data_9AVN # _entry.id 9AVN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.413 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9AVN pdb_00009avn 10.2210/pdb9avn/pdb WWPDB D_1000282120 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-03-12 ? 2 'Structure model' 1 1 2026-04-29 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_id_CSD' 3 2 'Structure model' '_citation.journal_id_ISSN' 4 2 'Structure model' '_citation.journal_volume' 5 2 'Structure model' '_citation.page_first' 6 2 'Structure model' '_citation.page_last' 7 2 'Structure model' '_citation.pdbx_database_id_DOI' 8 2 'Structure model' '_citation.pdbx_database_id_PubMed' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9AVN _pdbx_database_status.recvd_initial_deposition_date 2024-03-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 1 _pdbx_contact_author.email clemke@broadinstitute.org _pdbx_contact_author.name_first Christopher _pdbx_contact_author.name_last Lemke _pdbx_contact_author.name_mi T _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-9419-1511 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Raymond, D.D.' 1 0000-0003-4154-6141 'Lemke, C.T.' 2 0000-0001-9419-1511 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Cell _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1097-4172 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 189 _citation.language ? _citation.page_first 1356 _citation.page_last 1370.e26 _citation.title 'Human genetics guides the discovery of CARD9 inhibitors with anti-inflammatory activity.' _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.cell.2025.12.013 _citation.pdbx_database_id_PubMed 41547356 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Rush, J.S.' 1 ? primary 'Wertheimer, J.D.' 2 ? primary 'Goldberg, S.D.' 3 ? primary 'Raymond, D.' 4 ? primary 'Szuchnicki, M.' 5 ? primary 'Baltus, A.J.' 6 ? primary 'Branson, J.' 7 ? primary 'Stratton, C.F.' 8 ? primary 'Patrick, A.N.' 9 ? primary 'Steele, R.' 10 ? primary 'Adhikary, S.' 11 ? primary 'Del Rosario, A.' 12 ? primary 'Liu, A.' 13 ? primary 'Gomersall, N.J.' 14 ? primary 'Chung, M.' 15 ? primary 'Ranaghan, M.J.' 16 ? primary 'Gu, X.' 17 ? primary 'Brandt, M.' 18 ? primary 'Cao, Z.' 19 ? primary 'Bebenek, A.' 20 ? primary 'Oliver, B.A.' 21 ? primary 'Hoebe, K.' 22 ? primary 'Szewczuk, L.M.' 23 ? primary 'Venable, J.D.' 24 ? primary 'Graham, D.B.' 25 ? primary 'Towne, J.' 26 ? primary 'Xavier, R.J.' 27 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Caspase recruitment domain-containing protein 9' 7139.121 8 ? ? ? ? 2 non-polymer syn ;(2P)-2-(1-benzyl-3-phenyl-1H-pyrazol-4-yl)-5-chloro-1-[(1R)-1-cyclohexyl-2-(methylamino)-2-oxoethyl]-1H-1,3-benzimidazole-6-carboxylic acid ; 582.092 2 ? ? ? ? 3 water nat water 18.015 7 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name hCARD9 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code AKHQERVQRLKEECEAGSRELKRCKEENYDLAMRLAHQSEEKGAALMRNRDLQLEIDQLK _entity_poly.pdbx_seq_one_letter_code_can AKHQERVQRLKEECEAGSRELKRCKEENYDLAMRLAHQSEEKGAALMRNRDLQLEIDQLK _entity_poly.pdbx_strand_id A,B,C,D,E,F,G,H _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;(2P)-2-(1-benzyl-3-phenyl-1H-pyrazol-4-yl)-5-chloro-1-[(1R)-1-cyclohexyl-2-(methylamino)-2-oxoethyl]-1H-1,3-benzimidazole-6-carboxylic acid ; A1AG7 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 LYS n 1 3 HIS n 1 4 GLN n 1 5 GLU n 1 6 ARG n 1 7 VAL n 1 8 GLN n 1 9 ARG n 1 10 LEU n 1 11 LYS n 1 12 GLU n 1 13 GLU n 1 14 CYS n 1 15 GLU n 1 16 ALA n 1 17 GLY n 1 18 SER n 1 19 ARG n 1 20 GLU n 1 21 LEU n 1 22 LYS n 1 23 ARG n 1 24 CYS n 1 25 LYS n 1 26 GLU n 1 27 GLU n 1 28 ASN n 1 29 TYR n 1 30 ASP n 1 31 LEU n 1 32 ALA n 1 33 MET n 1 34 ARG n 1 35 LEU n 1 36 ALA n 1 37 HIS n 1 38 GLN n 1 39 SER n 1 40 GLU n 1 41 GLU n 1 42 LYS n 1 43 GLY n 1 44 ALA n 1 45 ALA n 1 46 LEU n 1 47 MET n 1 48 ARG n 1 49 ASN n 1 50 ARG n 1 51 ASP n 1 52 LEU n 1 53 GLN n 1 54 LEU n 1 55 GLU n 1 56 ILE n 1 57 ASP n 1 58 GLN n 1 59 LEU n 1 60 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 60 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CARD9 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1AG7 non-polymer . ;(2P)-2-(1-benzyl-3-phenyl-1H-pyrazol-4-yl)-5-chloro-1-[(1R)-1-cyclohexyl-2-(methylamino)-2-oxoethyl]-1H-1,3-benzimidazole-6-carboxylic acid ; ? 'C33 H32 Cl N5 O3' 582.092 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 155 ? ? ? A . n A 1 2 LYS 2 156 ? ? ? A . n A 1 3 HIS 3 157 ? ? ? A . n A 1 4 GLN 4 158 158 GLN GLN A . n A 1 5 GLU 5 159 159 GLU GLU A . n A 1 6 ARG 6 160 160 ARG ARG A . n A 1 7 VAL 7 161 161 VAL VAL A . n A 1 8 GLN 8 162 162 GLN GLN A . n A 1 9 ARG 9 163 163 ARG ARG A . n A 1 10 LEU 10 164 164 LEU LEU A . n A 1 11 LYS 11 165 165 LYS LYS A . n A 1 12 GLU 12 166 166 GLU GLU A . n A 1 13 GLU 13 167 167 GLU GLU A . n A 1 14 CYS 14 168 168 CYS CYS A . n A 1 15 GLU 15 169 169 GLU GLU A . n A 1 16 ALA 16 170 170 ALA ALA A . n A 1 17 GLY 17 171 171 GLY GLY A . n A 1 18 SER 18 172 172 SER SER A . n A 1 19 ARG 19 173 173 ARG ARG A . n A 1 20 GLU 20 174 174 GLU GLU A . n A 1 21 LEU 21 175 175 LEU LEU A . n A 1 22 LYS 22 176 176 LYS LYS A . n A 1 23 ARG 23 177 177 ARG ARG A . n A 1 24 CYS 24 178 178 CYS CYS A . n A 1 25 LYS 25 179 179 LYS LYS A . n A 1 26 GLU 26 180 180 GLU GLU A . n A 1 27 GLU 27 181 181 GLU GLU A . n A 1 28 ASN 28 182 182 ASN ASN A . n A 1 29 TYR 29 183 183 TYR TYR A . n A 1 30 ASP 30 184 184 ASP ASP A . n A 1 31 LEU 31 185 185 LEU LEU A . n A 1 32 ALA 32 186 186 ALA ALA A . n A 1 33 MET 33 187 187 MET MET A . n A 1 34 ARG 34 188 188 ARG ARG A . n A 1 35 LEU 35 189 189 LEU LEU A . n A 1 36 ALA 36 190 190 ALA ALA A . n A 1 37 HIS 37 191 191 HIS HIS A . n A 1 38 GLN 38 192 192 GLN GLN A . n A 1 39 SER 39 193 193 SER SER A . n A 1 40 GLU 40 194 194 GLU GLU A . n A 1 41 GLU 41 195 195 GLU GLU A . n A 1 42 LYS 42 196 196 LYS LYS A . n A 1 43 GLY 43 197 197 GLY GLY A . n A 1 44 ALA 44 198 198 ALA ALA A . n A 1 45 ALA 45 199 199 ALA ALA A . n A 1 46 LEU 46 200 200 LEU LEU A . n A 1 47 MET 47 201 201 MET MET A . n A 1 48 ARG 48 202 202 ARG ARG A . n A 1 49 ASN 49 203 203 ASN ASN A . n A 1 50 ARG 50 204 204 ARG ARG A . n A 1 51 ASP 51 205 205 ASP ASP A . n A 1 52 LEU 52 