data_9AA8 # _entry.id 9AA8 # loop_ _atom_type.symbol C H N O P S # loop_ _audit_author.name _audit_author.pdbx_ordinal "Kabra, A." 1 "Bushweller, J.H." 2 # loop_ _audit_conform.dict_location _audit_conform.dict_name _audit_conform.dict_version https://mmcif.wwpdb.org/dictionaries/ascii/mmcif_ihm_ext.dic mmcif_ihm_ext.dic 1.28 http://mmcif.wwpdb.org/dictionaries/ascii/mmcif_pdbx_v50.dic mmcif_pdbx.dic 5.403 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 9AA8 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2025-09-30 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2026-07-01 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9AA8 pdb_00009aa8 10.2210/pdb9aa8/pdb # loop_ _chem_comp.formula _chem_comp.formula_weight _chem_comp.id _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.type "C10 H14 N5 O7 P" 347.224 A . "ADENOSINE-5'-MONOPHOSPHATE" . "RNA linking" "C3 H7 N O2" 89.094 ALA . ALANINE . "L-peptide linking" "C6 H15 N4 O2 1" 175.212 ARG . ARGININE . "L-peptide linking" "C4 H8 N2 O3" 132.119 ASN . ASPARAGINE . "L-peptide linking" "C4 H7 N O4" 133.103 ASP . "ASPARTIC ACID" . "L-peptide linking" "C9 H14 N3 O8 P" 323.198 C . "CYTIDINE-5'-MONOPHOSPHATE" . "RNA linking" "C3 H7 N O2 S" 121.154 CYS . CYSTEINE . "L-peptide linking" "C10 H14 N5 O8 P" 363.223 G . "GUANOSINE-5'-MONOPHOSPHATE" . "RNA linking" "C5 H10 N2 O3" 146.146 GLN . GLUTAMINE . "L-peptide linking" "C5 H9 N O4" 147.13 GLU . "GLUTAMIC ACID" . "L-peptide linking" "C2 H5 N O2" 75.067 GLY . GLYCINE . "peptide linking" "C6 H10 N3 O2 1" 156.165 HIS . HISTIDINE . "L-peptide linking" "C6 H13 N O2" 131.175 ILE . ISOLEUCINE . "L-peptide linking" "C6 H13 N O2" 131.175 LEU . LEUCINE . "L-peptide linking" "C6 H15 N2 O2 1" 147.198 LYS . LYSINE . "L-peptide linking" "C5 H11 N O2 S" 149.208 MET . METHIONINE . "L-peptide linking" "C9 H11 N O2" 165.192 PHE . PHENYLALANINE . "L-peptide linking" "C5 H9 N O2" 115.132 PRO . PROLINE . "L-peptide linking" "C3 H7 N O3" 105.093 SER . SERINE . "L-peptide linking" "C4 H9 N O3" 119.12 THR . THREONINE . "L-peptide linking" "C11 H12 N2 O2" 204.229 TRP . TRYPTOPHAN . "L-peptide linking" "C9 H11 N O3" 181.191 TYR . TYROSINE . "L-peptide linking" "C9 H13 N2 O9 P" 324.182 U . "URIDINE-5'-MONOPHOSPHATE" . "RNA linking" "C5 H11 N O2" 117.148 VAL . VALINE . "L-peptide linking" # _citation.country . _citation.id 1 _citation.journal_abbrev "Cell Rep" _citation.journal_id_ASTM . _citation.journal_id_CSD . _citation.journal_id_ISSN . _citation.journal_issue . _citation.journal_volume . _citation.page_first . _citation.page_last . _citation.pdbx_database_id_DOI 10.1016/j.celrep.2026.117540 _citation.pdbx_database_id_PubMed 42268713 _citation.title "The MLLT3 YEATS domain binds histone marks (H3K9/18/27ac/cr) and ncRNA (7SK), linking transcription and RNA signaling to regulate hematopoiesis" _citation.year 2026 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal 1 "Boulton, A." 1 1 "Kabra, A." 2 1 "Achille, N." 3 1 "Adelman, E.R." 4 1 "Anastasakis, D.G." 5 1 "Beckdorff, F." 6 1 "Cingaram, P.K.R." 7 1 "Roller, D.G." 8 1 "Zhang, Y." 9 1 "Leach, B." 10 1 "Gioeli, D." 11 1 "Shiekhattar, R." 12 1 "Yokoyama, A." 13 1 "Hafner, M." 14 1 "Figueroa, M." 15 1 "Zeleznik-Le, N." 16 1 "Bushweller, J.H." 17 # loop_ _entity.details _entity.formula_weight _entity.id _entity.pdbx_description _entity.pdbx_number_of_molecules _entity.src_method _entity.type . 19058.45 1 "Protein AF-9" 1 MAN POLYMER . 12515.524 2 "RNA (37-MER)" 1 SYN POLYMER # loop_ _entity_poly.entity_id _entity_poly.nstd_chirality _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_sequence_evidence_code _entity_poly.pdbx_strand_id _entity_poly.type 1 . NO NO SHMASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKA SHMASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKA . A polypeptide(L) 2 . NO NO AAAUGAGGCGCUGCAUGUGGCAGUCUGCCUUUCUUUU AAAUGAGGCGCUGCAUGUGGCAGUCUGCCUUUCUUUU . B polyribonucleotide # loop_ _entity_poly_seq.entity_id _entity_poly_seq.hetero _entity_poly_seq.mon_id _entity_poly_seq.num 1 . SER 1 1 . HIS 2 1 . MET 3 1 . ALA 4 1 . SER 5 1 . SER 6 1 . CYS 7 1 . ALA 8 1 . VAL 9 1 . GLN 10 1 . VAL 11 1 . LYS 12 1 . LEU 13 1 . GLU 14 1 . LEU 15 1 . GLY 16 1 . HIS 17 1 . ARG 18 1 . ALA 19 1 . GLN 20 1 . VAL 21 1 . ARG 22 1 . LYS 23 1 . LYS 24 1 . PRO 25 1 . THR 26 1 . VAL 27 1 . GLU 28 1 . GLY 29 1 . PHE 30 1 . THR 31 1 . HIS 32 1 . ASP 33 1 . TRP 34 1 . MET 35 1 . VAL 36 1 . PHE 37 1 . VAL 38 1 . ARG 39 1 . GLY 40 1 . PRO 41 1 . GLU 42 1 . HIS 43 1 . SER 44 1 . ASN 45 1 . ILE 46 1 . GLN 47 1 . HIS 48 1 . PHE 49 1 . VAL 50 1 . GLU 51 1 . LYS 52 1 . VAL 53 1 . VAL 54 1 . PHE 55 1 . HIS 56 1 . LEU 57 1 . HIS 58 1 . GLU 59 1 . SER 60 1 . PHE 61 1 . PRO 62 1 . ARG 63 1 . PRO 64 1 . LYS 65 1 . ARG 66 1 . VAL 67 1 . CYS 68 1 . LYS 69 1 . ASP 70 1 . PRO 71 1 . PRO 72 1 . TYR 73 1 . LYS 74 1 . VAL 75 1 . GLU 76 1 . GLU 77 1 . SER 78 1 . GLY 79 1 . TYR 80 1 . ALA 81 1 . GLY 82 1 . PHE 83 1 . ILE 84 1 . LEU 85 1 . PRO 86 1 . ILE 87 1 . GLU 88 1 . VAL 89 1 . TYR 90 1 . PHE 91 1 . LYS 92 1 . ASN 93 1 . LYS 94 1 . GLU 95 1 . GLU 96 1 . PRO 97 1 . ARG 98 1 . LYS 99 1 . VAL 100 1 . ARG 101 1 . PHE 102 1 . ASP 103 1 . TYR 104 1 . ASP 105 1 . LEU 106 1 . PHE 107 1 . LEU 108 1 . HIS 109 1 . LEU 110 1 . GLU 111 1 . GLY 112 1 . HIS 113 1 . PRO 114 1 . PRO 115 1 . VAL 116 1 . ASN 117 1 . HIS 118 1 . LEU 119 1 . ARG 120 1 . CYS 121 1 . GLU 122 1 . LYS 123 1 . LEU 124 1 . THR 125 1 . PHE 126 1 . ASN 127 1 . ASN 128 1 . PRO 129 1 . THR 130 1 . GLU 131 1 . ASP 132 1 . PHE 133 1 . ARG 134 1 . ARG 135 1 . LYS 136 1 . LEU 137 1 . LEU 138 1 . LYS 139 1 . ALA 140 2 . A 1 2 . A 2 2 . A 3 2 . U 4 2 . G 5 2 . A 6 2 . G 7 2 . G 8 2 . C 9 2 . G 10 2 . C 11 2 . U 12 2 . G 13 2 . C 14 2 . A 15 2 . U 16 2 . G 17 2 . U 18 2 . G 19 2 . G 20 2 . C 21 2 . A 22 2 . G 23 2 . U 24 2 . C 25 2 . U 26 2 . G 27 2 . C 28 2 . C 29 2 . U 30 2 . U 31 2 . U 32 2 . C 33 2 . U 34 2 . U 35 2 . U 36 2 . U 37 # _ihm_dataset_group.application modeling _ihm_dataset_group.details "Docking with predicted contacts" _ihm_dataset_group.id 1 _ihm_dataset_group.name "HADDOCK modeling" # loop_ _ihm_dataset_group_link.dataset_list_id _ihm_dataset_group_link.group_id 1 1 2 1 3 1 4 1 5 1 # loop_ _ihm_dataset_list.data_type _ihm_dataset_list.database_hosted _ihm_dataset_list.details _ihm_dataset_list.id "Experimental model" YES "MLLT3 YEATS domain (PDB ID: 5HJB)" 1 "Experimental model" YES "7SK_SL4 (PDB ID: 7SLP)" 2 "NMR data" NO "BMRB entry 53503" 3 "NMR data" YES "NMR chemical shift perturbation experiments obtained using chemical shift assignments from BMRB entry 53503" 4 Other NO "Photoactivatable-Ribonucleoside-Enhanced Cross linking and Immunoprecipitation (PAR-CLIP) data. 7SK_SL4 C324 was defined as active base for the interaction based on PAR-CLIP data." 5 # loop_ _ihm_dataset_related_db_reference.accession_code _ihm_dataset_related_db_reference.dataset_list_id _ihm_dataset_related_db_reference.db_name _ihm_dataset_related_db_reference.details _ihm_dataset_related_db_reference.id _ihm_dataset_related_db_reference.version 5HJB 1 PDB . 1 . 7SLP 2 PDB . 2 . 53503 4 BMRB . 3 . # loop_ _ihm_entity_poly_segment.comp_id_begin _ihm_entity_poly_segment.comp_id_end _ihm_entity_poly_segment.entity_id _ihm_entity_poly_segment.id _ihm_entity_poly_segment.seq_id_begin _ihm_entity_poly_segment.seq_id_end SER ALA 1 1 1 140 A U 2 2 1 37 # loop_ _ihm_feature_list.details _ihm_feature_list.entity_type _ihm_feature_list.feature_id _ihm_feature_list.feature_type . polymer 1 residue . polymer 2 residue . polymer 3 residue . polymer 4 residue . polymer 5 residue . polymer 6 residue # _ihm_model_group.details . _ihm_model_group.id 1 _ihm_model_group.name . # _ihm_model_group_link.group_id 1 _ihm_model_group_link.model_id 1 # _ihm_model_list.assembly_id 1 _ihm_model_list.model_id 1 _ihm_model_list.model_name . _ihm_model_list.protocol_id 1 _ihm_model_list.representation_id 1 # _ihm_model_representation.details . _ihm_model_representation.id 1 _ihm_model_representation.name . # loop_ _ihm_model_representation_details.description _ihm_model_representation_details.entity_asym_id _ihm_model_representation_details.entity_description _ihm_model_representation_details.entity_id _ihm_model_representation_details.entity_poly_segment_id _ihm_model_representation_details.id _ihm_model_representation_details.model_granularity _ihm_model_representation_details.model_mode _ihm_model_representation_details.model_object_count _ihm_model_representation_details.model_object_primitive _ihm_model_representation_details.representation_id _ihm_model_representation_details.starting_model_id . A "Protein AF-9" 1 1 1 by-atom flexible . atomistic 1 1 . B "RNA (37-MER)" 2 2 2 by-atom flexible . atomistic 1 2 # _ihm_modeling_protocol.details "Default parameters were used for DOCKING using HADDOCK webserver." _ihm_modeling_protocol.id 1 _ihm_modeling_protocol.num_steps 1 _ihm_modeling_protocol.protocol_name modeling # _ihm_modeling_protocol_details.dataset_group_id 1 _ihm_modeling_protocol_details.description "Initial PDBs (5HJB for MLLT3 with H3K9Cr and 7SLP for 7SK_SL4) were removed. Both PDBs were processed in such way that non-essential components (H3K9Cr peptide from 5HJB and 7sk core RNP from 7SLP) were submitted to HADDOCK webserver for docking using default parameters. Active residues were defined for both components. For MLLT3 : Residues H56, R61, K63, C66, K67 were defined as active residues from our NMR chemical shift perturbation (CSP) data. For 7SK_SL4: C324 was defined as active base for the interaction based on our Photoactivatable-Ribonucleoside-Enhanced Cross linking and Immunoprecipitation (PAR-CLIP) data. No other restraints used except the active residues." _ihm_modeling_protocol_details.ensemble_flag NO _ihm_modeling_protocol_details.id 1 _ihm_modeling_protocol_details.multi_scale_flag NO _ihm_modeling_protocol_details.multi_state_flag NO _ihm_modeling_protocol_details.num_models_begin . _ihm_modeling_protocol_details.num_models_end . _ihm_modeling_protocol_details.ordered_flag NO _ihm_modeling_protocol_details.protocol_id 1 _ihm_modeling_protocol_details.script_file_id . _ihm_modeling_protocol_details.software_id 1 _ihm_modeling_protocol_details.step_id 1 _ihm_modeling_protocol_details.step_method . _ihm_modeling_protocol_details.step_name . _ihm_modeling_protocol_details.struct_assembly_description . _ihm_modeling_protocol_details.struct_assembly_id 1 # loop_ _ihm_poly_residue_feature.asym_id _ihm_poly_residue_feature.comp_id_begin _ihm_poly_residue_feature.comp_id_end _ihm_poly_residue_feature.entity_id _ihm_poly_residue_feature.feature_id _ihm_poly_residue_feature.interface_residue_flag _ihm_poly_residue_feature.ordinal_id _ihm_poly_residue_feature.rep_atom _ihm_poly_residue_feature.residue_range_granularity _ihm_poly_residue_feature.seq_id_begin _ihm_poly_residue_feature.seq_id_end A HIS HIS 1 1 . 1 . . 58 58 A ARG ARG 1 2 . 2 . . 63 63 A LYS LYS 1 3 . 3 . . 