data_9AWV # _entry.id 9AWV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.406 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9AWV pdb_00009awv 10.2210/pdb9awv/pdb WWPDB D_1000282215 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-03-12 ? 2 'Structure model' 1 1 2025-09-24 ? # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'Structure model' author 'Coordinate replacement' 'Model orientation/position' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 2 'Structure model' 'Data collection' 3 2 'Structure model' Other 4 2 'Structure model' 'Refinement description' 5 2 'Structure model' 'Source and taxonomy' 6 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_sites 2 2 'Structure model' cell 3 2 'Structure model' entity_src_gen 4 2 'Structure model' pdbx_contact_author 5 2 'Structure model' pdbx_entity_instance_feature 6 2 'Structure model' refine 7 2 'Structure model' refine_hist 8 2 'Structure model' refine_ls_restr 9 2 'Structure model' refine_ls_shell 10 2 'Structure model' reflns # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_sites.fract_transf_matrix[1][1]' 2 2 'Structure model' '_atom_sites.fract_transf_matrix[2][2]' 3 2 'Structure model' '_atom_sites.fract_transf_matrix[3][3]' 4 2 'Structure model' '_cell.length_a' 5 2 'Structure model' '_cell.length_b' 6 2 'Structure model' '_cell.length_c' 7 2 'Structure model' '_entity_src_gen.gene_src_common_name' 8 2 'Structure model' '_refine.B_iso_mean' 9 2 'Structure model' '_refine.aniso_B[1][1]' 10 2 'Structure model' '_refine.aniso_B[1][3]' 11 2 'Structure model' '_refine.aniso_B[2][2]' 12 2 'Structure model' '_refine.aniso_B[3][3]' 13 2 'Structure model' '_refine.correlation_coeff_Fo_to_Fc' 14 2 'Structure model' '_refine.correlation_coeff_Fo_to_Fc_free' 15 2 'Structure model' '_refine.ls_R_factor_R_free' 16 2 'Structure model' '_refine.ls_R_factor_R_work' 17 2 'Structure model' '_refine.ls_R_factor_all' 18 2 'Structure model' '_refine.ls_d_res_high' 19 2 'Structure model' '_refine.ls_d_res_low' 20 2 'Structure model' '_refine.ls_number_reflns_R_free' 21 2 'Structure model' '_refine.ls_number_reflns_R_work' 22 2 'Structure model' '_refine.ls_number_reflns_obs' 23 2 'Structure model' '_refine.ls_percent_reflns_R_free' 24 2 'Structure model' '_refine.ls_percent_reflns_obs' 25 2 'Structure model' '_refine.ls_wR_factor_R_free' 26 2 'Structure model' '_refine.ls_wR_factor_R_work' 27 2 'Structure model' '_refine.overall_SU_B' 28 2 'Structure model' '_refine.overall_SU_ML' 29 2 'Structure model' '_refine.pdbx_average_fsc_free' 30 2 'Structure model' '_refine.pdbx_average_fsc_work' 31 2 'Structure model' '_refine.pdbx_overall_ESU_R' 32 2 'Structure model' '_refine.pdbx_overall_ESU_R_Free' 33 2 'Structure model' '_refine_hist.d_res_high' 34 2 'Structure model' '_refine_hist.d_res_low' 35 2 'Structure model' '_refine_hist.number_atoms_solvent' 36 2 'Structure model' '_refine_hist.number_atoms_total' 37 2 'Structure model' '_refine_ls_shell.R_factor_R_free' 38 2 'Structure model' '_refine_ls_shell.R_factor_R_work' 39 2 'Structure model' '_refine_ls_shell.R_factor_all' 40 2 'Structure model' '_refine_ls_shell.d_res_high' 41 2 'Structure model' '_refine_ls_shell.d_res_low' 42 2 'Structure model' '_refine_ls_shell.number_reflns_R_free' 43 2 'Structure model' '_refine_ls_shell.number_reflns_R_work' 44 2 'Structure model' '_refine_ls_shell.number_reflns_all' 45 2 