206 206 LEU LEU A . n A 1 53 GLN 53 207 207 GLN GLN A . n A 1 54 LEU 54 208 208 LEU LEU A . n A 1 55 GLU 55 209 209 GLU GLU A . n A 1 56 ILE 56 210 210 ILE ILE A . n A 1 57 ASP 57 211 211 ASP ASP A . n A 1 58 GLN 58 212 212 GLN GLN A . n A 1 59 LEU 59 213 213 LEU LEU A . n A 1 60 LYS 60 214 214 LYS LYS A . n B 1 1 ALA 1 155 ? ? ? B . n B 1 2 LYS 2 156 ? ? ? B . n B 1 3 HIS 3 157 ? ? ? B . n B 1 4 GLN 4 158 158 GLN GLN B . n B 1 5 GLU 5 159 159 GLU GLU B . n B 1 6 ARG 6 160 160 ARG ARG B . n B 1 7 VAL 7 161 161 VAL VAL B . n B 1 8 GLN 8 162 162 GLN GLN B . n B 1 9 ARG 9 163 163 ARG ARG B . n B 1 10 LEU 10 164 164 LEU LEU B . n B 1 11 LYS 11 165 165 LYS LYS B . n B 1 12 GLU 12 166 166 GLU GLU B . n B 1 13 GLU 13 167 167 GLU GLU B . n B 1 14 CYS 14 168 168 CYS CYS B . n B 1 15 GLU 15 169 169 GLU GLU B . n B 1 16 ALA 16 170 170 ALA ALA B . n B 1 17 GLY 17 171 171 GLY GLY B . n B 1 18 SER 18 172 172 SER SER B . n B 1 19 ARG 19 173 173 ARG ARG B . n B 1 20 GLU 20 174 174 GLU GLU B . n B 1 21 LEU 21 175 175 LEU LEU B . n B 1 22 LYS 22 176 176 LYS LYS B . n B 1 23 ARG 23 177 177 ARG ARG B . n B 1 24 CYS 24 178 178 CYS CYS B . n B 1 25 LYS 25 179 179 LYS LYS B . n B 1 26 GLU 26 180 180 GLU GLU B . n B 1 27 GLU 27 181 181 GLU GLU B . n B 1 28 ASN 28 182 182 ASN ASN B . n B 1 29 TYR 29 183 183 TYR TYR B . n B 1 30 ASP 30 184 184 ASP ASP B . n B 1 31 LEU 31 185 185 LEU LEU B . n B 1 32 ALA 32 186 186 ALA ALA B . n B 1 33 MET 33 187 187 MET MET B . n B 1 34 ARG 34 188 188 ARG ARG B . n B 1 35 LEU 35 189 189 LEU LEU B . n B 1 36 ALA 36 190 190 ALA ALA B . n B 1 37 HIS 37 191 191 HIS HIS B . n B 1 38 GLN 38 192 192 GLN GLN B . n B 1 39 SER 39 193 193 SER SER B . n B 1 40 GLU 40 194 194 GLU GLU B . n B 1 41 GLU 41 195 195 GLU GLU B . n B 1 42 LYS 42 196 196 LYS LYS B . n B 1 43 GLY 43 197 197 GLY GLY B . n B 1 44 ALA 44 198 198 ALA ALA B . n B 1 45 ALA 45 199 199 ALA ALA B . n B 1 46 LEU 46 200 200 LEU LEU B . n B 1 47 MET 47 201 201 MET MET B . n B 1 48 ARG 48 202 202 ARG ARG B . n B 1 49 ASN 49 203 203 ASN ASN B . n B 1 50 ARG 50 204 204 ARG ARG B . n B 1 51 ASP 51 205 205 ASP ASP B . n B 1 52 LEU 52 206 206 LEU LEU B . n B 1 53 GLN 53 207 207 GLN GLN B . n B 1 54 LEU 54 208 208 LEU LEU B . n B 1 55 GLU 55 209 209 GLU GLU B . n B 1 56 ILE 56 210 210 ILE ILE B . n B 1 57 ASP 57 211 211 ASP ASP B . n B 1 58 GLN 58 212 212 GLN GLN B . n B 1 59 LEU 59 213 213 LEU LEU B . n B 1 60 LYS 60 214 214 LYS LYS B . n C 1 1 ALA 1 155 ? ? ? C . n C 1 2 LYS 2 156 ? ? ? C . n C 1 3 HIS 3 157 ? ? ? C . n C 1 4 GLN 4 158 158 GLN GLN C . n C 1 5 GLU 5 159 159 GLU GLU C . n C 1 6 ARG 6 160 160 ARG ARG C . n C 1 7 VAL 7 161 161 VAL VAL C . n C 1 8 GLN 8 162 162 GLN GLN C . n C 1 9 ARG 9 163 163 ARG ARG C . n C 1 10 LEU 10 164 164 LEU LEU C . n C 1 11 LYS 11 165 165 LYS LYS C . n C 1 12 GLU 12 166 166 GLU GLU C . n C 1 13 GLU 13 167 167 GLU GLU C . n C 1 14 CYS 14 168 168 CYS CYS C . n C 1 15 GLU 15 169 169 GLU GLU C . n C 1 16 ALA 16 170 170 ALA ALA C . n C 1 17 GLY 17 171 171 GLY GLY C . n C 1 18 SER 18 172 172 SER SER C . n C 1 19 ARG 19 173 173 ARG ARG C . n C 1 20 GLU 20 174 174 GLU GLU C . n C 1 21 LEU 21 175 175 LEU LEU C . n C 1 22 LYS 22 176 176 LYS LYS C . n C 1 23 ARG 23 177 177 ARG ARG C . n C 1 24 CYS 24 178 178 CYS CYS C . n C 1 25 LYS 25 179 179 LYS LYS C . n C 1 26 GLU 26 180 180 GLU GLU C . n C 1 27 GLU 27 181 181 GLU GLU C . n C 1 28 ASN 28 182 182 ASN ASN C . n C 1 29 TYR 29 183 183 TYR TYR C . n C 1 30 ASP 30 184 184 ASP ASP C . n C 1 31 LEU 31 185 185 LEU LEU C . n C 1 32 ALA 32 186 186 ALA ALA C . n C 1 33 MET 33 187 187 MET MET C . n C 1 34 ARG 34 188 188 ARG ARG C . n C 1 35 LEU 35 189 189 LEU LEU C . n C 1 36 ALA 36 190 190 ALA ALA C . n C 1 37 HIS 37 191 191 HIS HIS C . n C 1 38 GLN 38 192 192 GLN GLN C . n C 1 39 SER 39 193 193 SER SER C . n C 1 40 GLU 40 194 194 GLU GLU C . n C 1 41 GLU 41 195 195 GLU GLU C . n C 1 42 LYS 42 196 196 LYS LYS C . n C 1 43 GLY 43 197 197 GLY GLY C . n C 1 44 ALA 44 198 198 ALA ALA C . n C 1 45 ALA 45 199 199 ALA ALA C . n C 1 46 LEU 46 200 200 LEU LEU C . n C 1 47 MET 47 201 201 MET MET C . n C 1 48 ARG 48 202 202 ARG ARG C . n C 1 49 ASN 49 203 203 ASN ASN C . n C 1 50 ARG 50 204 204 ARG ARG C . n C 1 51 ASP 51 205 205 ASP ASP C . n C 1 52 LEU 52 206 206 LEU LEU C . n C 1 53 GLN 53 207 207 GLN GLN C . n C 1 54 LEU 54 208 208 LEU LEU C . n C 1 55 GLU 55 209 209 GLU GLU C . n C 1 56 ILE 56 210 210 ILE ILE C . n C 1 57 ASP 57 211 211 ASP ASP C . n C 1 58 GLN 58 212 212 GLN GLN C . n C 1 59 LEU 59 213 213 LEU LEU C . n C 1 60 LYS 60 214 214 LYS LYS C . n D 1 1 ALA 1 155 ? ? ? D . n D 1 2 LYS 2 156 ? ? ? D . n D 1 3 HIS 3 157 ? ? ? D . n D 1 4 GLN 4 158 158 GLN GLN D . n D 1 5 GLU 5 159 159 GLU GLU D . n D 1 6 ARG 6 160 160 ARG ARG D . n D 1 7 VAL 7 161 161 VAL VAL D . n D 1 8 GLN 8 162 162 GLN GLN D . n D 1 9 ARG 9 163 163 ARG ARG D . n D 1 10 LEU 10 164 164 LEU LEU D . n D 1 11 LYS 11 165 165 LYS LYS D . n D 1 12 GLU 12 166 166 GLU GLU D . n D 1 13 GLU 13 167 167 GLU GLU D . n D 1 14 CYS 14 168 168 CYS CYS D . n D 1 15 GLU 15 169 169 GLU GLU D . n D 1 16 ALA 16 170 170 ALA ALA D . n D 1 17 GLY 17 171 171 GLY GLY D . n D 1 18 SER 18 172 172 SER SER D . n D 1 19 ARG 19 173 173 ARG ARG D . n D 1 20 GLU 20 174 174 GLU GLU D . n D 1 21 LEU 21 175 175 LEU LEU D . n D 1 22 LYS 22 176 176 LYS LYS D . n D 1 23 ARG 23 177 177 ARG ARG D . n D 1 24 CYS 24 178 178 CYS CYS D . n D 1 25 LYS 25 179 179 LYS LYS D . n D 1 26 GLU 26 180 180 GLU GLU D . n D 1 27 GLU 27 181 181 GLU GLU D . n D 1 28 ASN 28 182 182 ASN ASN D . n D 1 29 TYR 29 183 183 TYR TYR D . n D 1 30 ASP 30 184 184 ASP ASP D . n D 1 31 LEU 31 185 185 LEU LEU D . n D 1 32 ALA 32 186 186 ALA ALA D . n D 1 33 MET 33 187 187 MET MET D . n D 1 34 ARG 34 188 188 ARG ARG D . n D 1 35 LEU 35 189 189 LEU LEU D . n D 1 36 ALA 36 190 190 ALA ALA D . n D 1 37 HIS 37 191 191 HIS HIS D . n D 1 38 GLN 38 192 192 GLN GLN D . n D 1 39 SER 39 193 193 SER SER D . n D 1 40 GLU 40 194 194 GLU GLU D . n D 1 41 GLU 41 195 195 GLU GLU D . n D 1 42 LYS 42 196 196 LYS LYS D . n D 1 43 GLY 43 197 197 GLY GLY D . n D 1 44 ALA 44 198 198 ALA ALA D . n D 1 45 ALA 45 199 199 ALA ALA D . n D 1 46 LEU 46 200 200 LEU LEU D . n D 1 47 MET 47 201 201 