65 65 A CYS CYS 1 4 . 4 . . 68 68 A LYS LYS 1 5 . 5 . . 69 69 B C C 2 6 . 6 . . 29 29 # _ihm_related_datasets.dataset_list_id_derived 4 _ihm_related_datasets.dataset_list_id_primary 3 _ihm_related_datasets.transformation_id . # loop_ _ihm_starting_model_details.asym_id _ihm_starting_model_details.dataset_list_id _ihm_starting_model_details.description _ihm_starting_model_details.entity_description _ihm_starting_model_details.entity_id _ihm_starting_model_details.entity_poly_segment_id _ihm_starting_model_details.starting_model_auth_asym_id _ihm_starting_model_details.starting_model_id _ihm_starting_model_details.starting_model_sequence_offset _ihm_starting_model_details.starting_model_source A 1 . "Protein AF-9" 1 1 A 1 0 "experimental model" B 2 . "RNA (37-MER)" 2 2 R 2 -44 "experimental model" # _ihm_struct_assembly.description "Integrative structure of MLLT3_YEATS domain with SL4 of 7SK nc-RNA modeled using HADDOCk webserver based on NMR chemical shift perturbation (CSP) and Photoactivatable-Ribonucleoside-Enhanced Cross linking and Immunoprecipitation (PAR-CLIP) data and starting models from the PDB (5HJB and 7SLP)." _ihm_struct_assembly.id 1 _ihm_struct_assembly.name "MLLT3_YEATS domain with SL4 of 7SK nc-RNA" # loop_ _ihm_struct_assembly_details.assembly_id _ihm_struct_assembly_details.asym_id _ihm_struct_assembly_details.entity_description _ihm_struct_assembly_details.entity_id _ihm_struct_assembly_details.entity_poly_segment_id _ihm_struct_assembly_details.id _ihm_struct_assembly_details.parent_assembly_id 1 A "Protein AF-9" 1 1 1 1 1 B "RNA (37-MER)" 2 2 2 1 # _software.citation_id . _software.classification docking _software.description . _software.location https://wenmr.science.uu.nl/haddock2.4/ _software.name HADDOCK _software.pdbx_ordinal 1 _software.type program _software.version . # _struct.entry_id 9AA8 _struct.pdbx_CASP_flag . _struct.pdbx_descriptor . _struct.pdbx_details . _struct.pdbx_model_details "This model was generated using HADDOCk webserver. Two individual PDBs (5HJB and 7SLP) were used. Non-essential entities were deleted from individual PDBs and processed before docking." _struct.pdbx_model_type_details . _struct.pdbx_structure_determination_methodology integrative _struct.title "MLLT3_YEATS domain with SL4 of 7SK nc-RNA" # loop_ _struct_asym.details _struct_asym.entity_id _struct_asym.id _struct_asym.pdbx_PDB_id _struct_asym.pdbx_alt_id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.pdbx_order _struct_asym.pdbx_type . 1 A . . . . . . . 2 B . . . . . . # loop_ _struct_ref.db_code _struct_ref.db_name _struct_ref.details _struct_ref.entity_id _struct_ref.id _struct_ref.pdbx_align_begin _struct_ref.pdbx_align_end _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.pdbx_seq_one_letter_code AF9_HUMAN UNP . 