF2 was trained using the PDB database of 2018-04-30 and did not include any NMR structures in the training data. " YES 2 NO YES . . NO 1 . 4 1 . modeling . 1 # loop_ _ihm_multi_state_model_group_link.model_group_id _ihm_multi_state_model_group_link.state_id 1 1 2 2 # loop_ _ihm_multi_state_modeling.details _ihm_multi_state_modeling.experiment_type _ihm_multi_state_modeling.population_fraction _ihm_multi_state_modeling.population_fraction_sd _ihm_multi_state_modeling.state_group_id _ihm_multi_state_modeling.state_id _ihm_multi_state_modeling.state_name _ihm_multi_state_modeling.state_type . "Fraction of bulk" . . 1 1 "State 1" "conformational change" . "Fraction of bulk" . . 1 2 "State 2" "conformational change" # _ihm_struct_assembly.description "Integrative structure of Cyclin-dependent kinase 2-associated protein 1 determined using the conformational selection approach: generating a distribution of realistic protein conformational models using artificial intelligence-(AI-) based methods and then selecting the sets of conformers that best explain the experimental data" _ihm_struct_assembly.id 1 _ihm_struct_assembly.name "Cyclin-dependent kinase 2-associated protein 1" # loop_ _ihm_struct_assembly_details.assembly_id _ihm_struct_assembly_details.asym_id _ihm_struct_assembly_details.entity_description _ihm_struct_assembly_details.entity_id _ihm_struct_assembly_details.entity_poly_segment_id _ihm_struct_assembly_details.id _ihm_struct_assembly_details.parent_assembly_id 1 A "Cyclin-dependent kinase 2-associated protein 1" 1 1 1 1 1 B "Cyclin-dependent kinase 2-associated protein 1" 1 1 2 1 # loop_ _software.citation_id _software.classification _software.description _software.location _software.name _software.pdbx_ordinal _software.type _software.version 3 Validation . https://montelionelab.chem.rpi.edu/PSVS/PSVS2/ "Protein Structure Validation Software" 1 program 2.0 6 Other . https://www.randomcoilindex.ca/cgi-bin/rci_cgi_current.py RCI 2 program . 2 Validation . https://montelionelab.chem.rpi.edu/rpf/ "RPF " 3 program "ASDP ver 1.0" 4 "Model Building" . https://github.com/google-deepmind/alphafold AlphaFold2 4 package 2.2.0 5 "Enhanced Sampling" . https://github.com/bjornwallner/alphafoldv2.2.0 AFsample 5 package . 1 Validation . https://github.rpi.edu/RPIBioinformatics/AlphaFold-NMR DoubleRecall 6 program 1.0 1 "Model Selection" . https://github.com/MontelioneLab/AISAR AISAR 7 package 1.0 # _struct.entry_id 9A8Z _struct.pdbx_CASP_flag . _struct.pdbx_descriptor . _struct.pdbx_details . _struct.pdbx_model_details . _struct.pdbx_model_type_details . _struct.pdbx_structure_determination_methodology integrative _struct.title "Integrative structure of Cyclin-dependent kinase 2-associated protein 1 inter-chain and intra-chain sulfur-pi states from NMR data" # loop_ _struct_asym.details _struct_asym.entity_id _struct_asym.id _struct_asym.pdbx_PDB_id _struct_asym.pdbx_alt_id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.pdbx_order _struct_asym.pdbx_type . 1 A . . . . . . . 