MET MET D . n D 1 48 ARG 48 202 202 ARG ARG D . n D 1 49 ASN 49 203 203 ASN ASN D . n D 1 50 ARG 50 204 204 ARG ARG D . n D 1 51 ASP 51 205 205 ASP ASP D . n D 1 52 LEU 52 206 206 LEU LEU D . n D 1 53 GLN 53 207 207 GLN GLN D . n D 1 54 LEU 54 208 208 LEU LEU D . n D 1 55 GLU 55 209 209 GLU GLU D . n D 1 56 ILE 56 210 210 ILE ILE D . n D 1 57 ASP 57 211 211 ASP ASP D . n D 1 58 GLN 58 212 212 GLN GLN D . n D 1 59 LEU 59 213 213 LEU LEU D . n D 1 60 LYS 60 214 214 LYS LYS D . n E 1 1 ALA 1 155 ? ? ? E . n E 1 2 LYS 2 156 ? ? ? E . n E 1 3 HIS 3 157 ? ? ? E . n E 1 4 GLN 4 158 ? ? ? E . n E 1 5 GLU 5 159 ? ? ? E . n E 1 6 ARG 6 160 ? ? ? E . n E 1 7 VAL 7 161 ? ? ? E . n E 1 8 GLN 8 162 162 GLN GLN E . n E 1 9 ARG 9 163 163 ARG ARG E . n E 1 10 LEU 10 164 164 LEU LEU E . n E 1 11 LYS 11 165 165 LYS LYS E . n E 1 12 GLU 12 166 166 GLU GLU E . n E 1 13 GLU 13 167 167 GLU GLU E . n E 1 14 CYS 14 168 168 CYS CYS E . n E 1 15 GLU 15 169 169 GLU GLU E . n E 1 16 ALA 16 170 170 ALA ALA E . n E 1 17 GLY 17 171 171 GLY GLY E . n E 1 18 SER 18 172 172 SER SER E . n E 1 19 ARG 19 173 173 ARG ARG E . n E 1 20 GLU 20 174 174 GLU GLU E . n E 1 21 LEU 21 175 175 LEU LEU E . n E 1 22 LYS 22 176 176 LYS LYS E . n E 1 23 ARG 23 177 177 ARG ARG E . n E 1 24 CYS 24 178 178 CYS CYS E . n E 1 25 LYS 25 179 179 LYS LYS E . n E 1 26 GLU 26 180 180 GLU GLU E . n E 1 27 GLU 27 181 181 GLU GLU E . n E 1 28 ASN 28 182 182 ASN ASN E . n E 1 29 TYR 29 183 183 TYR TYR E . n E 1 30 ASP 30 184 184 ASP ASP E . n E 1 31 LEU 31 185 185 LEU LEU E . n E 1 32 ALA 32 186 186 ALA ALA E . n E 1 33 MET 33 187 187 MET MET E . n E 1 34 ARG 34 188 188 ARG ARG E . n E 1 35 LEU 35 189 189 LEU LEU E . n E 1 36 ALA 36 190 190 ALA ALA E . n E 1 37 HIS 37 191 191 HIS HIS E . n E 1 38 GLN 38 192 192 GLN GLN E . n E 1 39 SER 39 193 193 SER SER E . n E 1 40 GLU 40 194 194 GLU GLU E . n E 1 41 GLU 41 195 195 GLU GLU E . n E 1 42 LYS 42 196 196 LYS LYS E . n E 1 43 GLY 43 197 197 GLY GLY E . n E 1 44 ALA 44 198 198 ALA ALA E . n E 1 45 ALA 45 199 199 ALA ALA E . n E 1 46 LEU 46 200 200 LEU LEU E . n E 1 47 MET 47 201 201 MET MET E . n E 1 48 ARG 48 202 202 ARG ARG E . n E 1 49 ASN 49 203 203 ASN ASN E . n E 1 50 ARG 50 204 204 ARG ARG E . n E 1 51 ASP 51 205 205 ASP ASP E . n E 1 52 LEU 52 206 206 LEU LEU E . n E 1 53 GLN 53 207 207 GLN GLN E . n E 1 54 LEU 54 208 208 LEU LEU E . n E 1 55 GLU 55 209 209 GLU GLU E . n E 1 56 ILE 56 210 210 ILE ILE E . n E 1 57 ASP 57 211 211 ASP ASP E . n E 1 58 GLN 58 212 212 GLN GLN E . n E 1 59 LEU 59 213 213 LEU LEU E . n E 1 60 LYS 60 214 214 LYS LYS E . n F 1 1 ALA 1 155 ? ? ? F . n F 1 2 LYS 2 156 ? ? ? F . n F 1 3 HIS 3 157 ? ? ? F . n F 1 4 GLN 4 158 ? ? ? F . n F 1 5 GLU 5 159 ? ? ? F . n F 1 6 ARG 6 160 160 ARG ARG F . n F 1 7 VAL 7 161 161 VAL VAL F . n F 1 8 GLN 8 162 162 GLN GLN F . n F 1 9 ARG 9 163 163 ARG ARG F . n F 1 10 LEU 10 164 164 LEU LEU F . n F 1 11 LYS 11 165 165 LYS LYS F . n F 1 12 GLU 12 166 166 GLU GLU F . n F 1 13 GLU 13 167 167 GLU GLU F . n F 1 14 CYS 14 168 168 CYS CYS F . n F 1 15 GLU 15 169 169 GLU GLU F . n F 1 16 ALA 16 170 170 ALA ALA F . n F 1 17 GLY 17 171 171 GLY GLY F . n F 1 18 SER 18 172 172 SER SER F . n F 1 19 ARG 19 173 173 ARG ARG F . n F 1 20 GLU 20 174 174 GLU GLU F . n F 1 21 LEU 21 175 175 LEU LEU F . n F 1 22 LYS 22 176 176 LYS LYS F . n F 1 23 ARG 23 177 177 ARG ARG F . n F 1 24 CYS 24 178 178 CYS CYS F . n F 1 25 LYS 25 179 179 LYS LYS F . n F 1 26 GLU 26 180 180 GLU GLU F . n F 1 27 GLU 27 181 181 GLU GLU F . n F 1 28 ASN 28 182 182 ASN ASN F . n F 1 29 TYR 29 183 183 TYR TYR F . n F 1 30 ASP 30 184 184 ASP ASP F . n F 1 31 LEU 31 185 185 LEU LEU F . n F 1 32 ALA 32 186 186 ALA ALA F . n F 1 33 MET 33 187 187 MET MET F . n F 1 34 ARG 34 188 188 ARG ARG F . n F 1 35 LEU 35 189 189 LEU LEU F . n F 1 36 ALA 36 190 190 ALA ALA F . n F 1 37 HIS 37 191 191 HIS HIS F . n F 1 38 GLN 38 192 192 GLN GLN F . n F 1 39 SER 39 193 193 SER SER F . n F 1 40 GLU 40 194 194 GLU GLU F . n F 1 41 GLU 41 195 195 GLU GLU F . n F 1 42 LYS 42 196 196 LYS LYS F . n F 1 43 GLY 43 197 197 GLY GLY F . n F 1 44 ALA 44 198 198 ALA ALA F . n F 1 45 ALA 45 199 199 ALA ALA F . n F 1 46 LEU 46 200 200 LEU LEU F . n F 1 47 MET 47 201 201 MET MET F . n F 1 48 ARG 48 202 202 ARG ARG F . n F 1 49 ASN 49 203 203 ASN ASN F . n F 1 50 ARG 50 204 204 ARG ARG F . n F 1 51 ASP 51 205 205 ASP ASP F . n F 1 52 LEU 52 206 206 LEU LEU F . n F 1 53 GLN 53 207 207 GLN GLN F . n F 1 54 LEU 54 208 208 LEU LEU F . n F 1 55 GLU 55 209 209 GLU GLU F . n F 1 56 ILE 56 210 210 ILE ILE F . n F 1 57 ASP 57 211 211 ASP ASP F . n F 1 58 GLN 58 212 212 GLN GLN F . n F 1 59 LEU 59 213 213 LEU LEU F . n F 1 60 LYS 60 214 ? ? ? F . n G 1 1 ALA 1 155 ? ? ? G . n G 1 2 LYS 2 156 ? ? ? G . n G 1 3 HIS 3 157 ? ? ? G . n G 1 4 GLN 4 158 ? ? ? G . n G 1 5 GLU 5 159 ? ? ? G . n G 1 6 ARG 6 160 ? ? ? G . n G 1 7 VAL 7 161 161 VAL VAL G . n G 1 8 GLN 8 162 162 GLN GLN G . n G 1 9 ARG 9 163 163 ARG ARG G . n G 1 10 LEU 10 164 164 LEU LEU G . n G 1 11 LYS 11 165 165 LYS LYS G . n G 1 12 GLU 12 166 166 GLU GLU G . n G 1 13 GLU 13 167 167 GLU GLU G . n G 1 14 CYS 14 168 168 CYS CYS G . n G 1 15 GLU 15 169 169 GLU GLU G . n G 1 16 ALA 16 170 170 ALA ALA G . n G 1 17 GLY 17 171 171 GLY GLY G . n G 1 18 SER 18 172 172 SER SER G . n G 1 19 ARG 19 173 173 ARG ARG G . n G 1 20 GLU 20 174 174 GLU GLU G . n G 1 21 LEU 21 175 175 LEU LEU G . n G 1 22 LYS 22 176 176 LYS LYS G . n G 1 23 ARG 23 177 177 ARG ARG G . n G 1 24 CYS 24 178 178 CYS CYS G . n G 1 25 LYS 25 179 179 LYS LYS G . n G 1 26 GLU 26 180 180 GLU GLU G . n G 1 27 GLU 27 181 181 GLU GLU G . n G 1 28 ASN 28 182 182 ASN ASN G . n G 1 29 TYR 29 183 183 TYR TYR G . n G 1 30 ASP 30 184 184 ASP ASP G . n G 1 31 LEU 31 185 185 LEU LEU G . n G 1 32 ALA 32 186 186 ALA ALA G . n G 1 33 MET 33 187 187 MET MET G . n G 1 34 ARG 34 188 188 ARG ARG G . n G 1 35 LEU 35 189 189 LEU LEU G . n G 1 36 ALA 36 190 190 ALA ALA G . n G 1 37 HIS 37 191 191 HIS HIS G . n G 1 38 GLN 38 192 192 GLN GLN G . n G 1 39 SER 39 193 193 SER SER G . n G 1 40 GLU 40 194 194 GLU GLU G . n G 1 41 GLU 41 195 195 GLU GLU G . n G 1 42 LYS 42 196 196 LYS LYS G . n G 1 43 GLY 43 197 197 GLY GLY G . n G 1 44 ALA 44 198 