1 1 1 . P42568 . . 9AA8 PDB . 2 2 1 . 9AA8 . . # loop_ _struct_ref_seq.align_id _struct_ref_seq.db_align_beg _struct_ref_seq.db_align_end _struct_ref_seq.details _struct_ref_seq.ref_id _struct_ref_seq.seq_align_beg _struct_ref_seq.seq_align_end 1 1 138 . 1 3 140 2 1 37 . 2 1 37 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code A 1 1 SER -1 -1 SER SER A ? A 1 2 HIS 0 0 HIS HIS A ? A 1 3 MET 1 1 MET MET A ? A 1 4 ALA 2 2 ALA ALA A ? A 1 5 SER 3 3 SER SER A ? A 1 6 SER 4 4 SER SER A ? A 1 7 CYS 5 5 CYS CYS A ? A 1 8 ALA 6 6 ALA ALA A ? A 1 9 VAL 7 7 VAL VAL A ? A 1 10 GLN 8 8 GLN GLN A ? A 1 11 VAL 9 9 VAL VAL A ? A 1 12 LYS 10 10 LYS LYS A ? A 1 13 LEU 11 11 LEU LEU A ? A 1 14 GLU 12 12 GLU GLU A ? A 1 15 LEU 13 13 LEU LEU A ? A 1 16 GLY 14 14 GLY GLY A ? A 1 17 HIS 15 15 HIS HIS A ? A 1 18 ARG 16 16 ARG ARG A ? A 1 19 ALA 17 17 ALA ALA A ? A 1 20 GLN 18 18 GLN GLN A ? A 1 21 VAL 19 19 VAL VAL A ? A 1 22 ARG 20 20 ARG ARG A ? A 1 23 LYS 21 21 LYS LYS A ? A 1 24 LYS 22 22 LYS LYS A ? A 1 25 PRO 23 23 PRO PRO A ? A 1 26 THR 24 24 THR THR A ? A 1 27 VAL 25 25 VAL VAL A ? A 1 28 GLU 26 26 GLU GLU A ? A 1 29 GLY 27 27 GLY GLY A ? A 1 30 PHE 28 28 PHE PHE A ? A 1 31 THR 29 29 THR THR A ? A 1 32 HIS 30 30 HIS HIS A ? A 1 33 ASP 31 31 ASP ASP A ? A 1 34 TRP 32 32 TRP TRP A ? A 1 35 MET 33 33 MET MET A ? A 1 36 VAL 34 34 VAL VAL A ? A 1 37 PHE 35 35 PHE PHE A ? A 1 38 VAL 36 36 VAL VAL A ? A 1 39 ARG 37 37 ARG ARG A ? A 1 40 GLY 38 38 GLY GLY A ? A 1 41 PRO 39 39 PRO PRO A ? A 1 42 GLU 40 40 GLU GLU A ? A 1 43 HIS 41 41 HIS HIS A ? A 1 44 SER 42 42 SER SER A ? A 1 45 ASN 43 43 ASN ASN A ? A 1 46 ILE 44 44 ILE ILE A ? A 1 47 GLN 45 45 GLN GLN A ? A 1 48 HIS 46 46 HIS HIS A ? A 1 49 PHE 47 47 PHE PHE A ? A 1 50 VAL 48 48 VAL VAL A ? A 1 51 GLU 49 49 GLU GLU A ? A 1 52 LYS 50 50 LYS LYS A ? A 1 53 VAL 51 51 VAL VAL A ? A 1 54 VAL 52 52 VAL VAL A ? A 1 55 PHE 53 53 PHE PHE A ? A 1 56 HIS 54 54 HIS HIS A ? A 1 57 LEU 55 55 LEU LEU A ? A 1 58 HIS 56 56 HIS HIS A ? A 1 59 GLU 57 57 GLU GLU A ? A 1 60 SER 58 58 SER SER A ? A 1 61 PHE 59 59 PHE PHE A ? A 1 62 PRO 60 60 PRO PRO A ? A 1 63 ARG 61 61 ARG ARG A ? A 1 64 PRO 62 62 PRO PRO A ? A 1 65 LYS 63 63 LYS LYS A ? A 1 66 ARG 64 64 ARG ARG A ? A 1 67 VAL 65 65 VAL VAL A ? A 1 68 CYS 66 66 CYS CYS A ? A 1 69 LYS 67 67 LYS LYS A ? A 1 70 ASP 68 68 ASP ASP A ? A 1 71 PRO 69 69 PRO PRO A ? A 1 72 PRO 70 70 PRO PRO A ? A 1 73 TYR 71 71 TYR TYR A ? A 1 74 LYS 72 72 LYS LYS A ? A 1 75 VAL 73 73 VAL VAL A ? A 1 76 GLU 74 74 GLU GLU A ? A 1 77 GLU 75 75 GLU GLU A ? A 1 78 SER 76 76 SER SER A ? A 1 79 GLY 77 77 GLY GLY A ? A 1 80 TYR 78 78 TYR TYR A ? A 1 81 ALA 79 79 ALA ALA A ? A 1 82 GLY 80 80 GLY GLY