data_9AAB # _entry.id 9AAB # loop_ _atom_type.symbol C H N O S # loop_ _audit_author.name _audit_author.pdbx_ordinal "Belyaeva, J." 1 "Elgeti, M." 2 # loop_ _audit_conform.dict_location _audit_conform.dict_name _audit_conform.dict_version https://mmcif.wwpdb.org/dictionaries/ascii/mmcif_ihm_ext.dic mmcif_ihm_ext.dic 1.28 http://mmcif.wwpdb.org/dictionaries/ascii/mmcif_pdbx_v50.dic mmcif_pdbx.dic 5.403 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 9AAB _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2025-12-16 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2026-10-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9AAB pdb_00009aab 10.2210/pdb9aab/pdb # loop_ _chem_comp.formula _chem_comp.formula_weight _chem_comp.id _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.type "C3 H7 N O2" 89.094 ALA . ALANINE . "L-peptide linking" "C6 H15 N4 O2 1" 175.212 ARG . ARGININE . "L-peptide linking" "C4 H8 N2 O3" 132.119 ASN . ASPARAGINE . "L-peptide linking" "C4 H7 N O4" 133.103 ASP . "ASPARTIC ACID" . "L-peptide linking" "C3 H7 N O2 S" 121.154 CYS . CYSTEINE . "L-peptide linking" "C5 H10 N2 O3" 146.146 GLN . GLUTAMINE . "L-peptide linking" "C5 H9 N O4" 147.13 GLU . "GLUTAMIC ACID" . "L-peptide linking" "C2 H5 N O2" 75.067 GLY . GLYCINE . "peptide linking" "C6 H10 N3 O2 1" 156.165 HIS . HISTIDINE . "L-peptide linking" "C6 H13 N O2" 131.175 ILE . ISOLEUCINE . "L-peptide linking" "C6 H13 N O2" 131.175 LEU . LEUCINE . "L-peptide linking" "C6 H15 N2 O2 1" 147.198 LYS . LYSINE . "L-peptide linking" "C5 H11 N O2 S" 149.208 MET . METHIONINE . "L-peptide linking" NH2 . NH2 . NH2 . other "C9 H11 N O2" 165.192 PHE . PHENYLALANINE . "L-peptide linking" "C5 H9 N O2" 115.132 PRO . PROLINE . "L-peptide linking" "C3 H7 N O2" 89.094 SAR . "N-methylglycine (sarcosine)" . "peptide linking" "C3 H7 N O3" 105.093 SER . SERINE . "L-peptide linking" "C4 H9 N O3" 119.12 THR . THREONINE . "L-peptide linking" "C11 H12 N2 O2" 204.229 TRP . TRYPTOPHAN . "L-peptide linking" "C9 H11 N O3" 181.191 TYR . TYROSINE . "L-peptide linking" "C5 H11 N O2" 117.148 VAL . VALINE . "L-peptide linking" # loop_ _citation.country _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_issue _citation.journal_volume _citation.page_first _citation.page_last _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.title _citation.year . 1 Structure . . . . . . . 10.1016/j.str.2026.09.003 . "Reconstructing hidden GPCR conformations and ligand binding modes through integrative DEER modeling" 2026 . 2 Cell . . . . 176 468-478 . 10.1016/j.cell.2018.12.005 30639099 "Angiotensin Analogs with Divergent Bias Stabilize Distinct Receptor Conformations" 2019 . 3 "Nat Biotechnol" . . . . 41 1810-1819 . 10.1038/s41587-023-01704-z 36941363 "Protein structure prediction with in-cell photo-crosslinking mass spectrometry and deep learning" 2023 . 4 bioRxiv . . . . . . . 10.1101/2021.10.04.463034 . "Protein complex prediction with AlphaFold-Multimer" 2021 . 5 SoftwareX . . . . 1-2 19-25 . 10.1016/j.softx.2015.06.001 . "GROMACS: High performance molecular simulations through multi-level parallelism from laptops to supercomputers" 2015 . 6 "Phys Chem Chem Phys" . . . . . . . 10.1039/c2cp41520h . "High sensitivity and versatility of the DEER experiment on nitroxide radical pairs at Q-band frequencies" 2012 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal 1 "Belyaeva, J." 1 1 "Elgeti, M." 2 2 "Wingler, L.M." 3 2 "Elgeti, M." 4 2 "Hilger, D." 5 2 "Latorraca, N.R." 6 2 "Lerch, M.T." 7 2 "Staus, D.P." 8 2 "Dror, R.O." 9 2 "Kobilka, B.K." 10 2 "Hubbell, W.L." 11 2 "Lefkowitz, R.J." 12 3 "Stahl, K." 13 3 "Graziadei, A." 14 3 "Dau, T." 15 3 "Brock, O." 16 3 "Rappsilber, J." 17 4 "Evans, R." 18 4 "O'Neill, M." 19 4 "Pritzel, A." 20 4 "Antropova, N." 21 4 "Senior, A." 22 4 "Green, T." 23 4 "Zidek, A." 24 4 "Bates, R." 25 4 "Blackwell, S." 26 4 "Yim, J." 27 4 "Ronneberger, O." 28 4 "Bodenstein, S." 29 4 "Zielinski, M." 30 4 "Bridgland, A." 31 4 "Potapenko, A." 32 4 "Cowie, A." 33 4 "Tunyasuvunakool, K." 34 4 "Jain, R." 35 4 "Clancy, E." 36 4 "Kohli, P." 37 4 "Jumper, J." 38 4 "Hassabis, D." 39 5 "Abraham, M.J." 40 5 "Murtola, T." 41 5 "Schulz, R." 42 5 "Pall, S." 43 5 "Smith, J.C." 44 5 "Hess, B." 45 5 "Lindahl, E." 46 6 "Polyhach, Y." 47 6 "Bordignon, E." 48 6 "Tschaggelar, R." 49 6 "Gandra, S." 50 6 "Godt, A." 51 6 "Jeschke, G." 52 # loop_ _entity.details _entity.formula_weight _entity.id _entity.pdbx_description _entity.pdbx_number_of_molecules _entity.src_method _entity.type . 42492.332 1 "Type-1 angiotensin II receptor" 1 MAN POLYMER . . 