198 ALA ALA G . n G 1 45 ALA 45 199 199 ALA ALA G . n G 1 46 LEU 46 200 200 LEU LEU G . n G 1 47 MET 47 201 201 MET MET G . n G 1 48 ARG 48 202 202 ARG ARG G . n G 1 49 ASN 49 203 203 ASN ASN G . n G 1 50 ARG 50 204 204 ARG ARG G . n G 1 51 ASP 51 205 205 ASP ASP G . n G 1 52 LEU 52 206 206 LEU LEU G . n G 1 53 GLN 53 207 207 GLN GLN G . n G 1 54 LEU 54 208 208 LEU LEU G . n G 1 55 GLU 55 209 209 GLU GLU G . n G 1 56 ILE 56 210 210 ILE ILE G . n G 1 57 ASP 57 211 211 ASP ASP G . n G 1 58 GLN 58 212 212 GLN GLN G . n G 1 59 LEU 59 213 213 LEU LEU G . n G 1 60 LYS 60 214 ? ? ? G . n H 1 1 ALA 1 155 ? ? ? H . n H 1 2 LYS 2 156 ? ? ? H . n H 1 3 HIS 3 157 ? ? ? H . n H 1 4 GLN 4 158 ? ? ? H . n H 1 5 GLU 5 159 ? ? ? H . n H 1 6 ARG 6 160 ? ? ? H . n H 1 7 VAL 7 161 ? ? ? H . n H 1 8 GLN 8 162 162 GLN GLN H . n H 1 9 ARG 9 163 163 ARG ARG H . n H 1 10 LEU 10 164 164 LEU LEU H . n H 1 11 LYS 11 165 165 LYS LYS H . n H 1 12 GLU 12 166 166 GLU GLU H . n H 1 13 GLU 13 167 167 GLU GLU H . n H 1 14 CYS 14 168 168 CYS CYS H . n H 1 15 GLU 15 169 169 GLU GLU H . n H 1 16 ALA 16 170 170 ALA ALA H . n H 1 17 GLY 17 171 171 GLY GLY H . n H 1 18 SER 18 172 172 SER SER H . n H 1 19 ARG 19 173 173 ARG ARG H . n H 1 20 GLU 20 174 174 GLU GLU H . n H 1 21 LEU 21 175 175 LEU LEU H . n H 1 22 LYS 22 176 176 LYS LYS H . n H 1 23 ARG 23 177 177 ARG ARG H . n H 1 24 CYS 24 178 178 CYS CYS H . n H 1 25 LYS 25 179 179 LYS LYS H . n H 1 26 GLU 26 180 180 GLU GLU H . n H 1 27 GLU 27 181 181 GLU GLU H . n H 1 28 ASN 28 182 182 ASN ASN H . n H 1 29 TYR 29 183 183 TYR TYR H . n H 1 30 ASP 30 184 184 ASP ASP H . n H 1 31 LEU 31 185 185 LEU LEU H . n H 1 32 ALA 32 186 186 ALA ALA H . n H 1 33 MET 33 187 187 MET MET H . n H 1 34 ARG 34 188 188 ARG ARG H . n H 1 35 LEU 35 189 189 LEU LEU H . n H 1 36 ALA 36 190 190 ALA ALA H . n H 1 37 HIS 37 191 191 HIS HIS H . n H 1 38 GLN 38 192 192 GLN GLN H . n H 1 39 SER 39 193 193 SER SER H . n H 1 40 GLU 40 194 194 GLU GLU H . n H 1 41 GLU 41 195 195 GLU GLU H . n H 1 42 LYS 42 196 196 LYS LYS H . n H 1 43 GLY 43 197 197 GLY GLY H . n H 1 44 ALA 44 198 198 ALA ALA H . n H 1 45 ALA 45 199 199 ALA ALA H . n H 1 46 LEU 46 200 200 LEU LEU H . n H 1 47 MET 47 201 201 MET MET H . n H 1 48 ARG 48 202 202 ARG ARG H . n H 1 49 ASN 49 203 203 ASN ASN H . n H 1 50 ARG 50 204 204 ARG ARG H . n H 1 51 ASP 51 205 205 ASP ASP H . n H 1 52 LEU 52 206 206 LEU LEU H . n H 1 53 GLN 53 207 207 GLN GLN H . n H 1 54 LEU 54 208 208 LEU LEU H . n H 1 55 GLU 55 209 209 GLU GLU H . n H 1 56 ILE 56 210 210 ILE ILE H . n H 1 57 ASP 57 211 211 ASP ASP H . n H 1 58 GLN 58 212 212 GLN GLN H . n H 1 59 LEU 59 213 213 LEU LEU H . n H 1 60 LYS 60 214 ? ? ? H . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1AG7 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1AG7 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code I 2 A1AG7 1 301 301 A1AG7 BRD A . J 2 A1AG7 1 301 301 A1AG7 BRD D . K 3 HOH 1 401 2 HOH HOH A . K 3 HOH 2 402 4 HOH HOH A . K 3 HOH 3 403 5 HOH HOH A . L 3 HOH 1 301 1 HOH HOH B . M 3 HOH 1 401 7 HOH HOH D . M 3 HOH 2 402 6 HOH HOH D . N 3 HOH 1 301 3 HOH HOH G . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? '2.10.3 (6-FEB-2020)' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 97.75 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9AVN _cell.details ? _cell.formula_units_Z ? _cell.length_a 56.390 _cell.length_a_esd ? _cell.length_b 56.050 _cell.length_b_esd ? _cell.length_c 84.300 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9AVN _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9AVN _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.33 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.31 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '8-14% PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 298 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-03-20 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 17-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9AVN _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.726 _reflns.d_resolution_low 83.53 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 25922 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 95.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 1.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.64 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.09699999999999999 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.995 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.07 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.73 2.8 ? ? ? ? ? ? 2007 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.695 ? ? 1 1 0.695 ? ? ? ? 0.507 ? ? ? ? ? ? ? ? ? 2.80 2.87 ? ? ? ? ? ? 1871 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.524 ? ? 2 1 0.795 ? ? ? ? 0.382 ? ? ? ? ? ? ? ? ? 2.87 2.96 ? ? ? ? ? ? 1873 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.39 ? ? 3 1 0.887 ? ? ? ? 0.28300000000000003 ? ? ? ? ? ? ? ? ? 2.96 3.05 ? ? ? ? ? ? 1783 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.315 ? ? 4 1 0.905 ? ? ? ? 0.228 ? ? ? ? ? ? ? ? ? 3.05 3.15 ? ? ? ? ? ? 1737 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.264 ? ? 5 1 0.9329999999999999 ? ? ? ? 0.192 ? ? ? ? ? ? ? ? ? 3.15 3.26 ? ? ? ? ? ? 1632 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.21600000000000003 ? ? 6 1 0.945 ? ? ? ? 0.158 ? ? ? ? ? ? ? ? ? 3.26 3.38 ? ? ? ? ? ? 1583 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.19 ? ? 7 1 0.961 ? ? ? ? 0.138 ? ? ? ? ? ? ? ? ? 3.38 3.52 ? ? ? ? ? ? 1580 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.155 ? ? 8 1 0.97 ? ? ? ? 0.11199999999999999 ? ? ? ? ? ? ? ? ? 3.52 3.68 ? ? ? ? ? ? 1430 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.127 ? ? 9 1 0.977 ? ? ? ? 0.09300000000000001 ? ? ? ? ? ? ? ? ? 3.68 3.86 ? ? ? ? ? ? 1387 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.107 ? ? 10 1 0.9840000000000001 ? ? ? ? 0.077 ? ? ? ? ? ? ? ? ? 3.86 4.06 ? ? ? ? ? ? 1345 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.086 ? ? 11 1 0.993 ? ? ? ? 0.062 ? ? ? ? ? ? ? ? ? 4.06 4.31 ? ? ? ? ? ? 1248 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.08199999999999999 ? ? 12 1 0.993 ? ? ? ? 