data_9A9U # _entry.id 9A9U # loop_ _atom_type.symbol C H N O # loop_ _audit_author.name _audit_author.pdbx_ordinal "Nagy, T.M." 1 "Jonsson, M." 2 "Hober, S." 3 "Wolf-Watz, M." 4 # loop_ _audit_conform.dict_location _audit_conform.dict_name _audit_conform.dict_version https://mmcif.wwpdb.org/dictionaries/ascii/mmcif_ihm_ext.dic mmcif_ihm_ext.dic 1.28 http://mmcif.wwpdb.org/dictionaries/ascii/mmcif_pdbx_v50.dic mmcif_pdbx.dic 5.403 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 9A9U _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2025-04-17 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2026-04-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9A9U pdb_00009a9u 10.2210/pdb9a9u/pdb # loop_ _chem_comp.formula _chem_comp.formula_weight _chem_comp.id _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.type "C3 H7 N O2" 89.094 ALA . ALANINE . "L-peptide linking" "C4 H8 N2 O3" 132.119 ASN . ASPARAGINE . "L-peptide linking" "C4 H7 N O4" 133.103 ASP . "ASPARTIC ACID" . "L-peptide linking" "C5 H10 N2 O3" 146.146 GLN . GLUTAMINE . "L-peptide linking" "C5 H9 N O4" 147.13 GLU . "GLUTAMIC ACID" . "L-peptide linking" "C2 H5 N O2" 75.067 GLY . GLYCINE . "peptide linking" "C6 H13 N O2" 131.175 ILE . ISOLEUCINE . "L-peptide linking" "C6 H13 N O2" 131.175 LEU . LEUCINE . "L-peptide linking" "C6 H15 N2 O2 1" 147.198 LYS . LYSINE . "L-peptide linking" "C9 H11 N O2" 165.192 PHE . PHENYLALANINE . "L-peptide linking" "C5 H9 N O2" 115.132 PRO . PROLINE . "L-peptide linking" "C4 H9 N O3" 119.12 THR . THREONINE . "L-peptide linking" "C11 H12 N2 O2" 204.229 TRP . TRYPTOPHAN . "L-peptide linking" "C9 H11 N O3" 181.191 TYR . TYROSINE . "L-peptide linking" "C5 H11 N O2" 117.148 VAL . VALINE . "L-peptide linking" # _citation.country . _citation.id 1 _citation.journal_abbrev "Sep Purif Technol" _citation.journal_id_ASTM . _citation.journal_id_CSD . _citation.journal_id_ISSN . _citation.journal_issue . _citation.journal_volume . _citation.page_first . _citation.page_last . _citation.pdbx_database_id_DOI 10.1016/j.seppur.2026.138115 _citation.pdbx_database_id_PubMed . _citation.title "Calcium as a molecular switch: Gentle antibody-purification through directed evolution of Protein G" _citation.year 2026 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal 1 "Jonsson, M." 1 1 "Hamnqvist, D." 2 1 "Dieminger, N." 3 1 "Nagy, T.M." 4 1 "Friberg, O." 5 1 "Wolf-Watz, M." 6 1 "Hober, S." 7 # _entity.details . _entity.formula_weight 8339.744 _entity.id 1 _entity.pdbx_description "Immunoglobulin G-binding protein G" _entity.pdbx_number_of_molecules 1 _entity.src_method MAN _entity.type POLYMER # _entity_poly.entity_id 1 _entity_poly.nstd_chirality . _entity_poly.nstd_linkage NO _entity_poly.nstd_monomer NO _entity_poly.pdbx_seq_one_letter_code TTYKLVINGKTLKGETTTEPPDVNNDGFIDFEDAEKVFKQYANDNGVDGEWTYDDATKTFTVTE _entity_poly.pdbx_seq_one_letter_code_can TTYKLVINGKTLKGETTTEPPDVNNDGFIDFEDAEKVFKQYANDNGVDGEWTYDDATKTFTVTE _entity_poly.pdbx_sequence_evidence_code . _entity_poly.pdbx_strand_id A _entity_poly.type polypeptide(L) # loop_ _entity_poly_seq.entity_id _entity_poly_seq.hetero _entity_poly_seq.mon_id _entity_poly_seq.num 1 . THR 1 1 . THR 2 1 . TYR 3 1 . LYS 4 1 . LEU 5 1 . VAL 6 1 . ILE 7 1 . ASN 8 1 . GLY 9 1 . LYS 10 1 . THR 11 1 . LEU 12 1 . LYS 13 1 . GLY 14 1 . GLU 15 1 . THR 16 1 . THR 17 1 . THR 18 1 . GLU 19 1 . PRO 20 1 . PRO 21 1 . ASP 22 1 . VAL 23 1 . ASN 24 1 . ASN 25 1 . ASP 26 1 . GLY 27 1 . PHE 28 1 . ILE 29 1 . ASP 30 1 . PHE 31 1 . GLU 32 1 . ASP 33 1 . ALA 34 1 . GLU 35 1 . LYS 36 1 . VAL 37 1 . PHE 38 1 . LYS 39 1 . GLN 40 1 . TYR 41 1 . ALA 42 1 . ASN 43 1 . ASP 44 1 . ASN 45 1 . GLY 46 1 . VAL 47 1 . ASP 48 1 . GLY 49 1 . GLU 50 1 . TRP 51 1 . THR 52 1 . TYR 53 1 . ASP 54 1 . ASP 55 1 . ALA 56 1 . THR 57 1 . LYS 58 1 . THR 59 1 . PHE 60 1 . THR 61 1 . VAL 62 1 . THR 63 1 . GLU 64 # _ihm_dataset_group.application modeling _ihm_dataset_group.details . _ihm_dataset_group.id 1 _ihm_dataset_group.name . # _ihm_dataset_group_link.dataset_list_id 1 _ihm_dataset_group_link.group_id 1 # _ihm_dataset_list.data_type "NMR data" _ihm_dataset_list.database_hosted YES _ihm_dataset_list.details BMRB _ihm_dataset_list.id 1 # _ihm_dataset_related_db_reference.accession_code 53011 _ihm_dataset_related_db_reference.dataset_list_id 1 _ihm_dataset_related_db_reference.db_name BMRB _ihm_dataset_related_db_reference.details . _ihm_dataset_related_db_reference.id 1 _ihm_dataset_related_db_reference.version . # _ihm_entity_poly_segment.comp_id_begin THR _ihm_entity_poly_segment.comp_id_end GLU _ihm_entity_poly_segment.entity_id 1 _ihm_entity_poly_segment.id 1 _ihm_entity_poly_segment.seq_id_begin 1 _ihm_entity_poly_segment.seq_id_end 64 # _ihm_model_group.details . _ihm_model_group.id 1 _ihm_model_group.name . # loop_ _ihm_model_group_link.group_id _ihm_model_group_link.model_id 1 1 1 2 1 3 1 4 1 5 1 6 1 7 1 8 1 9 1 10 # loop_ _ihm_model_list.assembly_id _ihm_model_list.model_id _ihm_model_list.model_name _ihm_model_list.protocol_id _ihm_model_list.representation_id 1 1 . 1 1 1 2 . 1 1 1 3 . 1 1 1 4 . 1 1 1 5 . 1 1 1 6 . 1 1 1 7 . 1 1 1 8 . 1 1 1 9 . 1 1 1 10 . 1 1 # _ihm_model_representation.details "No starting models were used" _ihm_model_representation.id 1 _ihm_model_representation.name . # _ihm_model_representation_details.description . _ihm_model_representation_details.entity_asym_id A _ihm_model_representation_details.entity_description "Immunoglobulin G-binding protein G" _ihm_model_representation_details.entity_id 1 _ihm_model_representation_details.entity_poly_segment_id 1 _ihm_model_representation_details.id 1 _ihm_model_representation_details.model_granularity by-atom _ihm_model_representation_details.model_mode flexible _ihm_model_representation_details.model_object_count . _ihm_model_representation_details.model_object_primitive atomistic _ihm_model_representation_details.representation_id 1 _ihm_model_representation_details.starting_model_id . # _ihm_modeling_protocol.details . _ihm_modeling_protocol.id 1 _ihm_modeling_protocol.num_steps 4 _ihm_modeling_protocol.protocol_name modeling # loop_ _ihm_modeling_protocol_details.dataset_group_id _ihm_modeling_protocol_details.description _ihm_modeling_protocol_details.ensemble_flag _ihm_modeling_protocol_details.id _ihm_modeling_protocol_details.multi_scale_flag _ihm_modeling_protocol_details.multi_state_flag _ihm_modeling_protocol_details.num_models_begin _ihm_modeling_protocol_details.num_models_end _ihm_modeling_protocol_details.ordered_flag _ihm_modeling_protocol_details.protocol_id _ihm_modeling_protocol_details.script_file_id _ihm_modeling_protocol_details.software_id _ihm_modeling_protocol_details.step_id _ihm_modeling_protocol_details.step_method _ihm_modeling_protocol_details.step_name _ihm_modeling_protocol_details.struct_assembly_description _ihm_modeling_protocol_details.struct_assembly_id 1 "Phi/psi torsion predictions from shifts using TALOS" YES 1 NO NO . . NO 1 . . 1 TALOS "Secondary Structure and Torsion Prediction" . 1 1 "Rosetta fragment picker generates fragment libraries" YES 2 NO NO . . NO 1 . 1 2 "Rosetta fragment picker" "Fragment Library Generation" . 1 1 "Rosetta AbinitioRelax generates thousands of candidate structures" YES 3 NO NO . . NO 1 . 1 3 "Rosetta AbinitioRelax" "Abinitio Structure Modeling" . 1 1 "Clustering and Scoring" YES 4 NO NO . . NO 1 . . 4 "Rosetta Energy Score" "Clustering and Scoring" . 1 # _ihm_struct_assembly.description "Streptococcal Protein G antibody-binding domain C2 - variant C2Ca EP7-G35E modeled using CS-Rosetta, guided by its experimentally determined chemical shift values" _ihm_struct_assembly.id 1 _ihm_struct_assembly.name "Streptococcal Protein G antibody-binding domain C2 - variant C2Ca EP7-G35E" # _ihm_struct_assembly_details.assembly_id 1 _ihm_struct_assembly_details.asym_id A _ihm_struct_assembly_details.entity_description "Immunoglobulin G-binding protein G" _ihm_struct_assembly_details.entity_id 1 _ihm_struct_assembly_details.entity_poly_segment_id 1 _ihm_struct_assembly_details.id 1 _ihm_struct_assembly_details.parent_assembly_id 1 # _software.citation_id . _software.classification "model building" _software.description "Restraint generation, structure calculation" _software.location https://www.rosettacommons.org/docs/latest/CS-Rosetta _software.name CS-ROSETTA _software.pdbx_ordinal 1 _software.type program _software.version . # _struct.entry_id 9A9U _struct.pdbx_CASP_flag . _struct.pdbx_descriptor . _struct.pdbx_details . _struct.pdbx_model_details . _struct.pdbx_model_type_details . _struct.pdbx_structure_determination_methodology integrative _struct.title "Streptococcal Protein G antibody-binding domain C2 - variant C2Ca EP7-G35E" # _struct_asym.details . _struct_asym.entity_id 1 _struct_asym.id A _struct_asym.pdbx_PDB_id . _struct_asym.pdbx_alt_id . _struct_asym.pdbx_blank_PDB_chainid_flag . _struct_asym.pdbx_modified . _struct_asym.pdbx_order . _struct_asym.pdbx_type . # _struct_ref.db_code SPG2_STRSG _struct_ref.db_name UNP _struct_ref.details . _struct_ref.entity_id 1 _struct_ref.id 1 _struct_ref.pdbx_align_begin 372 _struct_ref.pdbx_align_end . _struct_ref.pdbx_db_accession P19909 _struct_ref.pdbx_db_isoform . _struct_ref.pdbx_seq_one_letter_code . # _struct_ref_seq.align_id 1 _struct_ref_seq.db_align_beg 372 _struct_ref_seq.db_align_end 427 _struct_ref_seq.ref_id 1 _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.seq_align_end 64 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code A 1 1 THR 1 1 THR THR A . A 1 2 THR 2 2 THR THR A . A 1 3 TYR 3 3 TYR TYR A . A 1 4 LYS 4 4 LYS LYS A . A 1 5 LEU 5 5 LEU LEU A . A 1 6 VAL 6 6 VAL VAL A . A 1 7 ILE 7 7 ILE ILE A . A 1 8 ASN 8 8 ASN ASN A . A 1 9 GLY 9 9 GLY GLY A . A 1 10 LYS 10 10 LYS LYS A . A 1 11 THR 11 11 THR THR A . A 1 12 LEU 12 12 LEU LEU A . A 1 13 LYS 13 13 LYS LYS A . A 1 14 GLY 14 14 GLY GLY A . A 1 15 GLU 15 15 GLU GLU A . A 1 16 THR 16 16 THR THR A . A 1 17 THR 17 17 THR THR A . A 1 18 THR 18 18 THR THR A . A 1 19 GLU 19 19 GLU GLU A . A 1 20 PRO 20 20 PRO PRO A . A 1 21 PRO 21 21 PRO PRO A . A 1 22 ASP 22 22 ASP ASP A . A 1 23 VAL 23 23 VAL VAL A . A 1 24 ASN 24 24 ASN ASN A . A 1 25 ASN 25 25 ASN ASN A . A 1 26 ASP 26 26 ASP ASP A . A 1 27 GLY 27 27 GLY GLY A . A 1 28 PHE 28 28 PHE PHE A . A 1 29 ILE 29 29 ILE ILE A . A 1 30 ASP 30 30 ASP ASP A . A 1 31 PHE 31 31 PHE PHE A . A 1 32 GLU 32 32 GLU GLU A . A 1 33 ASP 33 33 ASP ASP A . A 1 34 ALA 34 34 ALA ALA A . A 1 35 GLU 35 35 GLU GLU A . A 1 36 LYS 36 36 LYS LYS A . A 1 37 VAL 37 37 VAL VAL A . A 1 38 PHE 38 38 PHE PHE A . A 1 39 LYS 39 39 LYS LYS A . A 1 40 GLN 40 40 GLN GLN A . A 1 41 TYR 41 41 TYR TYR A . A 1 42 ALA 42 42 ALA ALA A . A 1 43 ASN 43 43 ASN ASN A . A 1 44 ASP 44 44 ASP ASP A . A 1 45 ASN 45 45 ASN ASN A . A 1 46 GLY 46 46 GLY GLY A . A 1 47 VAL 47 47 VAL VAL A . A 1 48 ASP 48 48 ASP ASP A . A 1 49 GLY 49 49 GLY GLY A . A 1 50 GLU 50 50 GLU GLU A . A 1 51 TRP 51 51 TRP TRP A . A 1 52 THR 52 52 THR THR A . A 1 53 TYR 53 53 TYR TYR A . A 1 54 ASP 54 54 ASP ASP A . A 1 55 ASP 55 55 ASP ASP A . A 1 56 ALA 56 56 ALA ALA A . A 1 57 THR 57 57 THR THR A . A 1 58 LYS 58 58 LYS LYS A . A 1 59 THR 59 59 THR THR A . A 1 60 PHE 60 60 PHE PHE A . A 1 61 THR 61 61 THR THR A . A 1 62 VAL 62 62 VAL VAL A . A 1 63 THR 63 63 THR THR A . A 1 64 GLU 64 64 GLU GLU A . # # loop_ # #