2 "TRV026, beta-arrestin biased peptide" 1 MAN POLYMER # loop_ _entity_name_com.entity_id _entity_name_com.name 1 AT1R 2 TRV026 # loop_ _entity_poly.entity_id _entity_poly.nstd_chirality _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_sequence_evidence_code _entity_poly.pdbx_strand_id _entity_poly.type 1 . NO NO MILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPAIIHRNVFFIENTNITVCAFHYESQNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFKIIMAIVLFFFFSWIPHQIFTFLDVLIQLGIIRDCRIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKRYFLQLLKY MILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPAIIHRNVFFIENTNITVCAFHYESQNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFKIIMAIVLFFFFSWIPHQIFTFLDVLIQLGIIRDCRIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKRYFLQLLKY . A polypeptide(L) 2 . NO NO (SAR)RVYYHP(NH2) GRVYYHPX . B polypeptide(L) # loop_ _entity_poly_seq.entity_id _entity_poly_seq.hetero _entity_poly_seq.mon_id _entity_poly_seq.num 1 . MET 1 1 . ILE 2 1 . LEU 3 1 . ASN 4 1 . SER 5 1 . SER 6 1 . THR 7 1 . GLU 8 1 . ASP 9 1 . GLY 10 1 . ILE 11 1 . LYS 12 1 . ARG 13 1 . ILE 14 1 . GLN 15 1 . ASP 16 1 . ASP 17 1 . CYS 18 1 . PRO 19 1 . LYS 20 1 . ALA 21 1 . GLY 22 1 . ARG 23 1 . HIS 24 1 . ASN 25 1 . TYR 26 1 . ILE 27 1 . PHE 28 1 . VAL 29 1 . MET 30 1 . ILE 31 1 . PRO 32 1 . THR 33 1 . LEU 34 1 . TYR 35 1 . SER 36 1 . ILE 37 1 . ILE 38 1 . PHE 39 1 . VAL 40 1 . VAL 41 1 . GLY 42 1 . ILE 43 1 . PHE 44 1 . GLY 45 1 . ASN 46 1 . SER 47 1 . LEU 48 1 . VAL 49 1 . VAL 50 1 . ILE 51 1 . VAL 52 1 . ILE 53 1 . TYR 54 1 . PHE 55 1 . TYR 56 1 . MET 57 1 . LYS 58 1 . LEU 59 1 . LYS 60 1 . THR 61 1 . VAL 62 1 . ALA 63 1 . SER 64 1 . VAL 65 1 . PHE 66 1 . LEU 67 1 . LEU 68 1 . ASN 69 1 . LEU 70 1 . ALA 71 1 . LEU 72 1 . ALA 73 1 . ASP 74 1 . LEU 75 1 . CYS 76 1 . PHE 77 1 . LEU 78 1 . LEU 79 1 . THR 80 1 . LEU 81 1 . PRO 82 1 . LEU 83 1 . TRP 84 1 . ALA 85 1 . VAL 86 1 . TYR 87 1 . THR 88 1 . ALA 89 1 . MET 90 1 . GLU 91 1 . TYR 92 1 . ARG 93 1 . TRP 94 1 . PRO 95 1 . PHE 96 1 . GLY 97 1 . ASN 98 1 . TYR 99 1 . LEU 100 1 . CYS 101 1 . LYS 102 1 . ILE 103 1 . ALA 104 1 . SER 105 1 . ALA 106 1 . SER 107 1 . VAL 108 1 . SER 109 1 . PHE 110 1 . ASN 111 1 . LEU 112 1 . TYR 113 1 . ALA 114 1 . SER 115 1 . VAL 116 1 . PHE 117 1 . LEU 118 1 . LEU 119 1 . THR 120 1 . CYS 121 1 . LEU 122 1 . SER 123 1 . ILE 124 1 . ASP 125 1 . ARG 126 1 . TYR 127 1 . LEU 128 1 . ALA 129 1 . ILE 130 1 . VAL 131 1 . HIS 132 1 . PRO 133 1 . MET 134 1 . LYS 135 1 . SER 136 1 . ARG 137 1 . LEU 138 1 . ARG 139 1 . ARG 140 1 . THR 141 1 . MET 142 1 . LEU 143 1 . VAL 144 1 . ALA 145 1 . LYS 146 1 . VAL 147 1 . THR 148 1 . CYS 149 1 . ILE 150 1 . ILE 151 1 . ILE 152 1 . TRP 153 1 . LEU 154 1 . LEU 155 1 . ALA 156 1 . GLY 157 1 . LEU 158 1 . ALA 159 1 . SER 160 1 . LEU 161 1 . PRO 162 1 . ALA 163 1 . ILE 164 1 . ILE 165 1 . HIS 166 1 . ARG 167 1 . ASN 168 1 . VAL 169 1 . PHE 170 1 . PHE 171 1 . ILE 172 1 . GLU 173 1 . ASN 174 1 . THR 175 1 . ASN 176 1 . ILE 177 1 . THR 178 1 . VAL 179 1 . CYS 180 1 . ALA 181 1 . PHE 182 1 . HIS 183 1 . TYR 184 1 . GLU 185 1 . SER 186 1 . GLN 187 1 . ASN 188 1 . SER 189 1 . THR 190 1 . LEU 191 1 . PRO 192 1 . ILE 193 1 . GLY 194 1 . LEU 195 1 . GLY 196 1 . LEU 197 1 . THR 198 1 . LYS 199 1 . ASN 200 1 . ILE 201 1 . LEU 202 1 . GLY 203 1 . PHE 204 1 . LEU 205 1 . PHE 206 1 . PRO 207 1 . PHE 208 1 . LEU 209 1 . ILE 210 1 . ILE 211 1 . LEU 212 1 . THR 213 1 . SER 214 1 . TYR 215 1 . THR 216 1 . LEU 217 1 . ILE 218 1 . TRP 219 1 . LYS 220 1 . ALA 221 1 . LEU 222 1 . LYS 223 1 . LYS 224 1 . ALA 225 1 . TYR 226 1 . GLU 227 1 . ILE 228 1 . GLN 229 1 . LYS 230 1 . ASN 231 1 . LYS 232 1 . PRO 233 1 . ARG 234 1 . ASN 235 1 . ASP 236 1 . ASP 237 1 . ILE 238 1 . PHE 239 1 . LYS 240 1 . ILE 241 1 . ILE 242 1 . MET 243 1 . ALA 244 1 . ILE 245 1 . VAL 246 1 . LEU 247 1 . PHE 248 1 . PHE 249 1 . PHE 250 1 . PHE 251 1 . SER 252 1 . TRP 253 1 . ILE 254 1 . PRO 255 1 . HIS 256 1 . GLN 257 1 . ILE 258 1 . PHE 259 1 . THR 260 1 . PHE 261 1 . LEU 262 1 . ASP 263 1 . VAL 264 1 . LEU 265 1 . ILE 266 1 . GLN 267 1 . LEU 268 1 . GLY 269 1 . ILE 270 1 . ILE 271 1 . ARG 272 1 . ASP 273 1 . CYS 274 1 . ARG 275 1 . ILE 276 1 . ALA 277 1 . ASP 278 1 . ILE 279 1 . VAL 280 1 . ASP 281 1 . THR 282 1 . ALA 283 1 . MET 284 1 . PRO 285 1 . ILE 286 1 . THR 287 1 . ILE 288 1 . CYS 289 1 . ILE 290 1 . ALA 291 1 . TYR 292 1 . PHE 293 1 . ASN 294 1 . ASN 295 1 . CYS 296 1 . LEU 297 1 . ASN 298 1 . PRO 299 1 . LEU 300 1 . PHE 301 1 . TYR 302 1 . GLY 303 1 . PHE 304 1 . LEU 305 1 . GLY 306 1 . LYS 307 1 . LYS 308 1 . PHE 309 1 . LYS 310 1 . ARG 311 1 . TYR 312 1 . PHE 313 1 . LEU 314 1 . GLN 315 1 . LEU 316 1 . LEU 317 1 . LYS 318 1 . TYR 319 2 . SAR 1 2 . ARG 2 2 . VAL 3 2 . TYR 4 2 . TYR 5 2 . HIS 6 2 . PRO 7 2 . NH2 8 # loop_ _ihm_dataset_external_reference.dataset_list_id _ihm_dataset_external_reference.file_id _ihm_dataset_external_reference.id 1 1 1 1 2 2 1 3 3 1 4 4 1 5 5 1 6 6 1 7 7 1 8 8 1 9 9 1 10 10 2 11 11 # _ihm_dataset_group.application . _ihm_dataset_group.details . _ihm_dataset_group.id 1 _ihm_dataset_group.name "Datasets used for AT1R-TRV026 modeling from experimental DEER data and AlphaLink-derived distograms." # loop_ _ihm_dataset_group_link.dataset_list_id _ihm_dataset_group_link.group_id 1 1 2 1 3 1 4 1 # loop_ _ihm_dataset_list.data_type _ihm_dataset_list.database_hosted _ihm_dataset_list.details _ihm_dataset_list.id "EPR data" NO "Ten Double Electron-Electron Resonance (DEER) distance distributions that were previously published (L. Wingler et al., Cell 2019)." 