0.059000000000000004 ? ? ? ? ? ? ? ? ? 4.31 4.61 ? ? ? ? ? ? 1168 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.075 ? ? 13 1 0.992 ? ? ? ? 0.054000000000000006 ? ? ? ? ? ? ? ? ? 4.61 4.98 ? ? ? ? ? ? 1104 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.062 ? ? 14 1 0.997 ? ? ? ? 0.044000000000000004 ? ? ? ? ? ? ? ? ? 4.98 5.45 ? ? ? ? ? ? 993 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.064 ? ? 15 1 0.997 ? ? ? ? 0.045 ? ? ? ? ? ? ? ? ? 5.45 6.1 ? ? ? ? ? ? 909 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.094 ? ? 16 1 0.9890000000000001 ? ? ? ? 0.067 ? ? ? ? ? ? ? ? ? 6.10 7.04 ? ? ? ? ? ? 804 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.071 ? ? 17 1 0.996 ? ? ? ? 0.051 ? ? ? ? ? ? ? ? ? 7.04 8.62 ? ? ? ? ? ? 670 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.057999999999999996 ? ? 18 1 0.995 ? ? ? ? 0.040999999999999995 ? ? ? ? ? ? ? ? ? 8.62 12.19 ? ? ? ? ? ? 513 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.05 ? ? 19 1 0.995 ? ? ? ? 0.035 ? ? ? ? ? ? ? ? ? 12.19 83.53 ? ? ? ? ? ? 285 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.059000000000000004 ? ? 20 1 0.993 ? ? ? ? 0.042 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] -4.73250 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] -5.37560 _refine.aniso_B[2][2] -10.75950 _refine.aniso_B[2][3] 0.00000 _refine.aniso_B[3][3] 15.49200 _refine.B_iso_max ? _refine.B_iso_mean 68.81 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.877 _refine.correlation_coeff_Fo_to_Fc_free 0.862 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9AVN _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.726 _refine.ls_d_res_low 83.53 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13975 _refine.ls_number_reflns_R_free 708 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.8 _refine.ls_percent_reflns_R_free 5.070 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2756 _refine.ls_R_factor_R_free 0.2988 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2743 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI 0.409 _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 9AVN _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.49 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.726 _refine_hist.d_res_low 83.53 _refine_hist.number_atoms_solvent 7 _refine_hist.number_atoms_total 3713 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 3622 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 84 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 3728 ? t_bond_d 2.00 HARMONIC 'X-RAY DIFFRACTION' ? 0.87 ? 4943 ? t_angle_deg 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1555 ? t_dihedral_angle_d 2.00 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_incorr_chiral_ct ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_trig_c_planes ? ? 'X-RAY DIFFRACTION' ? ? ? 733 ? t_gen_planes 5.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 3728 ? t_it 10.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? 2.24 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 21.86 ? ? ? t_other_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 434 ? t_chiral_improper_torsion 5.00 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 2999 ? t_ideal_dist_contact 4.00 SEMIHARMONIC # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.73 _refine_ls_shell.d_res_low 2.75 _refine_ls_shell.number_reflns_all 400 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free ? _refine_ls_shell.number_reflns_R_work 375 _refine_ls_shell.percent_reflns_obs 98.27 _refine_ls_shell.percent_reflns_R_free 6.25 _refine_ls_shell.R_factor_all 0.2533 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2482 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 36 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.3375 # _struct.entry_id 9AVN _struct.title 'Crystal Structure of CARD9 coiled-coil K156-K214 bound to Compound 1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9AVN _struct_keywords.text 'Adapter protein, immune system' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 1 ? F N N 1 ? G N N 1 ? H N N 1 ? I N N 2 ? J N N 2 ? K N N 3 ? L N N 3 ? M N N 3 ? N N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CARD9_HUMAN _struct_ref.pdbx_db_accession Q9H257 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KHQERVQRLKEECEAGSRELKRCKEENYDLAMRLAHQSEEKGAALMRNRDLQLEIDQLK _struct_ref.pdbx_align_begin 156 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9AVN A 2 ? 60 ? Q9H257 156 ? 214 ? 156 214 2 1 9AVN B 2 ? 60 ? Q9H257 156 ? 214 ? 156 214 3 1 9AVN C 2 ? 60 ? Q9H257 156 ? 214 ? 156 214 4 1 9AVN D 2 ? 60 ? Q9H257 156 ? 214 ? 156 214 5 1 9AVN E 2 ? 60 ? Q9H257 156 ? 214 ? 156 214 6 1 9AVN F 2 ? 60 ? Q9H257 156 ? 214 ? 156 214 7 1 9AVN G 2 ? 60 ? Q9H257 156 ? 214 ? 156 214 8 1 9AVN H 2 ? 60 ? Q9H257 156 ? 214 ? 156 214 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9AVN ALA A 1 ? UNP Q9H257 ? ? 'expression tag' 155 1 2 9AVN ALA B 1 ? UNP Q9H257 ? ? 'expression tag' 155 2 3 9AVN ALA C 1 ? UNP Q9H257 ? ? 'expression tag' 155 3 4 9AVN ALA D 1 ? UNP Q9H257 ? ? 'expression tag' 155 4 5 9AVN ALA E 1 ? UNP Q9H257 ? ? 'expression tag' 155 5 6 9AVN ALA F 1 ? UNP Q9H257 ? ? 'expression tag' 155 6 7 9AVN ALA G 1 ? UNP Q9H257 ? ? 'expression tag' 155 7 8 9AVN ALA H 1 ? UNP Q9H257 ? ? 'expression tag' 155 8 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 author_and_software_defined_assembly PISA dimeric 2 3 author_and_software_defined_assembly PISA dimeric 2 4 author_and_software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3830 ? 1 MORE -26 ? 1 'SSA (A^2)' 8680 ? 2 'ABSA (A^2)' 4000 ? 2 MORE -26 ? 2 'SSA (A^2)' 8710 ? 3 'ABSA (A^2)' 2650 ? 3 MORE -25 ? 3 'SSA (A^2)' 8530 ? 4 'ABSA (A^2)' 2680 ? 4 MORE -24 ? 4 'SSA (A^2)' 8340 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,I,K,L 2 1 C,D,J,M 3 1 E,F 4 1 G,H,N # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLN A 4 ? LEU A 59 ? GLN A 158 LEU A 213 1 ? 56 HELX_P HELX_P2 AA2 GLU B 5 ? LEU B 59 ? GLU B 159 LEU B 213 1 ? 55 HELX_P HELX_P3 AA3 GLU C 5 ? LEU C 59 ? GLU C 159 LEU C 213 1 ? 55 HELX_P HELX_P4 AA4 GLU D 5 ? LEU D 59 ? GLU D 159 LEU D 213 1 ? 55 HELX_P HELX_P5 AA5 LEU E 10 ? LEU E 59 ? LEU E 164 LEU E 213 1 ? 