A ? A 1 83 PHE 81 81 PHE PHE A ? A 1 84 ILE 82 82 ILE ILE A ? A 1 85 LEU 83 83 LEU LEU A ? A 1 86 PRO 84 84 PRO PRO A ? A 1 87 ILE 85 85 ILE ILE A ? A 1 88 GLU 86 86 GLU GLU A ? A 1 89 VAL 87 87 VAL VAL A ? A 1 90 TYR 88 88 TYR TYR A ? A 1 91 PHE 89 89 PHE PHE A ? A 1 92 LYS 90 90 LYS LYS A ? A 1 93 ASN 91 91 ASN ASN A ? A 1 94 LYS 92 92 LYS LYS A ? A 1 95 GLU 93 93 GLU GLU A ? A 1 96 GLU 94 94 GLU GLU A ? A 1 97 PRO 95 95 PRO PRO A ? A 1 98 ARG 96 96 ARG ARG A ? A 1 99 LYS 97 97 LYS LYS A ? A 1 100 VAL 98 98 VAL VAL A ? A 1 101 ARG 99 99 ARG ARG A ? A 1 102 PHE 100 100 PHE PHE A ? A 1 103 ASP 101 101 ASP ASP A ? A 1 104 TYR 102 102 TYR TYR A ? A 1 105 ASP 103 103 ASP ASP A ? A 1 106 LEU 104 104 LEU LEU A ? A 1 107 PHE 105 105 PHE PHE A ? A 1 108 LEU 106 106 LEU LEU A ? A 1 109 HIS 107 107 HIS HIS A ? A 1 110 LEU 108 108 LEU LEU A ? A 1 111 GLU 109 109 GLU GLU A ? A 1 112 GLY 110 110 GLY GLY A ? A 1 113 HIS 111 111 HIS HIS A ? A 1 114 PRO 112 112 PRO PRO A ? A 1 115 PRO 113 113 PRO PRO A ? A 1 116 VAL 114 114 VAL VAL A ? A 1 117 ASN 115 115 ASN ASN A ? A 1 118 HIS 116 116 HIS HIS A ? A 1 119 LEU 117 117 LEU LEU A ? A 1 120 ARG 118 118 ARG ARG A ? A 1 121 CYS 119 119 CYS CYS A ? A 1 122 GLU 120 120 GLU GLU A ? A 1 123 LYS 121 121 LYS LYS A ? A 1 124 LEU 122 122 LEU LEU A ? A 1 125 THR 123 123 THR THR A ? A 1 126 PHE 124 124 PHE PHE A ? A 1 127 ASN 125 125 ASN ASN A ? A 1 128 ASN 126 126 ASN ASN A ? A 1 129 PRO 127 127 PRO PRO A ? A 1 130 THR 128 128 THR THR A ? A 1 131 GLU 129 129 GLU GLU A ? A 1 132 ASP 130 130 ASP ASP A ? A 1 133 PHE 131 131 PHE PHE A ? A 1 134 ARG 132 132 ARG ARG A ? A 1 135 ARG 133 133 ARG ARG A ? A 1 136 LYS 134 134 LYS LYS A ? A 1 137 LEU 135 135 LEU LEU A ? A 1 138 LEU 136 136 LEU LEU A ? A 1 139 LYS 137 137 LYS LYS A ? A 1 140 ALA 138 138 ALA ALA A ? B 2 1 A 296 296 A A B . B 2 2 A 297 297 A A B . B 2 3 A 298 298 A A B . B 2 4 U 299 299 U U B . B 2 5 G 300 300 G G B . B 2 6 A 301 301 A A B . B 2 7 G 302 302 G G B . B 2 8 G 303 303 G G B . B 2 9 C 304 304 C C B . B 2 10 G 305 305 G G B . B 2 11 C 306 306 C C B . B 2 12 U 307 307 U U B . B 2 13 G 308 308 G G B . B 2 14 C 309 309 C C B . B 2 15 A 310 310 A A B . B 2 16 U 311 311 U U B . B 2 17 G 312 312 G G B . B 2 18 U 313 313 U U B . B 2 19 G 314 314 G G B . B 2 20 G 315 315 G G B . B 2 21 C 316 316 C C B . B 2 22 A 317 317 A A B . B 2 23 G 318 318 G G B . B 2 24 U 319 319 U U B . B 2 25 C 320 320 C C B . B 2 26 U 321 321 U U B . B 2 27 G 322 322 G G B . B 2 28 C 323 323 C C B . B 2 29 C 324 324 C C B . B 2 30 U 325 325 U U B . B 2 31 U 326 326 U U B . B 2 32 U 327 327 U U B . B 2 33 C 328 328 C C B . B 2 34 U 329 329 U U B . B 2 35 U 330 330 U U B . B 2 36 U 331 331 U U B . B 2 37 U 332 332 U U B . # # loop_ # #