1 "EPR data" NO "AlphaLink distograms derived from the original DEER dataset." 2 "Experimental model" YES "An experimental structure of AT1R in complex with the small-molecule antagonist ZD7155, in which the receptor adopts an inactive conformation." 3 "Experimental model" YES "An experimental structure of AT1R in complex with the -arrestin-biased peptide TRV026, in which the receptor is stabilized in an active conformation by a nanobody." 4 # loop_ _ihm_dataset_related_db_reference.accession_code _ihm_dataset_related_db_reference.dataset_list_id _ihm_dataset_related_db_reference.db_name _ihm_dataset_related_db_reference.details _ihm_dataset_related_db_reference.id _ihm_dataset_related_db_reference.version 4YAY 3 PDB . 1 . 6OS2 4 PDB . 2 . # loop_ _ihm_derived_distance_restraint.dataset_list_id _ihm_derived_distance_restraint.distance_lower_limit _ihm_derived_distance_restraint.distance_lower_limit_esd _ihm_derived_distance_restraint.distance_threshold_esd _ihm_derived_distance_restraint.distance_threshold_mean _ihm_derived_distance_restraint.distance_upper_limit _ihm_derived_distance_restraint.distance_upper_limit_esd _ihm_derived_distance_restraint.feature_id_1 _ihm_derived_distance_restraint.feature_id_2 _ihm_derived_distance_restraint.group_conditionality _ihm_derived_distance_restraint.group_id _ihm_derived_distance_restraint.id _ihm_derived_distance_restraint.mic_value _ihm_derived_distance_restraint.probability _ihm_derived_distance_restraint.random_exclusion_fraction _ihm_derived_distance_restraint.restraint_type 2 30.871 . . . 38.852 . 1 2 . . 1 . 1 . "lower and upper bound" 2 32.844 . . . 36.864 . 1 3 . . 2 . 1 . "lower and upper bound" 2 23.375 . . . 33.31 . 1 4 . . 3 . 1 . "lower and upper bound" 2 19.252 . . . 25.675 . 1 5 . . 4 . 1 . "lower and upper bound" 2 29.424 . . . 34.66 . 6 5 . . 5 . 1 . "lower and upper bound" 2 17.855 . . . 25.813 . 2 6 . . 6 . 1 . "lower and upper bound" 2 25.044 . . . 32.648 . 2 3 . . 7 . 1 . "lower and upper bound" 2 35.176 . . . 41.433 . 2 4 . . 8 . 1 . "lower and upper bound" 2 28.035 . . . 35.661 . 2 5 . . 9 . 1 . "lower and upper bound" 2 22.627 . . . 29.004 . 3 5 . . 10 . 1 . "lower and upper bound" # loop_ _ihm_entity_poly_segment.comp_id_begin _ihm_entity_poly_segment.comp_id_end _ihm_entity_poly_segment.entity_id _ihm_entity_poly_segment.id _ihm_entity_poly_segment.seq_id_begin _ihm_entity_poly_segment.seq_id_end MET TYR 1 1 1 319 SAR NH2 2 2 1 8 # _ihm_epr_restraint.chi_value . _ihm_epr_restraint.dataset_list_id 2 _ihm_epr_restraint.details . _ihm_epr_restraint.fitting_method "Model-free analysis using smoothness parameter determined by L-curve criterion" _ihm_epr_restraint.fitting_method_citation_id 6 _ihm_epr_restraint.fitting_particle_type . _ihm_epr_restraint.fitting_software_id 4 _ihm_epr_restraint.fitting_state . _ihm_epr_restraint.model_id 1 _ihm_epr_restraint.ordinal_id 1 # loop_ _ihm_external_files.content_type _ihm_external_files.details _ihm_external_files.file_format _ihm_external_files.file_path _ihm_external_files.file_size_bytes _ihm_external_files.id _ihm_external_files.reference_id "Input data or restraints" . Other AlphaLink-DEER/00.datasets/00.DEER_distance_distributions_Cell2019/AT1R_NNMF-055V1-139V1-Conf2.dat . 1 1 "Input data or restraints" . Other AlphaLink-DEER/00.datasets/00.DEER_distance_distributions_Cell2019/AT1R_NNMF-055V1-236V1-Conf2.dat . 2 1 "Input data or restraints" . Other AlphaLink-DEER/00.datasets/00.DEER_distance_distributions_Cell2019/AT1R_NNMF-055V1-304V1-Conf2.dat . 3 1 "Input data or restraints" . Other AlphaLink-DEER/00.datasets/00.DEER_distance_distributions_Cell2019/AT1R_NNMF-055V1-311V1-Conf2.dat . 4 1 "Input data or restraints" . Other AlphaLink-DEER/00.datasets/00.DEER_distance_distributions_Cell2019/AT1R_NNMF-139V1-220V1-Conf2.dat . 5 1 "Input data or restraints" . Other AlphaLink-DEER/00.datasets/00.DEER_distance_distributions_Cell2019/AT1R_NNMF-139V1-236V1-Conf2.dat . 6 1 "Input data or restraints" . Other AlphaLink-DEER/00.datasets/00.DEER_distance_distributions_Cell2019/AT1R_NNMF-139V1-304V1-Conf2.dat . 7 1 "Input data or restraints" . Other AlphaLink-DEER/00.datasets/00.DEER_distance_distributions_Cell2019/AT1R_NNMF-139V1-311V1-Conf2.dat . 8 1 "Input data or restraints" . Other AlphaLink-DEER/00.datasets/00.DEER_distance_distributions_Cell2019/AT1R_NNMF-220V1-311V1-Conf2.dat . 9 1 "Input data or restraints" . Other AlphaLink-DEER/00.datasets/00.DEER_distance_distributions_Cell2019/AT1R_NNMF-236V1-311V1-Conf2.dat . 10 1 "Input data or restraints" . Other AlphaLink-DEER/00.datasets/01.DEER_distograms_AlphaLink_input/distributions.csv . 