'Structure model' '_refine_ls_shell.pdbx_fsc_free' 46 2 'Structure model' '_refine_ls_shell.pdbx_fsc_work' 47 2 'Structure model' '_refine_ls_shell.percent_reflns_obs' 48 2 'Structure model' '_refine_ls_shell.wR_factor_R_work' 49 2 'Structure model' '_reflns.d_resolution_low' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9AWV _pdbx_database_status.recvd_initial_deposition_date 2024-03-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 3 _pdbx_contact_author.email luismauriciolima@gmail.com _pdbx_contact_author.name_first Luis _pdbx_contact_author.name_last Lima _pdbx_contact_author.name_mi T.R. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-6020-0504 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lima, L.M.T.R.' 1 0000-0001-6020-0504 'de Sa Ribeiro, F.' 2 0000-0002-8521-6745 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of trypsin at 300 Kelvin with benzamidine (duplicate)' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lima, L.M.T.R.' 1 0000-0001-6020-0504 primary 'de Sa Ribeiro, F.' 2 0000-0002-8521-6745 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cationic trypsin' 23324.287 1 3.4.21.4 ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 3 non-polymer syn BENZAMIDINE 120.152 1 ? ? ? ? 4 water nat water 18.015 80 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Beta-trypsin # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN ; _entity_poly.pdbx_seq_one_letter_code_can ;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 BENZAMIDINE BEN 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ILE n 1 2 VAL n 1 3 GLY n 1 4 GLY n 1 5 TYR n 1 6 THR n 1 7 CYS n 1 8 GLY n 1 9 ALA n 1 10 ASN n 1 11 THR n 1 12 VAL n 1 13 PRO n 1 14 TYR n 1 15 GLN n 1 16 VAL n 1 17 SER n 1 18 LEU n 1 19 ASN n 1 20 SER n 1 21 GLY n 1 22 TYR n 1 23 HIS n 1 24 PHE n 1 25 CYS n 1 26 GLY n 1 27 GLY n 1 28 SER n 1 29 LEU n 1 30 ILE n 1 31 ASN n 1 32 SER n 1 33 GLN n 1 34 TRP n 1 35 VAL n 1 36 VAL n 1 37 SER n 1 38 ALA n 1 39 ALA n 1 40 HIS n 1 41 CYS n 1 42 TYR n 1 43 LYS n 1 44 SER n 1 45 GLY n 1 46 ILE n 1 47 GLN n 1 48 VAL n 1 49 ARG n 1 50 LEU n 1 51 GLY n 1 52 GLU n 1 53 ASP n 1 54 ASN n 1 55 ILE n 1 56 ASN n 1 57 VAL n 1 58 VAL n 1 59 GLU n 1 60 GLY n 1 61 ASN n 1 62 GLU n 1 63 GLN n 1 64 PHE n 1 65 ILE n 1 66 SER n 1 67 ALA n 1 68 SER n 1 69 LYS n 1 70 SER n 1 71 ILE n 1 72 VAL n 1 73 HIS n 1 74 PRO n 1 75 SER n 1 76 TYR n 1 77 ASN n 1 78 SER n 1 79 ASN n 1 80 THR n 1 81 LEU n 1 82 ASN n 1 83 ASN n 1 84 ASP n 1 85 ILE n 1 86 MET n 1 87 LEU n 1 88 ILE n 1 89 LYS n 1 90 LEU n 1 91 LYS n 1 92 SER n 1 93 ALA n 1 94 ALA n 1 95 SER n 1 96 LEU n 1 97 ASN n 1 98 SER n 1 99 ARG n 1 100 VAL n 1 101 ALA n 1 102 SER n 1 103 ILE n 1 104 SER n 1 105 LEU n 1 106 PRO n 1 107 THR n 1 108 SER n 1 109 CYS n 1 110 ALA n 1 111 SER n 1 112 ALA n 1 113 GLY n 1 114 THR n 1 115 GLN n 1 116 CYS n 1 117 LEU n 1 118 ILE n 1 119 SER n 1 120 GLY n 1 121 TRP n 1 122 GLY n 1 123 ASN n 1 124 THR n 1 125 LYS n 1 126 SER n 1 127 SER n 1 128 GLY n 1 129 THR n 1 130 SER n 1 131 TYR n 1 132 PRO n 1 133 ASP n 1 134 VAL n 1 135 LEU n 1 136 LYS n 1 137 CYS n 1 138 LEU n 1 139 LYS n 1 140 ALA n 1 141 PRO n 1 142 ILE n 1 143 LEU n 1 144 SER n 1 145 ASP n 1 146 SER n 1 147 SER n 1 148 CYS n 1 149 LYS n 1 150 SER n 1 151 ALA n 1 152 TYR n 1 153 PRO n 1 154 GLY n 1 155 GLN n 1 156 ILE n 1 157 THR n 1 158 SER n 1 159 ASN n 1 160 MET n 1 161 PHE n 1 162 