50 HELX_P HELX_P6 AA6 VAL F 7 ? LEU F 59 ? VAL F 161 LEU F 213 1 ? 53 HELX_P HELX_P7 AA7 GLN G 8 ? LEU G 59 ? GLN G 162 LEU G 213 1 ? 52 HELX_P HELX_P8 AA8 LEU H 10 ? LEU H 59 ? LEU H 164 LEU H 213 1 ? 50 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 14 SG ? ? ? 1_555 B CYS 14 SG ? ? A CYS 168 B CYS 168 1_555 ? ? ? ? ? ? ? 2.060 ? ? disulf2 disulf ? ? C CYS 14 SG ? ? ? 1_555 D CYS 14 SG ? ? C CYS 168 D CYS 168 1_555 ? ? ? ? ? ? ? 2.067 ? ? disulf3 disulf ? ? E CYS 14 SG ? ? ? 1_555 F CYS 14 SG ? ? E CYS 168 F CYS 168 1_555 ? ? ? ? ? ? ? 2.050 ? ? disulf4 disulf ? ? G CYS 14 SG ? ? ? 1_555 H CYS 14 SG ? ? G CYS 168 H CYS 168 1_555 ? ? ? ? ? ? ? 2.049 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 14 ? CYS B 14 ? CYS A 168 ? 1_555 CYS B 168 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS C 14 ? CYS D 14 ? CYS C 168 ? 1_555 CYS D 168 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS E 14 ? CYS F 14 ? CYS E 168 ? 1_555 CYS F 168 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS G 14 ? CYS H 14 ? CYS G 168 ? 1_555 CYS H 168 ? 1_555 SG SG . . . None 'Disulfide bridge' # _pdbx_entry_details.entry_id 9AVN _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id LEU _pdbx_validate_torsion.auth_asym_id E _pdbx_validate_torsion.auth_seq_id 213 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -103.08 _pdbx_validate_torsion.psi 42.08 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 155 ? A ALA 1 2 1 Y 1 A LYS 156 ? A LYS 2 3 1 Y 1 A HIS 157 ? A HIS 3 4 1 Y 1 B ALA 155 ? B ALA 1 5 1 Y 1 B LYS 156 ? B LYS 2 6 1 Y 1 B HIS 157 ? B HIS 3 7 1 Y 1 C ALA 155 ? C ALA 1 8 1 Y 1 C LYS 156 ? C LYS 2 9 1 Y 1 C HIS 157 ? C HIS 3 10 1 Y 1 D ALA 155 ? D ALA 1 11 1 Y 1 D LYS 156 ? D LYS 2 12 1 Y 1 D HIS 157 ? D HIS 3 13 1 Y 1 E ALA 155 ? E ALA 1 14 1 Y 1 E LYS 156 ? E LYS 2 15 1 Y 1 E HIS 157 ? E HIS 3 16 1 Y 1 E GLN 158 ? E GLN 4 17 1 Y 1 E GLU 159 ? E GLU 5 18 1 Y 1 E ARG 160 ? E ARG 6 19 1 Y 1 E VAL 161 ? E VAL 7 20 1 Y 1 F ALA 155 ? F ALA 1 21 1 Y 1 F LYS 156 ? F LYS 2 22 1 Y 1 F HIS 157 ? F HIS 3 23 1 Y 1 F GLN 158 ? F GLN 4 24 1 Y 1 F GLU 159 ? F GLU 5 25 1 Y 1 F LYS 214 ? F LYS 60 26 1 Y 1 G ALA 155 ? G ALA 1 27 1 Y 1 G LYS 156 ? G LYS 2 28 1 Y 1 G HIS 157 ? G HIS 3 29 1 Y 1 G GLN 158 ? G GLN 4 30 1 Y 1 G GLU 159 ? G GLU 5 31 1 Y 1 G ARG 160 ? G ARG 6 32 1 Y 1 G LYS 214 ? G LYS 60 33 1 Y 1 H ALA 155 ? H ALA 1 34 1 Y 1 H LYS 156 ? H LYS 2 35 1 Y 1 H HIS 157 ? H HIS 3 36 1 Y 1 H GLN 158 ? H GLN 4 37 1 Y 1 H GLU 159 ? H GLU 5 38 1 Y 1 H ARG 160 ? H ARG 6 39 1 Y 1 H VAL 161 ? H VAL 7 40 1 Y 1 H LYS 214 ? H LYS 60 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1AG7 C4 C Y N 1 A1AG7 N3 N Y N 2 A1AG7 C2 C N N 3 A1AG7 N1 N N N 4 A1AG7 C7 C N N 5 A1AG7 C6 C N N 6 A1AG7 O2 O N N 7 A1AG7 C5 C N R 8 A1AG7 CL CL N N 9 A1AG7 C C Y N 10 A1AG7 C1 C Y N 11 A1AG7 O O N N 12 A1AG7 O1 O N N 13 A1AG7 C3 C Y N 14 A1AG7 N N Y N 15 A1AG7 C8 C N N 16 A1AG7 C9 C N N 17 A1AG7 C10 C N N 18 A1AG7 C11 C N N 19 A1AG7 C12 C N N 20 A1AG7 C13 C N N 21 A1AG7 C32 C Y N 22 A1AG7 C31 C Y N 23 A1AG7 N4 N Y N 24 A1AG7 C14 C Y N 25 A1AG7 C15 C Y N 26 A1AG7 C16 C Y N 27 A1AG7 C17 C Y N 28 A1AG7 C18 C Y N 29 A1AG7 C19 C Y N 30 A1AG7 C20 C Y N 31 A1AG7 C21 C Y N 32 A1AG7 C22 C Y N 33 A1AG7 N2 N Y N 34 A1AG7 C30 C Y N 35 A1AG7 C23 C N N 36 A1AG7 C24 C Y N 37 A1AG7 C25 C Y N 38 A1AG7 C26 C Y N 39 A1AG7 C27 C Y N 40 A1AG7 C28 C Y N 41 A1AG7 C29 C Y N 42 A1AG7 H1 H N N 43 A1AG7 H2 H N N 44 A1AG7 H3 H N N 45 A1AG7 H4 H N N 46 A1AG7 H5 H N N 47 A1AG7 H6 H N N 48 A1AG7 H7 H N N 49 A1AG7 H8 H N N 50 A1AG7 H9 H N N 51 A1AG7 H10 H N N 52 A1AG7 H11 H N N 53 A1AG7 H12 H N N 54 A1AG7 H13 H N N 55 A1AG7 H14 H N N 56 A1AG7 H15 H N N 57 A1AG7 H16 H N N 58 A1AG7 H17 H N N 59 A1AG7 H18 H N N 60 A1AG7 H19 H N N 61 A1AG7 H20 H N N 62 A1AG7 H21 H N N 63 A1AG7 H22 H N N 64 A1AG7 H23 H N N 65 A1AG7 H24 H N N 66 A1AG7 H25 H N N 67 A1AG7 H26 H N N 68 A1AG7 H27 H N N 69 A1AG7 H28 H N N 70 A1AG7 H29 H N N 71 A1AG7 H30 H N N 72 A1AG7 H31 H N N 73 A1AG7 H32 H N N 74 ALA N N N N 75 ALA CA C N S 76 ALA C C N N 77 ALA O O N N 78 ALA CB C N N 79 ALA OXT O N N 80 ALA H H N N 81 ALA H2 H N N 82 ALA HA H N N 83 ALA HB1 H N N 84 ALA HB2 H N N 85 ALA HB3 H N N 86 ALA HXT H N N 87 ARG N N N N 88 ARG CA C N S 89 ARG C C N N 90 ARG O O N N 91 ARG CB C N N 92 ARG CG C N N 93 ARG CD C N N 94 ARG NE N N N 95 ARG CZ C N N 96 ARG NH1 N N N 97 ARG NH2 N N N 98 ARG OXT O N N 99 ARG H H N N 100 ARG H2 H N N 101 ARG HA H N N 102 ARG HB2 H N N 103 ARG HB3 H N N 104 ARG HG2 H N N 105 ARG HG3 H N N 106 ARG HD2 H N N 107 ARG HD3 H N N 108 ARG HE H N N 109 ARG HH11 H N N 110 ARG HH12 H N N 111 ARG HH21 H N N 112 ARG HH22 H N N 113 ARG HXT H N N 114 ASN N N N N 115 ASN CA C N S 116 ASN C C N N 117 ASN O O N N 118 ASN CB C N N 119 ASN CG C N N 120 ASN OD1 O N N 121 ASN ND2 N N N 122 ASN OXT O N N 123 ASN H H N N 124 ASN H2 H N N 125 ASN HA H N N 126 ASN HB2 H N N 127 ASN HB3 H N N 128 ASN HD21 H N N 129 ASN HD22 H N N 130 ASN HXT H N N 131 ASP N N N N 132 ASP CA C N S 133 ASP C C N N 134 ASP O O N N 135 ASP CB C N N 136 ASP CG C N N 137 ASP OD1 O N N 138 ASP OD2 O N N 139 ASP OXT O N N 140 ASP H H N N 141 ASP H2 H N N 142 ASP HA H N N 143 ASP HB2 H N N 144 ASP HB3 H N N 145 ASP HD2 H N N 146 ASP HXT H N N 147 CYS N N N N 148 CYS CA C N R 149 CYS C C N N 150 CYS O O N N 151 CYS CB C N N 152 CYS SG S N N 153 CYS OXT O N N 154 CYS H H N N 155 CYS H2 H N N 156 CYS HA H N N 157 CYS HB2 H N N 158 CYS HB3 H N N 159 CYS HG H N N 160 CYS HXT H N N 161 GLN N N N N 162 GLN CA C N S 163 GLN C C N N 164 GLN O O N N 165 GLN CB C N N 166 GLN CG C N N 167 GLN CD C N N 168 GLN OE1 O N N 169 GLN NE2 N N N 170 GLN OXT O N N 171 GLN H H N N 172 GLN H2 H N N 173 GLN HA H N N 174 GLN HB2 H N N 175 GLN HB3 H N N 176 GLN HG2 H N N 177 GLN HG3 H N N 178 GLN HE21 H N N 179 GLN HE22 H N N 180 GLN HXT H N N 181 GLU N N N N 182 GLU CA C N S 183 GLU C C N N 184 GLU O O N N 185 GLU CB C N N 186 GLU CG C N N 187 GLU CD C N N 188 GLU OE1 O N N 189 GLU OE2 O N N 190 GLU OXT O N N 191 GLU H H N N 192 GLU H2 H N N 193 GLU HA H N N 194 GLU HB2 H N N 195 GLU HB3 H N N 196 GLU HG2 H N N 197 GLU HG3 H N N 198 GLU HE2 H N N 199 GLU HXT H N N 200 GLY N N N N 201 GLY CA C N N 202 GLY C C N N 203 