11 1 # _ihm_external_reference_info.associated_url https://zenodo.org/records/20259483/files/AlphaLink-DEER.zip _ihm_external_reference_info.details . _ihm_external_reference_info.reference 10.5281/zenodo.20259483 _ihm_external_reference_info.reference_id 1 _ihm_external_reference_info.reference_provider Zenodo _ihm_external_reference_info.reference_type DOI _ihm_external_reference_info.refers_to Archive # loop_ _ihm_feature_list.details _ihm_feature_list.entity_type _ihm_feature_list.feature_id _ihm_feature_list.feature_type "AT1R F1.59(55) CA (chain A)" polymer 1 atom "AT1R R34.56(139) CA (chain A)" polymer 2 atom "AT1R D6.31(236) CA (chain A)" polymer 3 atom "AT1R F7.55(304) CA (chain A)" polymer 4 atom "AT1R R8.52(311) CA (chain A)" polymer 5 atom "AT1R K5.63(220) CA (chain A)" polymer 6 atom # loop_ _ihm_model_group.details _ihm_model_group.id _ihm_model_group.name "Intermediate binding mode INT_4_d of AT1R-TRV026" 1 INT_4_d "Intermediate binding mode INT_3_p of AT1R-TRV026" 2 INT_3_p "Intermediate binding mode INT_2_p of AT1R-TRV026" 3 INT_2_p # loop_ _ihm_model_group_link.group_id _ihm_model_group_link.model_id 1 1 2 2 3 3 # loop_ _ihm_model_list.assembly_id _ihm_model_list.model_id _ihm_model_list.model_name _ihm_model_list.protocol_id _ihm_model_list.representation_id 1 1 INT_4_d 1 1 1 2 INT_3_p 1 1 1 3 INT_2_p 1 1 # _ihm_model_representation.details "Both receptor and ligand modeled at atomic resolution" _ihm_model_representation.id 1 _ihm_model_representation.name "All-atom AT1R-TRV026 model" # loop_ _ihm_model_representation_details.description _ihm_model_representation_details.entity_asym_id _ihm_model_representation_details.entity_description _ihm_model_representation_details.entity_id _ihm_model_representation_details.entity_poly_segment_id _ihm_model_representation_details.id _ihm_model_representation_details.model_granularity _ihm_model_representation_details.model_mode _ihm_model_representation_details.model_object_count _ihm_model_representation_details.model_object_primitive _ihm_model_representation_details.representation_id _ihm_model_representation_details.starting_model_id "AT1R, chain A, atomic resolution" A "Type-1 angiotensin II receptor" 1 1 1 by-atom flexible . atomistic 1 1 "TRV026 peptide, chain B, atomic resolution" B "TRV026, beta-arrestin biased peptide" 2 2 2 by-atom flexible . atomistic 1 2 # _ihm_modeling_protocol.details "The AlphaLink-DEER protocol generates a weighted ensemble of AT1R-TRV026 all-atom models from sparse experimental DEER data. AlphaLink first builds preliminary AT1R conformations from DEER data and sequence. AlphaFold2-Multimer is then used to place TRV026 into the orthosteric pocket of these receptor models.The resulting complexes are refined by short molecular dynamics simulations, followed by RMSD-based filtering, identification of intermediate binding modes, and linear combination analysis of simulated DEER distributions to create the final ensemble. A detailed description of the workflow is provided in the accompanying publication." _ihm_modeling_protocol.id 1 _ihm_modeling_protocol.num_steps 11 _ihm_modeling_protocol.protocol_name AlphaLink-DEER # loop_ _ihm_modeling_protocol_details.dataset_group_id _ihm_modeling_protocol_details.description _ihm_modeling_protocol_details.ensemble_flag _ihm_modeling_protocol_details.id _ihm_modeling_protocol_details.multi_scale_flag _ihm_modeling_protocol_details.multi_state_flag _ihm_modeling_protocol_details.num_models_begin _ihm_modeling_protocol_details.num_models_end _ihm_modeling_protocol_details.ordered_flag _ihm_modeling_protocol_details.protocol_id _ihm_modeling_protocol_details.script_file_id _ihm_modeling_protocol_details.software_id _ihm_modeling_protocol_details.step_id _ihm_modeling_protocol_details.step_method _ihm_modeling_protocol_details.step_name _ihm_modeling_protocol_details.struct_assembly_description _ihm_modeling_protocol_details.struct_assembly_id 1 "AlphaLink builds AT1R models using ten experimental DEER restraints and the AT1R sequence. A total of 2000 models were generated: 1000 with -Neff 5 and 1000 with -Neff 10." NO 1 NO NO 0 2000 NO 1 . 1 1 AlphaLink Sampling . 1 1 "AlphaLink models were filtered based on per-helix RMSD relative to inactive (PDB: 4YAY) and active (PDB: 6OS2) experimental AT1R structures. Each model was aligned to both references using backbone heavy atoms of TM1-TM7, and RMSD was computed separately for all seven helices. Models were discarded if any TM helix exceeded 4.5 A RMSD from both reference states, ensuring removal of distorted conformations." NO 2 NO NO 2000 1734 NO 1 . . 2 "Filtering: adequacy of models" Filtering . 1 1 "AlphaLink models were clustered using three non-correlated Ca-Ca distances: F1.59(55)-R34.56(139), F1.59(55)-D6.31(236), and F1.59(55)-R8.52(311). Clustering was performed with GaussianMixture model, and one representative structure was selected from each cluster." NO 3 NO NO 1734 8 NO 1 . . 