CYS n 1 163 ALA n 1 164 GLY n 1 165 TYR n 1 166 LEU n 1 167 GLU n 1 168 GLY n 1 169 GLY n 1 170 LYS n 1 171 ASP n 1 172 SER n 1 173 CYS n 1 174 GLN n 1 175 GLY n 1 176 ASP n 1 177 SER n 1 178 GLY n 1 179 GLY n 1 180 PRO n 1 181 VAL n 1 182 VAL n 1 183 CYS n 1 184 SER n 1 185 GLY n 1 186 LYS n 1 187 LEU n 1 188 GLN n 1 189 GLY n 1 190 ILE n 1 191 VAL n 1 192 SER n 1 193 TRP n 1 194 GLY n 1 195 SER n 1 196 GLY n 1 197 CYS n 1 198 ALA n 1 199 GLN n 1 200 LYS n 1 201 ASN n 1 202 LYS n 1 203 PRO n 1 204 GLY n 1 205 VAL n 1 206 TYR n 1 207 THR n 1 208 LYS n 1 209 VAL n 1 210 CYS n 1 211 ASN n 1 212 TYR n 1 213 VAL n 1 214 SER n 1 215 TRP n 1 216 ILE n 1 217 LYS n 1 218 GLN n 1 219 THR n 1 220 ILE n 1 221 ALA n 1 222 SER n 1 223 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 223 _entity_src_gen.gene_src_common_name 'domestic cattle' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bos taurus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9913 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Bos taurus' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 9913 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BEN non-polymer . BENZAMIDINE ? 'C7 H8 N2' 120.152 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ILE 1 1 1 ILE ILE A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 TYR 5 5 5 TYR TYR A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 HIS 23 23 23 HIS HIS A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 CYS 25 25 25 CYS CYS A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 TRP 34 34 34 TRP TRP A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 HIS 40 40 40 HIS HIS A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 SER 68 68 68 SER SER A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 HIS 73 73 73 HIS HIS A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 MET 86 86 86 MET MET A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 CYS 109 109 109 CYS CYS A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 CYS 116 116 116 CYS CYS A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 SER 119 119 119 SER SER A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 TRP 121 121 121 TRP TRP A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 ASN 123 123 123 ASN ASN A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 SER 130 130 130 SER SER A . n A 1 131 TYR 131 131 131 TYR TYR A . n A 1 132 PRO 132 132 132 PRO PRO A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 CYS 137 137 137 CYS CYS A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 PRO 141 141 141 PRO PRO A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 SER 144 144 144 SER SER A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 CYS 148 148 148 CYS CYS A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 SER 150 150 150 SER SER A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 TYR 152 152 152 TYR TYR A . n A 1 153 PRO 153 153 153 PRO PRO A . n A 1 154 GLY 154 154 154 GLY GLY A . n A 1 155 GLN 155 155 155 GLN GLN A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 ASN 159 159 159 ASN ASN A . n A 1 160 MET 160 160 160 MET MET A . n A 1 161 PHE 161 161 161 PHE PHE A . n A 1 162 CYS 162 162 162 CYS CYS A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 GLY 164 164 164 GLY GLY A . n A 1 165 TYR 165 165 165 TYR TYR A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 GLY 168 168 168 GLY