1 B . . . . . . # _struct_ref.db_code CDKA1_HUMAN _struct_ref.db_name UNP _struct_ref.details . _struct_ref.entity_id 1 _struct_ref.id 1 _struct_ref.pdbx_align_begin 61 _struct_ref.pdbx_align_end . _struct_ref.pdbx_db_accession O14519 _struct_ref.pdbx_db_isoform . _struct_ref.pdbx_seq_one_letter_code . # _struct_ref_seq.align_id 1 _struct_ref_seq.db_align_beg 61 _struct_ref_seq.db_align_end 115 _struct_ref_seq.ref_id 1 _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.seq_align_end 55 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code A 1 1 SER 61 61 SER SER A . A 1 2 LYS 62 62 LYS LYS A . A 1 3 TYR 63 63 TYR TYR A . A 1 4 ALA 64 64 ALA ALA A . A 1 5 GLU 65 65 GLU GLU A . A 1 6 LEU 66 66 LEU LEU A . A 1 7 LEU 67 67 LEU LEU A . A 1 8 ALA 68 68 ALA ALA A . A 1 9 ILE 69 69 ILE ILE A . A 1 10 ILE 70 70 ILE ILE A . A 1 11 GLU 71 71 GLU GLU A . A 1 12 GLU 72 72 GLU GLU A . A 1 13 LEU 73 73 LEU LEU A . A 1 14 GLY 74 74 GLY GLY A . A 1 15 LYS 75 75 LYS LYS A . A 1 16 GLU 76 76 GLU GLU A . A 1 17 ILE 77 77 ILE ILE A . A 1 18 ARG 78 78 ARG ARG A . A 1 19 PRO 79 79 PRO PRO A . A 1 20 THR 80 80 THR THR A . A 1 21 TYR 81 81 TYR TYR A . A 1 22 ALA 82 82 ALA ALA A . A 1 23 GLY 83 83 GLY GLY A . A 1 24 SER 84 84 SER SER A . A 1 25 LYS 85 85 LYS LYS A . A 1 26 SER 86 86 SER SER A . A 1 27 ALA 87 87 ALA ALA A . A 1 28 MET 88 88 MET MET A . A 1 29 GLU 89 89 GLU GLU A . A 1 30 ARG 90 90 ARG ARG A . A 1 31 LEU 91 91 LEU LEU A . A 1 32 LYS 92 92 LYS LYS A . A 1 33 ARG 93 93 ARG ARG A . A 1 34 GLY 94 94 GLY GLY A . A 1 35 ILE 95 95 ILE ILE A . A 1 36 ILE 96 96 ILE ILE A . A 1 37 HIS 97 97 HIS HIS A . A 1 38 ALA 98 98 ALA ALA A . A 1 39 ARG 99 99 ARG ARG A . A 1 40 GLY 100 100 GLY GLY A . A 1 41 LEU 101 101 LEU LEU A . A 1 42 VAL 102 102 VAL VAL A . A 1 43 ARG 103 103 ARG ARG A . A 1 44 GLU 104 104 GLU GLU A . A 1 45 CYS 105 105 CYS CYS A . A 1 46 LEU 106 106 LEU LEU A . A 1 47 ALA 107 107 ALA ALA A . A 1 48 GLU 108 108 GLU GLU A . A 1 49 THR 109 109 THR THR A . A 1 50 GLU 110 110 GLU GLU A . A 1 51 ARG 111 111 ARG ARG A . A 1 52 ASN 112 112 ASN ASN A . A 1 53 ALA 113 113 ALA ALA A . A 1 54 ARG 114 114 ARG ARG A . A 1 55 SER 115 115 SER SER A . B 1 1 SER 61 61 SER SER B . B 1 2 LYS 62 62 LYS LYS B . B 1 3 TYR 63 63 TYR TYR B . B 1 4 ALA 64 64 ALA ALA B . B 1 5 GLU 65 65 GLU GLU B . B 1 6 LEU 66 66 LEU LEU B . B 1 7 LEU 67 67 LEU LEU B . B 1 8 ALA 68 68 ALA ALA B . B 1 9 ILE 69 69 ILE ILE B . B 1 10 ILE 70 70 ILE ILE B . B 1 11 GLU 71 71 GLU GLU B . B 1 12 GLU 72 72 GLU GLU B . B 1 13 LEU 73 73 LEU LEU B . B 1 14 GLY 74 74 GLY GLY B . B 1 15 LYS 75 75 LYS LYS B . B 1 16 GLU 76 76 GLU GLU B . B 1 17 ILE 77 77 ILE ILE B . B 1 18 ARG 78 78 ARG ARG B . B 1 19 PRO 79 79 PRO PRO B . B 1 20 THR 80 80 THR THR B . B 1 21 TYR 81 81 TYR TYR B . B 1 22 ALA 82 82 ALA ALA B . B 1 23 GLY 83 83 GLY GLY B . B 1 24 SER 84 84 SER SER B . B 1 25 LYS 85 85 LYS LYS B . B 1 26 SER 86 86 SER SER B . B 1 27 ALA 87 87 ALA ALA B . B 1 28 MET 88 88 MET MET B . B 1 29 GLU 89 89 GLU GLU B . B 1 30 ARG 90 90 ARG ARG B . B 1 31 LEU 91 91 LEU LEU B . B 1 32 LYS 92 92 LYS LYS B . B 1 33 ARG 93 93 ARG ARG B . B 1 34 GLY 94 94 GLY GLY B . B 1 35 ILE 95 95 ILE ILE B . B 1 36 ILE 96 96 ILE ILE B . B 1 37 HIS 97 97 HIS HIS B . B 1 38 ALA 98 98 ALA ALA B . B 1 39 ARG 99 99 ARG ARG B . B 1 40 GLY 100 100 GLY GLY B . B 1 41 LEU 101 101 LEU LEU B . B 1 42 VAL 102 102 VAL VAL B . B 1 43 ARG 103 103 ARG ARG B . B 1 44 GLU 104 104 GLU GLU B . B 1 45 CYS 105 105 CYS CYS B . B 1 46 LEU 106 106 LEU LEU B . B 1 47 ALA 107 107 ALA ALA B . B 1 48 GLU 108 108 GLU GLU B . B 1 49 THR 109 109 THR THR B . B 1 50 GLU 110 110 GLU GLU B . B 1 51 ARG 111 111 ARG ARG B . B 1 52 ASN 112 112 ASN ASN B . B 1 53 ALA 113 113 ALA ALA B . B 1 54 ARG 114 114 ARG ARG B . B 1 55 SER 115 115 SER SER B . # # loop_ # #