3 "Clustering of AlphaLink models" Clustering . 1 1 "AlphaFold2-Multimer (ColabFold version) was used to place TRV026 onto each representative AlphaLink model. Each AlphaFold2-Multimer run used the AlphaLink representative as the main receptor template and the experimental AT1R-TRV026 structure (PDB: 6OS2) as a hypothesis for the peptide pose." NO 4 NO NO 8 8 NO 1 . 2 4 AlphaFold2-Multimer Sampling . 1 1 "Molecular dynamics simulations were performed in GROMACS. 80 trajectories total, each 500 ns long: 8 systems 5 replicas 2 D3.49(125) protonation variants. Details are available in the manuscript." NO 5 NO NO 8 80 NO 1 . 3 5 "MD simulations in GROMACS" Sampling . 1 1 "RMSD-based filtering was applied to ensure (i) stability of the AT1R-TRV026 complex and (ii) absence of rapid, non-physical conformational changes in the receptor. Ligand stability: TRV026 heavy-atom RMSD between consecutive frames <= 2.0 in at least 95% of frames. Receptor stability: maximum absolute RMSD change of TM6 intracellular part (D6.31-W6.48) within any 50-ns window <= 2.0 . Equilibration period was identified using PELT changepoint detection, capped at 75 ns. 39 trajectories passed both filters." NO 6 NO NO 80 39 NO 1 . . 6 "RMSD-based filtering: ligand and receptor stability" Filtering . 1 1 "For the 39 filtered trajectories, we identified plateau regions where TM6 adopted stable conformations. DEER distance distributions were simulated for each frame using Off-Rotamer Sampling (chiLife library, V1 spin label, 5000 iterations). Plateaus were identified from TM1-TM6 peak distance time series: smoothed with 25-frame rolling average, local slope calculated over 50-frame windows, slopes < threshold classified as plateaus. Plateaus classified as inactive-like (<= 32.7 A), intermediate-like (32.7-38.3 A), or active-like (>= 38.3 A) based on experimental TM1-TM6 distance." NO 7 NO NO 39 39 NO 1 . . 7 "Identification of plateau regions in TM1-TM6 distance" Analysis . 1 1 "Receptor-ligand interactions, hydrogen bonds, salt bridges and pi- or T-stacking,were identified in each frame of the 39 filtered trajectories using MDAnalysis." NO 8 NO NO 39 39 NO 1 . . 8 "Computing AT1R-TRV026 interactions" Analysis . 1 1 "Interactions were classified as scaffold (constant frequency) or BM-defining (concentrated in specific intervals). Time-lagged Independent Component Analysis (TICA) was applied to reduce dimensionality. K-means clustering (scikit-learn) was performed on TICA-transformed coordinates.Binding mode segments were defined as continuous stretches. Similar BMs were merged using hierarchical clustering.As a result, we obtained 76 binding modes." NO 9 NO NO 39 76 NO 1 . . 9 "Clustering of interactions into binding modes" Clustering . 1 1 "TM6 conformation (inactive/intermediate/active) was assigned to each BM by overlapping with plateau regions. The procedure resulted in seven inactive-like, nine intermediate-like, and 60 active-like BMs. Nine intermediate BMs (INTs) were selected for linear combination analysis." NO 10 NO NO 76 9 NO 1 . . 10 "Classification of binding modes by TM6 conformation" Classification . 1 1 "For each of the nine intermediate BMs, representative DEER distributions were obtained by averaging over a subset of frames. The optimal percentage (8%) was selected using five-fold leave-one-out cross-validation (LOO-CV). Linear combination coefficients were fitted using SLSQP optimizer (SciPy) with non-negative constraint, sum-to-one constraint, constant offset term. Coefficient uncertainties were estimated by bootstrapping (500 iterations). Final model retained three INTs: INT_2_p, INT_3_p, INT_4_d, representative structures of which were added to the current model." NO 11 NO NO 9 3 NO 1 . . 11 "Linear combination analysis of intermediate binding modes" Validation . 1 # loop_ _ihm_multi_state_model_group_link.model_group_id _ihm_multi_state_model_group_link.state_id 1 1 2 2 3 3 # loop_ _ihm_multi_state_modeling.details _ihm_multi_state_modeling.experiment_type _ihm_multi_state_modeling.population_fraction _ihm_multi_state_modeling.population_fraction_sd _ihm_multi_state_modeling.state_group_id _ihm_multi_state_modeling.state_id _ihm_multi_state_modeling.state_name _ihm_multi_state_modeling.state_type "Intermediate binding mode INT_4_d explaining DEER data" . 0.73 . 1 1 "INT_4_d state" . "Intermediate binding mode INT_3_p explaining DEER data" . 0.14 . 1 2 "INT_3_p state" . "Intermediate binding mode INT_2_p explaining DEER data" . 0.13 . 