GLY A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 LYS 170 170 170 LYS LYS A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 SER 172 172 172 SER SER A . n A 1 173 CYS 173 173 173 CYS CYS A . n A 1 174 GLN 174 174 174 GLN GLN A . n A 1 175 GLY 175 175 175 GLY GLY A . n A 1 176 ASP 176 176 176 ASP ASP A . n A 1 177 SER 177 177 177 SER SER A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 GLY 179 179 179 GLY GLY A . n A 1 180 PRO 180 180 180 PRO PRO A . n A 1 181 VAL 181 181 181 VAL VAL A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 CYS 183 183 183 CYS CYS A . n A 1 184 SER 184 184 184 SER SER A . n A 1 185 GLY 185 185 185 GLY GLY A . n A 1 186 LYS 186 186 186 LYS LYS A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 GLN 188 188 188 GLN GLN A . n A 1 189 GLY 189 189 189 GLY GLY A . n A 1 190 ILE 190 190 190 ILE ILE A . n A 1 191 VAL 191 191 191 VAL VAL A . n A 1 192 SER 192 192 192 SER SER A . n A 1 193 TRP 193 193 193 TRP TRP A . n A 1 194 GLY 194 194 194 GLY GLY A . n A 1 195 SER 195 195 195 SER SER A . n A 1 196 GLY 196 196 196 GLY GLY A . n A 1 197 CYS 197 197 197 CYS CYS A . n A 1 198 ALA 198 198 198 ALA ALA A . n A 1 199 GLN 199 199 199 GLN GLN A . n A 1 200 LYS 200 200 200 LYS LYS A . n A 1 201 ASN 201 201 201 ASN ASN A . n A 1 202 LYS 202 202 202 LYS LYS A . n A 1 203 PRO 203 203 203 PRO PRO A . n A 1 204 GLY 204 204 204 GLY GLY A . n A 1 205 VAL 205 205 205 VAL VAL A . n A 1 206 TYR 206 206 206 TYR TYR A . n A 1 207 THR 207 207 207 THR THR A . n A 1 208 LYS 208 208 208 LYS LYS A . n A 1 209 VAL 209 209 209 VAL VAL A . n A 1 210 CYS 210 210 210 CYS CYS A . n A 1 211 ASN 211 211 211 ASN ASN A . n A 1 212 TYR 212 212 212 TYR TYR A . n A 1 213 VAL 213 213 213 VAL VAL A . n A 1 214 SER 214 214 214 SER SER A . n A 1 215 TRP 215 215 215 TRP TRP A . n A 1 216 ILE 216 216 216 ILE ILE A . n A 1 217 LYS 217 217 217 LYS LYS A . n A 1 218 GLN 218 218 218 GLN GLN A . n A 1 219 THR 219 219 219 THR THR A . n A 1 220 ILE 220 220 220 ILE ILE A . n A 1 221 ALA 221 221 221 ALA ALA A . n A 1 222 SER 222 222 222 SER SER A . n A 1 223 ASN 223 223 223 ASN ASN A . n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 BEN ? ? BEN ? ? 'SUBJECT OF INVESTIGATION' ? 2 CA ? ? CA ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 301 224 CA CA A . C 3 BEN 1 302 225 BEN BEN A . D 4 HOH 1 401 2 HOH HOH A . D 4 HOH 2 402 40 HOH HOH A . D 4 HOH 3 403 25 HOH HOH A . D 4 HOH 4 404 67 HOH HOH A . D 4 HOH 5 405 52 HOH HOH A . D 4 HOH 6 406 63 HOH HOH A . D 4 HOH 7 407 37 HOH HOH A . D 4 HOH 8 408 34 HOH HOH A . D 4 HOH 9 409 51 HOH HOH A . D 4 HOH 10 410 10 HOH HOH A . D 4 HOH 11 411 17 HOH HOH A . D 4 HOH 12 412 23 HOH HOH A . D 4 HOH 13 413 3 HOH HOH A . D 4 HOH 14 414 42 HOH HOH A . D 4 HOH 15 415 57 HOH HOH A . D 4 HOH 16 416 58 HOH HOH A . D 4 HOH 17 417 14 HOH HOH A . D 4 HOH 18 418 9 HOH HOH A . D 4 HOH 19 419 64 HOH HOH A . D 4 HOH 20 420 30 HOH HOH A . D 4 HOH 21 421 33 HOH HOH A . D 4 HOH 22 422 11 HOH HOH A . D 4 HOH 23 423 20 HOH HOH A . D 4 HOH 24 424 4 HOH HOH A . D 4 HOH 25 425 46 HOH HOH A . D 4 HOH 26 426 54 HOH HOH A . D 4 HOH 27 427 49 HOH HOH A . D 4 HOH 28 428 50 HOH HOH A . D 4 HOH 29 429 16 HOH HOH A . D 4 HOH 30 430 73 HOH HOH A . D 4 HOH 31 431 21 HOH HOH A . D 4 HOH 32 432 28 HOH HOH A . D 4 HOH 33 433 36 HOH HOH A . D 4 HOH 34 434 48 HOH HOH A . D 4 HOH 35 435 27 HOH HOH A . D 4 HOH 36 436 35 HOH HOH A . D 