GLY O O N N 204 GLY OXT O N N 205 GLY H H N N 206 GLY H2 H N N 207 GLY HA2 H N N 208 GLY HA3 H N N 209 GLY HXT H N N 210 HIS N N N N 211 HIS CA C N S 212 HIS C C N N 213 HIS O O N N 214 HIS CB C N N 215 HIS CG C Y N 216 HIS ND1 N Y N 217 HIS CD2 C Y N 218 HIS CE1 C Y N 219 HIS NE2 N Y N 220 HIS OXT O N N 221 HIS H H N N 222 HIS H2 H N N 223 HIS HA H N N 224 HIS HB2 H N N 225 HIS HB3 H N N 226 HIS HD1 H N N 227 HIS HD2 H N N 228 HIS HE1 H N N 229 HIS HE2 H N N 230 HIS HXT H N N 231 HOH O O N N 232 HOH H1 H N N 233 HOH H2 H N N 234 ILE N N N N 235 ILE CA C N S 236 ILE C C N N 237 ILE O O N N 238 ILE CB C N S 239 ILE CG1 C N N 240 ILE CG2 C N N 241 ILE CD1 C N N 242 ILE OXT O N N 243 ILE H H N N 244 ILE H2 H N N 245 ILE HA H N N 246 ILE HB H N N 247 ILE HG12 H N N 248 ILE HG13 H N N 249 ILE HG21 H N N 250 ILE HG22 H N N 251 ILE HG23 H N N 252 ILE HD11 H N N 253 ILE HD12 H N N 254 ILE HD13 H N N 255 ILE HXT H N N 256 LEU N N N N 257 LEU CA C N S 258 LEU C C N N 259 LEU O O N N 260 LEU CB C N N 261 LEU CG C N N 262 LEU CD1 C N N 263 LEU CD2 C N N 264 LEU OXT O N N 265 LEU H H N N 266 LEU H2 H N N 267 LEU HA H N N 268 LEU HB2 H N N 269 LEU HB3 H N N 270 LEU HG H N N 271 LEU HD11 H N N 272 LEU HD12 H N N 273 LEU HD13 H N N 274 LEU HD21 H N N 275 LEU HD22 H N N 276 LEU HD23 H N N 277 LEU HXT H N N 278 LYS N N N N 279 LYS CA C N S 280 LYS C C N N 281 LYS O O N N 282 LYS CB C N N 283 LYS CG C N N 284 LYS CD C N N 285 LYS CE C N N 286 LYS NZ N N N 287 LYS OXT O N N 288 LYS H H N N 289 LYS H2 H N N 290 LYS HA H N N 291 LYS HB2 H N N 292 LYS HB3 H N N 293 LYS HG2 H N N 294 LYS HG3 H N N 295 LYS HD2 H N N 296 LYS HD3 H N N 297 LYS HE2 H N N 298 LYS HE3 H N N 299 LYS HZ1 H N N 300 LYS HZ2 H N N 301 LYS HZ3 H N N 302 LYS HXT H N N 303 MET N N N N 304 MET CA C N S 305 MET C C N N 306 MET O O N N 307 MET CB C N N 308 MET CG C N N 309 MET SD S N N 310 MET CE C N N 311 MET OXT O N N 312 MET H H N N 313 MET H2 H N N 314 MET HA H N N 315 MET HB2 H N N 316 MET HB3 H N N 317 MET HG2 H N N 318 MET HG3 H N N 319 MET HE1 H N N 320 MET HE2 H N N 321 MET HE3 H N N 322 MET HXT H N N 323 SER N N N N 324 SER CA C N S 325 SER C C N N 326 SER O O N N 327 SER CB C N N 328 SER OG O N N 329 SER OXT O N N 330 SER H H N N 331 SER H2 H N N 332 SER HA H N N 333 SER HB2 H N N 334 SER HB3 H N N 335 SER HG H N N 336 SER HXT H N N 337 TYR N N N N 338 TYR CA C N S 339 TYR C C N N 340 TYR O O N N 341 TYR CB C N N 342 TYR CG C Y N 343 TYR CD1 C Y N 344 TYR CD2 C Y N 345 TYR CE1 C Y N 346 TYR CE2 C Y N 347 TYR CZ C Y N 348 TYR OH O N N 349 TYR OXT O N N 350 TYR H H N N 351 TYR H2 H N N 352 TYR HA H N N 353 TYR HB2 H N N 354 TYR HB3 H N N 355 TYR HD1 H N N 356 TYR HD2 H N N 357 TYR HE1 H N N 358 TYR HE2 H N N 359 TYR HH H N N 360 TYR HXT H N N 361 VAL N N N N 362 VAL CA C N S 363 VAL C C N N 364 VAL O O N N 365 VAL CB C N N 366 VAL CG1 C N N 367 VAL CG2 C N N 368 VAL OXT O N N 369 VAL H H N N 370 VAL H2 H N N 371 VAL HA H N N 372 VAL HB H N N 373 VAL HG11 H N N 374 VAL HG12 H N N 375 VAL HG13 H N N 376 VAL HG21 H N N 377 VAL HG22 H N N 378 VAL HG23 H N N 379 VAL HXT H N N 380 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1AG7 O1 C2 doub N N 1 A1AG7 CL C sing N N 2 A1AG7 C2 O sing N N 3 A1AG7 C2 C1 sing N N 4 A1AG7 C C1 doub Y N 5 A1AG7 C C32 sing Y N 6 A1AG7 C1 C3 sing Y N 7 A1AG7 C32 C31 doub Y N 8 A1AG7 C3 C4 doub Y N 9 A1AG7 C31 C4 sing Y N 10 A1AG7 C31 N4 sing Y N 11 A1AG7 C4 N sing Y N 12 A1AG7 N4 C14 doub Y N 13 A1AG7 O2 C6 doub N N 14 A1AG7 N C14 sing Y N 15 A1AG7 N C5 sing N N 16 A1AG7 C8 C13 sing N N 17 A1AG7 C8 C5 sing N N 18 A1AG7 C8 C9 sing N N 19 A1AG7 C14 C15 sing N N 20 A1AG7 C12 C13 sing N N 21 A1AG7 C12 C11 sing N N 22 A1AG7 C21 C22 doub Y N 23 A1AG7 C21 C20 sing Y N 24 A1AG7 C5 C6 sing N N 25 A1AG7 C6 N1 sing N N 26 A1AG7 C22 C17 sing Y N 27 A1AG7 C11 C10 sing N N 28 A1AG7 C9 C10 sing N N 29 A1AG7 C20 C19 doub Y N 30 A1AG7 C15 C16 sing Y N 31 A1AG7 C15 C30 doub Y N 32 A1AG7 N1 C7 sing N N 33 A1AG7 C17 C16 sing N N 34 A1AG7 C17 C18 doub Y N 35 A1AG7 C16 N2 doub Y N 36 A1AG7 C19 C18 sing Y N 37 A1AG7 C30 N3 sing Y N 38 A1AG7 N2 N3 sing Y N 39 A1AG7 N3 C23 sing N N 40 A1AG7 C25 C26 doub Y N 41 A1AG7 C25 C24 sing Y N 42 A1AG7 C26 C27 sing Y N 43 A1AG7 C23 C24 sing N N 44 A1AG7 C24 C29 doub Y N 45 A1AG7 C27 C28 doub Y N 46 A1AG7 C29 C28 sing Y N 47 A1AG7 N1 H1 sing N N 48 A1AG7 C7 H2 sing N N 49 A1AG7 C7 H3 sing N N 50 A1AG7 C7 H4 sing N N 51 A1AG7 C5 H5 sing N N 52 A1AG7 O H6 sing N N 53 A1AG7 C3 H7 sing N N 54 A1AG7 C8 H8 sing N N 55 A1AG7 C9 H9 sing N N 56 A1AG7 C9 H10 sing N N 57 A1AG7 C10 H11 sing N N 58 A1AG7 C10 H12 sing N N 59 A1AG7 C11 H13 sing N N 60 A1AG7 C11 H14 sing N N 61 A1AG7 C12 H15 sing N N 62 A1AG7 C12 H16 sing N N 63 A1AG7 C13 H17 sing N N 64 A1AG7 C13 H18 sing N N 65 A1AG7 C32 H19 sing N N 66 A1AG7 C18 H20 sing N N 67 A1AG7 C19 H21 sing N N 68 A1AG7 C20 H22 sing N N 69 A1AG7 C21 H23 sing N N 70 A1AG7 C22 H24 sing N N 71 A1AG7 C30 H25 sing N N 72 A1AG7 C23 H26 sing N N 73 A1AG7 C23 H27 sing N N 74 A1AG7 C25 H28 sing N N 75 A1AG7 C26 H29 sing N N 76 A1AG7 C27 H30 sing N N 77 A1AG7 C28 H31 sing N N 78 A1AG7 C29 H32 sing N N 79 ALA N CA sing N N 80 ALA N H sing N N 81 ALA N H2 sing N N 82 ALA CA C sing N N 83 ALA CA CB sing N N 84 ALA CA HA sing N N 85 ALA C O doub N N 86 ALA C OXT sing N N 87 ALA CB HB1 sing N N 88 ALA CB HB2 sing N N 89 ALA CB HB3 sing N N 90 ALA OXT HXT sing N N 91 ARG N CA sing N N 92 ARG N H sing N N 93 ARG N H2 sing N N 94 ARG CA C sing N N 95 ARG CA CB sing N N 96 ARG CA HA sing N N 97 ARG C O doub N N 98 ARG C OXT sing N N 99 ARG CB CG sing N N 100 ARG CB HB2 sing N N 101 ARG CB HB3 sing N N 102 ARG CG CD sing N N 103 ARG CG HG2 sing N N 104 ARG CG HG3 sing N N 105 ARG CD NE sing N N 106 ARG CD HD2 sing N N 107 ARG CD HD3 sing N N 108 ARG NE CZ sing N N 109 ARG NE HE sing N N 110 ARG CZ NH1 sing N N 111 ARG CZ NH2 doub N N 112 ARG NH1 HH11 sing N N 113 ARG NH1 HH12 sing N N 114 ARG NH2 HH21 sing N N 115 ARG NH2 HH22 sing N N 116 ARG OXT HXT sing N N 117 ASN N CA sing N N 118 ASN N H sing N N 119 ASN N H2 sing N N 120 ASN CA C sing N N 121 ASN CA CB sing N N 122 ASN CA HA sing N N 123 ASN C O doub N N 124 ASN C OXT sing N N 125 ASN CB CG sing N N 126 ASN CB HB2 sing N N 127 