1 3 "INT_2_p state" . # loop_ _ihm_poly_atom_feature.asym_id _ihm_poly_atom_feature.atom_id _ihm_poly_atom_feature.comp_id _ihm_poly_atom_feature.entity_id _ihm_poly_atom_feature.feature_id _ihm_poly_atom_feature.ordinal_id _ihm_poly_atom_feature.seq_id A CA PHE 1 1 1 55 A CA ARG 1 2 2 139 A CA ASP 1 3 3 236 A CA PHE 1 4 4 304 A CA ARG 1 5 5 311 A CA LYS 1 6 6 220 # _ihm_related_datasets.dataset_list_id_derived 2 _ihm_related_datasets.dataset_list_id_primary 1 _ihm_related_datasets.transformation_id . # loop_ _ihm_starting_model_details.asym_id _ihm_starting_model_details.dataset_list_id _ihm_starting_model_details.description _ihm_starting_model_details.entity_description _ihm_starting_model_details.entity_id _ihm_starting_model_details.entity_poly_segment_id _ihm_starting_model_details.starting_model_auth_asym_id _ihm_starting_model_details.starting_model_id _ihm_starting_model_details.starting_model_sequence_offset _ihm_starting_model_details.starting_model_source A 4 . "Type-1 angiotensin II receptor" 1 1 A 1 7 "experimental model" B 4 . "TRV026, beta-arrestin biased peptide" 2 2 B 2 0 "experimental model" # _ihm_struct_assembly.description "Integrative model of TRV026-stabilized conformation of AT1R obtained from experimental DEER distance restraints using a protocol combining AlphaLink, AlphaFold2-Multimer, and short unbiased molecular dynamics simulations in GROMACS." _ihm_struct_assembly.id 1 _ihm_struct_assembly.name "TRV026-stabilized conformation of AT1R" # loop_ _ihm_struct_assembly_details.assembly_id _ihm_struct_assembly_details.asym_id _ihm_struct_assembly_details.entity_description _ihm_struct_assembly_details.entity_id _ihm_struct_assembly_details.entity_poly_segment_id _ihm_struct_assembly_details.id _ihm_struct_assembly_details.parent_assembly_id 1 A "Type-1 angiotensin II receptor" 1 1 1 1 1 B "TRV026, beta-arrestin biased peptide" 2 2 2 1 # loop_ _software.citation_id _software.classification _software.description _software.location _software.name _software.pdbx_ordinal _software.type _software.version 3 sampling "Used to generate preliminary structural models of AT1R from the experimental DEER restraints and sequence." https://github.com/lhatsk/AlphaLink AlphaLink 1 program 1.0 4 sampling "Used to place TRV026 peptide into the AT1R models produced by AlphaLink." https://colab.research.google.com/github/sokrypton/ColabFold/blob/main/AlphaFold2.ipynb AlphaFold2-Multimer 2 program 3 5 sampling "Used to perform unbiased MD simulations with GPU acceleration." https://www.gromacs.org/ GROMACS 3 program 2023 . "data analysis" "A Program to Analyze DEER Data" https://sites.google.com/site/altenbach/labview-programs/epr-programs/long-distances LongDistances 4 program 590 # _struct.entry_id 9AAB _struct.pdbx_CASP_flag . _struct.pdbx_descriptor . _struct.pdbx_details . _struct.pdbx_model_details ; We modelled a complex of the angiotensin II type-1 receptor (AT1R) with the peptidic ligand TRV026, which is associated with an intratransducer bias. The "intratransducer" bias means that a ligand stabilises a receptor conformation that preferentially binds a specific intracellular partner (beta-arrestin) in a certain geometry (e.g., via the receptor's C-terminus) We built our model from published DEER data using a protocol that combines deep-learning methods (AlphaLink and AlphaFold2-Multimer) with unbiased MD simulations. The final result is a weighted ensemble of five models that captures the structural heterogeneity observed in the original DEER experiment. ; _struct.pdbx_model_type_details . _struct.pdbx_structure_determination_methodology integrative _struct.title "The integrative model of the TRV026-stabilized conformation of AT1R was obtained from experimental DEER distance restraints using a protocol combining AlphaLink, AlphaFold2-Multimer, and short unbiased molecular dynamics simulations in GROMACS." # loop_ _struct_asym.details _struct_asym.entity_id _struct_asym.id _struct_asym.pdbx_PDB_id _struct_asym.pdbx_alt_id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.pdbx_order _struct_asym.pdbx_type "AT1R, receptor" 1 A . . . . . . "TRV026, peptidic ligand" 2 B . . . . . . # loop_ _struct_ref.db_code _struct_ref.db_name _struct_ref.details _struct_ref.entity_id _struct_ref.id _struct_ref.pdbx_align_begin _struct_ref.pdbx_align_end _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.pdbx_seq_one_letter_code AGTR1_HUMAN UNP . 1 1 1 . P30556 . MILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPAIIHRNVFFIENTNITVCAFHYESQNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFKIIMAIVLFFFFSWIPHQIFTFLDVLIQLGIIRDCRIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKRYFLQLLKY 9AAB PDB . 2 2 1 . 9AAB . . # loop_ _struct_ref_seq.align_id _struct_ref_seq.db_align_beg _struct_ref_seq.db_align_end _struct_ref_seq.details _struct_ref_seq.ref_id _struct_ref_seq.seq_align_beg _struct_ref_seq.seq_align_end 1 1 319 . 1 1 319 2 1 8 . 2 1 8 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code A 1 1 MET 1 1 MET MET A . A 1 2 ILE 2 2 ILE ILE A . A 1 3 LEU 3 3 LEU LEU A . A 1 4 ASN 4 4 ASN ASN A . A 1 5 SER 5 5 SER SER A . A 1 6 SER 6 6 SER SER A . A 1 7 THR 7 7 THR THR A . A 1 8 GLU 8 8 GLU GLU A . A 1 9 ASP 9 9 ASP ASP A . A 1 10 GLY 10 10 GLY GLY A . A 1 11 ILE 11 11 ILE ILE A . A 1 12 LYS 12 12 LYS LYS A . A 1 13 ARG 13 13 ARG ARG A . A 1 14 ILE 14 14 ILE ILE A . A 1 15 GLN 15 15 GLN GLN A . A 1 16 ASP 16 16 ASP ASP A . A 1 17 ASP 17 17 ASP ASP A . A 1 18 CYS 18 18 CYS CYS A . A 1 19 PRO 19 19 PRO PRO A . A 1 20 LYS 20 20 LYS LYS A . A 1 21 ALA 21 21 ALA ALA A . A 1 22 GLY 22 22 GLY GLY A . A 1 23 ARG 23 23 ARG ARG A . A 1 24 HIS 24 24 HIS HIS A . A 1 25 ASN 25 25 ASN ASN A . A 1 26 TYR 26 26 TYR TYR A . A 1 27 ILE 27 27 ILE ILE A . A 1 28 PHE 28 28 PHE PHE A . A 1 29 VAL 29 29 VAL VAL A . A 1 30 MET 30 30 MET MET A . A 1 31 ILE 31 31 ILE ILE A . A 1 32 PRO 32 32 PRO PRO A . A 1 33 THR 33 33 THR THR A . A 1 34 LEU 34 34 LEU LEU A . A 1 35 TYR 35 35 TYR TYR A . A 1 36 SER 36 36 SER SER A . A 1 37 ILE 37 37 ILE ILE A . A 1 38 ILE 38 38 ILE ILE A . A 1 39 PHE 39 39 PHE PHE A . A 1 40 VAL 40 40 VAL VAL A . A 1 41 VAL 41 41 VAL VAL A . A 1 42 GLY 42 42 GLY GLY A . A 1 43 ILE 43 43 ILE ILE A . A 1 44 PHE 44 44 PHE PHE A . A 1 45 GLY 45 45 GLY GLY A . A 1 46 ASN 46 46 ASN ASN A . A 1 47 SER 47 47 SER SER A . A 1 48 LEU 48 48 LEU LEU A . A 1 49 VAL 49 49 VAL VAL A . A 1 50 VAL 50 50 VAL VAL A . A 1 51 ILE 51 51 ILE ILE A . A 1 52 VAL 52 52 VAL VAL A . A 1 53 ILE 53 53 ILE ILE A . A 1 54 TYR 54 54 TYR TYR A . A 1 55 PHE 55 55 PHE PHE A . A 1 56 TYR 56 56 TYR TYR A . A 1 57 MET 57 57 MET MET A . A 1 58 LYS 58 58 LYS LYS A . A 1 59 LEU 59 59 LEU LEU A . A 1 60 LYS 60 60 LYS LYS A . A 1 61 THR 61 61 THR THR A . A 1 62 VAL 62 62 VAL VAL A . A 1 63 ALA 63 63 ALA ALA A . A 1 64 SER 64 64 SER SER A . A 1 65 VAL 65 65 VAL VAL A . A 1 66 PHE 66 66 PHE PHE A . A 1 67 LEU 67 67 LEU LEU A . A 1 68 LEU 68 68 LEU LEU A . A 1 69 ASN 69 69 ASN ASN A . A 1 70 LEU 70 70 LEU LEU A . A 1 71 ALA 71 71 ALA ALA A . A 1 72 LEU 72 72 LEU LEU A . A 1 73 ALA 73 73 ALA ALA A . A 1 74 ASP 74 74 ASP ASP A . A 1 75 LEU 75 75 LEU LEU A . A 1 76 CYS 76 76 CYS CYS A . A 1 77 PHE 77 77 PHE PHE A . A 1 78 LEU 78 78 LEU LEU A . A 1 79 LEU 79 79 LEU LEU A . A 1 80 THR 80 80 THR THR A . A 1 81 LEU 81 81 LEU LEU A . A 1 82 PRO 82 82 PRO PRO A . A 1 83 LEU 83 83 LEU LEU A . A 1 84 TRP 84 84 TRP TRP A . A 1 85 ALA 85 85 ALA ALA A . A 1 86 VAL 86 86 VAL VAL A . A 1 87 TYR 87 87 TYR TYR A . A 1 88 THR 88 88 THR THR A . A 1 89 ALA 89 89 ALA ALA A . A 1 90 MET 90 90 MET MET A . A 1 91 GLU 91 91 GLU GLU A . A 1 92 TYR 92 92 TYR TYR A . A 1 93 ARG 93 93 ARG ARG A . A 1 94 TRP 94 94 TRP TRP A . A 1 95 PRO 95 95 PRO PRO A . A 1 96 PHE 96 96 PHE PHE A . A 1 97 GLY 97 97 GLY GLY A . A 1 98 ASN 98 98 ASN ASN A . A 1 99 TYR 99 99 TYR TYR A . A 1 100 LEU 100 100 LEU LEU A . A 1 101 CYS 101 101 CYS CYS A . A 1 102 LYS 102 102 LYS LYS A . A 1 103 ILE 103 103 ILE ILE A . A 1 104 ALA 104 104 ALA ALA A . A 1 105 SER 105 105 SER SER A . A 1 106 ALA 106 106 ALA ALA A . A 1 107 SER 107 107 SER SER A . A 1 108 VAL 108 108 VAL VAL A . A 1 109 SER 109 109 SER SER A . A 1 110 PHE 110 110 PHE PHE A . A 1 111 ASN 111 111 ASN ASN A . A 1 112 LEU 112 112 LEU LEU A . A 1 113 TYR 113 113 TYR TYR A . A 1 114 ALA 114 114 ALA ALA A . A 1 115 SER 115 115 SER SER A . A 1 116 VAL 116 116 VAL VAL A . A 1 117 PHE 117 117 PHE PHE A . A 1 118 LEU 118 118 LEU LEU A . A 1 119 LEU 119 119 LEU LEU A . A 1 120 THR 120 120 THR THR A . A 1 121 CYS 121 121 CYS CYS A . A 1 122 LEU 122 122 LEU LEU A . A 1 123 SER 123 123 SER SER A . A 1 124 ILE 124 124 ILE ILE A . A 1 125 ASP 125 125 ASP ASP A . A 1 126 ARG 126 126 ARG ARG A . A 1 127 TYR 127 127 TYR TYR A . A 1 128 LEU 128 128 LEU LEU A . A 1 129 ALA 129 129 ALA ALA A . A 1 130 ILE 130 130 ILE ILE A . A 1 131 VAL 131 131 VAL VAL A . A 1 132 HIS 132 132 HIS HIS A . A 1 133 PRO 133 133 PRO PRO A . A 1 134 MET 134 134 MET MET A . A 1 135 LYS 135 135 LYS LYS A . A 1 136 SER 136 136 SER SER A . A 1 137 ARG 137 137 ARG ARG A . A 1 138 LEU 138 138 LEU LEU A . A 1 139 ARG 139 139 ARG ARG A . A 1 140 ARG 140 140 ARG ARG A . A 1 141 THR 141 141 THR THR A . A 1 142 MET 142 142 MET MET A . A 1 143 LEU 143 143 LEU LEU A . A 1 144 VAL 144 144 VAL VAL A . A 1 145 ALA 145 145 ALA ALA A . A 1 146 LYS 146 146 LYS LYS A . A 1 147 VAL 147 147 VAL VAL A . A 1 148 THR 148 148 THR THR A . A 1 149 CYS 149 149 CYS CYS A . A 1 150 ILE 150 150 ILE ILE A . A 1 151 ILE 151 151 ILE ILE A . A 1 152 ILE 152 152 ILE ILE A . A 1 153 TRP 153 153 TRP TRP A . A 1 154 LEU 154 154 LEU LEU A . A 1 155 LEU 155 155 LEU LEU A . A 1 156 ALA 156 156 ALA ALA A . A 1 157 GLY 157 157 GLY GLY A . A 1 158 LEU 158 158 LEU LEU A . A 1 159 ALA 159 159 ALA ALA A . A 1 160 SER 160 160 SER SER A . A 1 161 LEU 161 161 LEU LEU A . A 1 162 PRO 162 162 PRO PRO A . A 1 163 ALA 163 163 ALA ALA A . A 1 164 ILE 164 164 ILE ILE A . A 1 165 ILE 165 165 ILE ILE A . A 1 166 HIS 166 166 HIS HIS A . A 1 167 ARG 167 167 ARG ARG A . A 1 168 ASN 168 168 ASN ASN A . A 1 169 VAL 169 169 VAL VAL A . A 1 170 PHE 170 170 PHE PHE A . A 1 171 PHE 171 171 PHE PHE A . A 1 172 ILE 172 172 ILE ILE A . A 1 173 GLU 