ASN CB HB3 sing N N 128 ASN CG OD1 doub N N 129 ASN CG ND2 sing N N 130 ASN ND2 HD21 sing N N 131 ASN ND2 HD22 sing N N 132 ASN OXT HXT sing N N 133 ASP N CA sing N N 134 ASP N H sing N N 135 ASP N H2 sing N N 136 ASP CA C sing N N 137 ASP CA CB sing N N 138 ASP CA HA sing N N 139 ASP C O doub N N 140 ASP C OXT sing N N 141 ASP CB CG sing N N 142 ASP CB HB2 sing N N 143 ASP CB HB3 sing N N 144 ASP CG OD1 doub N N 145 ASP CG OD2 sing N N 146 ASP OD2 HD2 sing N N 147 ASP OXT HXT sing N N 148 CYS N CA sing N N 149 CYS N H sing N N 150 CYS N H2 sing N N 151 CYS CA C sing N N 152 CYS CA CB sing N N 153 CYS CA HA sing N N 154 CYS C O doub N N 155 CYS C OXT sing N N 156 CYS CB SG sing N N 157 CYS CB HB2 sing N N 158 CYS CB HB3 sing N N 159 CYS SG HG sing N N 160 CYS OXT HXT sing N N 161 GLN N CA sing N N 162 GLN N H sing N N 163 GLN N H2 sing N N 164 GLN CA C sing N N 165 GLN CA CB sing N N 166 GLN CA HA sing N N 167 GLN C O doub N N 168 GLN C OXT sing N N 169 GLN CB CG sing N N 170 GLN CB HB2 sing N N 171 GLN CB HB3 sing N N 172 GLN CG CD sing N N 173 GLN CG HG2 sing N N 174 GLN CG HG3 sing N N 175 GLN CD OE1 doub N N 176 GLN CD NE2 sing N N 177 GLN NE2 HE21 sing N N 178 GLN NE2 HE22 sing N N 179 GLN OXT HXT sing N N 180 GLU N CA sing N N 181 GLU N H sing N N 182 GLU N H2 sing N N 183 GLU CA C sing N N 184 GLU CA CB sing N N 185 GLU CA HA sing N N 186 GLU C O doub N N 187 GLU C OXT sing N N 188 GLU CB CG sing N N 189 GLU CB HB2 sing N N 190 GLU CB HB3 sing N N 191 GLU CG CD sing N N 192 GLU CG HG2 sing N N 193 GLU CG HG3 sing N N 194 GLU CD OE1 doub N N 195 GLU CD OE2 sing N N 196 GLU OE2 HE2 sing N N 197 GLU OXT HXT sing N N 198 GLY N CA sing N N 199 GLY N H sing N N 200 GLY N H2 sing N N 201 GLY CA C sing N N 202 GLY CA HA2 sing N N 203 GLY CA HA3 sing N N 204 GLY C O doub N N 205 GLY C OXT sing N N 206 GLY OXT HXT sing N N 207 HIS N CA sing N N 208 HIS N H sing N N 209 HIS N H2 sing N N 210 HIS CA C sing N N 211 HIS CA CB sing N N 212 HIS CA HA sing N N 213 HIS C O doub N N 214 HIS C OXT sing N N 215 HIS CB CG sing N N 216 HIS CB HB2 sing N N 217 HIS CB HB3 sing N N 218 HIS CG ND1 sing Y N 219 HIS CG CD2 doub Y N 220 HIS ND1 CE1 doub Y N 221 HIS ND1 HD1 sing N N 222 HIS CD2 NE2 sing Y N 223 HIS CD2 HD2 sing N N 224 HIS CE1 NE2 sing Y N 225 HIS CE1 HE1 sing N N 226 HIS NE2 HE2 sing N N 227 HIS OXT HXT sing N N 228 HOH O H1 sing N N 229 HOH O H2 sing N N 230 ILE N CA sing N N 231 ILE N H sing N N 232 ILE N H2 sing N N 233 ILE CA C sing N N 234 ILE CA CB sing N N 235 ILE CA HA sing N N 236 ILE C O doub N N 237 ILE C OXT sing N N 238 ILE CB CG1 sing N N 239 ILE CB CG2 sing N N 240 ILE CB HB sing N N 241 ILE CG1 CD1 sing N N 242 ILE CG1 HG12 sing N N 243 ILE CG1 HG13 sing N N 244 ILE CG2 HG21 sing N N 245 ILE CG2 HG22 sing N N 246 ILE CG2 HG23 sing N N 247 ILE CD1 HD11 sing N N 248 ILE CD1 HD12 sing N N 249 ILE CD1 HD13 sing N N 250 ILE OXT HXT sing N N 251 LEU N CA sing N N 252 LEU N H sing N N 253 LEU N H2 sing N N 254 LEU CA C sing N N 255 LEU CA CB sing N N 256 LEU CA HA sing N N 257 LEU C O doub N N 258 LEU C OXT sing N N 259 LEU CB CG sing N N 260 LEU CB HB2 sing N N 261 LEU CB HB3 sing N N 262 LEU CG CD1 sing N N 263 LEU CG CD2 sing N N 264 LEU CG HG sing N N 265 LEU CD1 HD11 sing N N 266 LEU CD1 HD12 sing N N 267 LEU CD1 HD13 sing N N 268 LEU CD2 HD21 sing N N 269 LEU CD2 HD22 sing N N 270 LEU CD2 HD23 sing N N 271 LEU OXT HXT sing N N 272 LYS N CA sing N N 273 LYS N H sing N N 274 LYS N H2 sing N N 275 LYS CA C sing N N 276 LYS CA CB sing N N 277 LYS CA HA sing N N 278 LYS C O doub N N 279 LYS C OXT sing N N 280 LYS CB CG sing N N 281 LYS CB HB2 sing N N 282 LYS CB HB3 sing N N 283 LYS CG CD sing N N 284 LYS CG HG2 sing N N 285 LYS CG HG3 sing N N 286 LYS CD CE sing N N 287 LYS CD HD2 sing N N 288 LYS CD HD3 sing N N 289 LYS CE NZ sing N N 290 LYS CE HE2 sing N N 291 LYS CE HE3 sing N N 292 LYS NZ HZ1 sing N N 293 LYS NZ HZ2 sing N N 294 LYS NZ HZ3 sing N N 295 LYS OXT HXT sing N N 296 MET N CA sing N N 297 MET N H sing N N 298 MET N H2 sing N N 299 MET CA C sing N N 300 MET CA CB sing N N 301 MET CA HA sing N N 302 MET C O doub N N 303 MET C OXT sing N N 304 MET CB CG sing N N 305 MET CB HB2 sing N N 306 MET CB HB3 sing N N 307 MET CG SD sing N N 308 MET CG HG2 sing N N 309 MET CG HG3 sing N N 310 MET SD CE sing N N 311 MET CE HE1 sing N N 312 MET CE HE2 sing N N 313 MET CE HE3 sing N N 314 MET OXT HXT sing N N 315 SER N CA sing N N 316 SER N H sing N N 317 SER N H2 sing N N 318 SER CA C sing N N 319 SER CA CB sing N N 320 SER CA HA sing N N 321 SER C O doub N N 322 SER C OXT sing N N 323 SER CB OG sing N N 324 SER CB HB2 sing N N 325 SER CB HB3 sing N N 326 SER OG HG sing N N 327 SER OXT HXT sing N N 328 TYR N CA sing N N 329 TYR N H sing N N 330 TYR N H2 sing N N 331 TYR CA C sing N N 332 TYR CA CB sing N N 333 TYR CA HA sing N N 334 TYR C O doub N N 335 TYR C OXT sing N N 336 TYR CB CG sing N N 337 TYR CB HB2 sing N N 338 TYR CB HB3 sing N N 339 TYR CG CD1 doub Y N 340 TYR CG CD2 sing Y N 341 TYR CD1 CE1 sing Y N 342 TYR CD1 HD1 sing N N 343 TYR CD2 CE2 doub Y N 344 TYR CD2 HD2 sing N N 345 TYR CE1 CZ doub Y N 346 TYR CE1 HE1 sing N N 347 TYR CE2 CZ sing Y N 348 TYR CE2 HE2 sing N N 349 TYR CZ OH sing N N 350 TYR OH HH sing N N 351 TYR OXT HXT sing N N 352 VAL N CA sing N N 353 VAL N H sing N N 354 VAL N H2 sing N N 355 VAL CA C sing N N 356 VAL CA CB sing N N 357 VAL CA HA sing N N 358 VAL C O doub N N 359 VAL C OXT sing N N 360 VAL CB CG1 sing N N 361 VAL CB CG2 sing N N 362 VAL CB HB sing N N 363 VAL CG1 HG11 sing N N 364 VAL CG1 HG12 sing N N 365 VAL CG1 HG13 sing N N 366 VAL CG2 HG21 sing N N 367 VAL CG2 HG22 sing N N 368 VAL CG2 HG23 sing N N 369 VAL OXT HXT sing N N 370 # _pdbx_audit_support.funding_organization 'Other government' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'An idealized helix was used for molecular replacement' # _atom_sites.entry_id 9AVN _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.017734 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002413 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017841 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011972 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL N O S # loop_ #