173 173 GLU GLU A . A 1 174 ASN 174 174 ASN ASN A . A 1 175 THR 175 175 THR THR A . A 1 176 ASN 176 176 ASN ASN A . A 1 177 ILE 177 177 ILE ILE A . A 1 178 THR 178 178 THR THR A . A 1 179 VAL 179 179 VAL VAL A . A 1 180 CYS 180 180 CYS CYS A . A 1 181 ALA 181 181 ALA ALA A . A 1 182 PHE 182 182 PHE PHE A . A 1 183 HIS 183 183 HIS HIS A . A 1 184 TYR 184 184 TYR TYR A . A 1 185 GLU 185 185 GLU GLU A . A 1 186 SER 186 186 SER SER A . A 1 187 GLN 187 187 GLN GLN A . A 1 188 ASN 188 188 ASN ASN A . A 1 189 SER 189 189 SER SER A . A 1 190 THR 190 190 THR THR A . A 1 191 LEU 191 191 LEU LEU A . A 1 192 PRO 192 192 PRO PRO A . A 1 193 ILE 193 193 ILE ILE A . A 1 194 GLY 194 194 GLY GLY A . A 1 195 LEU 195 195 LEU LEU A . A 1 196 GLY 196 196 GLY GLY A . A 1 197 LEU 197 197 LEU LEU A . A 1 198 THR 198 198 THR THR A . A 1 199 LYS 199 199 LYS LYS A . A 1 200 ASN 200 200 ASN ASN A . A 1 201 ILE 201 201 ILE ILE A . A 1 202 LEU 202 202 LEU LEU A . A 1 203 GLY 203 203 GLY GLY A . A 1 204 PHE 204 204 PHE PHE A . A 1 205 LEU 205 205 LEU LEU A . A 1 206 PHE 206 206 PHE PHE A . A 1 207 PRO 207 207 PRO PRO A . A 1 208 PHE 208 208 PHE PHE A . A 1 209 LEU 209 209 LEU LEU A . A 1 210 ILE 210 210 ILE ILE A . A 1 211 ILE 211 211 ILE ILE A . A 1 212 LEU 212 212 LEU LEU A . A 1 213 THR 213 213 THR THR A . A 1 214 SER 214 214 SER SER A . A 1 215 TYR 215 215 TYR TYR A . A 1 216 THR 216 216 THR THR A . A 1 217 LEU 217 217 LEU LEU A . A 1 218 ILE 218 218 ILE ILE A . A 1 219 TRP 219 219 TRP TRP A . A 1 220 LYS 220 220 LYS LYS A . A 1 221 ALA 221 221 ALA ALA A . A 1 222 LEU 222 222 LEU LEU A . A 1 223 LYS 223 223 LYS LYS A . A 1 224 LYS 224 224 LYS LYS A . A 1 225 ALA 225 225 ALA ALA A . A 1 226 TYR 226 226 TYR TYR A . A 1 227 GLU 227 227 GLU GLU A . A 1 228 ILE 228 228 ILE ILE A . A 1 229 GLN 229 229 GLN GLN A . A 1 230 LYS 230 230 LYS LYS A . A 1 231 ASN 231 231 ASN ASN A . A 1 232 LYS 232 232 LYS LYS A . A 1 233 PRO 233 233 PRO PRO A . A 1 234 ARG 234 234 ARG ARG A . A 1 235 ASN 235 235 ASN ASN A . A 1 236 ASP 236 236 ASP ASP A . A 1 237 ASP 237 237 ASP ASP A . A 1 238 ILE 238 238 ILE ILE A . A 1 239 PHE 239 239 PHE PHE A . A 1 240 LYS 240 240 LYS LYS A . A 1 241 ILE 241 241 ILE ILE A . A 1 242 ILE 242 242 ILE ILE A . A 1 243 MET 243 243 MET MET A . A 1 244 ALA 244 244 ALA ALA A . A 1 245 ILE 245 245 ILE ILE A . A 1 246 VAL 246 246 VAL VAL A . A 1 247 LEU 247 247 LEU LEU A . A 1 248 PHE 248 248 PHE PHE A . A 1 249 PHE 249 249 PHE PHE A . A 1 250 PHE 250 250 PHE PHE A . A 1 251 PHE 251 251 PHE PHE A . A 1 252 SER 252 252 SER SER A . A 1 253 TRP 253 253 TRP TRP A . A 1 254 ILE 254 254 ILE ILE A . A 1 255 PRO 255 255 PRO PRO A . A 1 256 HIS 256 256 HIS HIS A . A 1 257 GLN 257 257 GLN GLN A . A 1 258 ILE 258 258 ILE ILE A . A 1 259 PHE 259 259 PHE PHE A . A 1 260 THR 260 260 THR THR A . A 1 261 PHE 261 261 PHE PHE A . A 1 262 LEU 262 262 LEU LEU A . A 1 263 ASP 263 263 ASP ASP A . A 1 264 VAL 264 264 VAL VAL A . A 1 265 LEU 265 265 LEU LEU A . A 1 266 ILE 266 266 ILE ILE A . A 1 267 GLN 267 267 GLN GLN A . A 1 268 LEU 268 268 LEU LEU A . A 1 269 GLY 269 269 GLY GLY A . A 1 270 ILE 270 270 ILE ILE A . A 1 271 ILE 271 271 ILE ILE A . A 1 272 ARG 272 272 ARG ARG A . A 1 273 ASP 273 273 ASP ASP A . A 1 274 CYS 274 274 CYS CYS A . A 1 275 ARG 275 275 ARG ARG A . A 1 276 ILE 276 276 ILE ILE A . A 1 277 ALA 277 277 ALA ALA A . A 1 278 ASP 278 278 ASP ASP A . A 1 279 ILE 279 279 ILE ILE A . A 1 280 VAL 280 280 VAL VAL A . A 1 281 ASP 281 281 ASP ASP A . A 1 282 THR 282 282 THR THR A . A 1 283 ALA 283 283 ALA ALA A . A 1 284 MET 284 284 MET MET A . A 1 285 PRO 285 285 PRO PRO A . A 1 286 ILE 286 286 ILE ILE A . A 1 287 THR 287 287 THR THR A . A 1 288 ILE 288 288 ILE ILE A . A 1 289 CYS 289 289 CYS CYS A . A 1 290 ILE 290 290 ILE ILE A . A 1 291 ALA 291 291 ALA ALA A . A 1 292 TYR 292 292 TYR TYR A . A 1 293 PHE 293 293 PHE PHE A . A 1 294 ASN 294 294 ASN ASN A . A 1 295 ASN 295 295 ASN ASN A . A 1 296 CYS 296 296 CYS CYS A . A 1 297 LEU 297 297 LEU LEU A . A 1 298 ASN 298 298 ASN ASN A . A 1 299 PRO 299 299 PRO PRO A . A 1 300 LEU 300 300 LEU LEU A . A 1 301 PHE 301 301 PHE PHE A . A 1 302 TYR 302 302 TYR TYR A . A 1 303 GLY 303 303 GLY GLY A . A 1 304 PHE 304 304 PHE PHE A . A 1 305 LEU 305 305 LEU LEU A . A 1 306 GLY 306 306 GLY GLY A . A 1 307 LYS 307 307 LYS LYS A . A 1 308 LYS 308 308 LYS LYS A . A 1 309 PHE 309 309 PHE PHE A . A 1 310 LYS 310 310 LYS LYS A . A 1 311 ARG 311 311 ARG ARG A . A 1 312 TYR 312 312 TYR TYR A . A 1 313 PHE 313 313 PHE PHE A . A 1 314 LEU 314 314 LEU LEU A . A 1 315 GLN 315 315 GLN GLN A . A 1 316 LEU 316 316 LEU LEU A . A 1 317 LEU 317 317 LEU LEU A . A 1 318 LYS 318 318 LYS LYS A . A 1 319 TYR 319 319 TYR TYR A . B 2 1 SAR 1 1 SAR SAR B . B 2 2 ARG 2 2 ARG ARG B . B 2 3 VAL 3 3 VAL VAL B . B 2 4 TYR 4 4 TYR TYR B . B 2 5 TYR 5 5 TYR TYR B . B 2 6 HIS 6 6 HIS HIS B . B 2 7 PRO 7 7 PRO PRO B . B 2 8 NH2 8 8 NH2 NH2 B . # # loop_ # #