4 HOH 37 437 59 HOH HOH A . D 4 HOH 38 438 19 HOH HOH A . D 4 HOH 39 439 22 HOH HOH A . D 4 HOH 40 440 41 HOH HOH A . D 4 HOH 41 441 53 HOH HOH A . D 4 HOH 42 442 5 HOH HOH A . D 4 HOH 43 443 78 HOH HOH A . D 4 HOH 44 444 43 HOH HOH A . D 4 HOH 45 445 24 HOH HOH A . D 4 HOH 46 446 38 HOH HOH A . D 4 HOH 47 447 12 HOH HOH A . D 4 HOH 48 448 31 HOH HOH A . D 4 HOH 49 449 8 HOH HOH A . D 4 HOH 50 450 55 HOH HOH A . D 4 HOH 51 451 26 HOH HOH A . D 4 HOH 52 452 15 HOH HOH A . D 4 HOH 53 453 60 HOH HOH A . D 4 HOH 54 454 13 HOH HOH A . D 4 HOH 55 455 74 HOH HOH A . D 4 HOH 56 456 66 HOH HOH A . D 4 HOH 57 457 32 HOH HOH A . D 4 HOH 58 458 29 HOH HOH A . D 4 HOH 59 459 18 HOH HOH A . D 4 HOH 60 460 68 HOH HOH A . D 4 HOH 61 461 76 HOH HOH A . D 4 HOH 62 462 77 HOH HOH A . D 4 HOH 63 463 7 HOH HOH A . D 4 HOH 64 464 45 HOH HOH A . D 4 HOH 65 465 6 HOH HOH A . D 4 HOH 66 466 1 HOH HOH A . D 4 HOH 67 467 61 HOH HOH A . D 4 HOH 68 468 75 HOH HOH A . D 4 HOH 69 469 79 HOH HOH A . D 4 HOH 70 470 44 HOH HOH A . D 4 HOH 71 471 47 HOH HOH A . D 4 HOH 72 472 39 HOH HOH A . D 4 HOH 73 473 80 HOH HOH A . D 4 HOH 74 474 69 HOH HOH A . D 4 HOH 75 475 72 HOH HOH A . D 4 HOH 76 476 56 HOH HOH A . D 4 HOH 77 477 70 HOH HOH A . D 4 HOH 78 478 71 HOH HOH A . D 4 HOH 79 479 65 HOH HOH A . D 4 HOH 80 480 62 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0425 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? 'PROTEUM PLUS' ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? 'PROTEUM PLUS' ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . ? 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9AWV _cell.details ? _cell.formula_units_Z ? _cell.length_a 54.214 _cell.length_a_esd ? _cell.length_b 57.413 _cell.length_b_esd ? _cell.length_c 66.567 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9AWV _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9AWV _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.22 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.61 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 9.4 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Potassium phosphate dibasic, 20% w/v Polyethylene glycol 3,350.' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 298 # _diffrn.ambient_environment ? _diffrn.ambient_temp 300 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'Bruker PHOTON II' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-11-09 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54184 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'BRUKER X8 PROTEUM' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54184 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9AWV _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.483 _reflns.d_resolution_low 25.443 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 34788 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 95.10 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.800 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.743 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.5 _reflns_shell.d_res_low 25.41 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1679 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.743 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -0.943 _refine.aniso_B[1][2] -0.000 _refine.aniso_B[1][3] -0.000 _refine.aniso_B[2][2] 0.009 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] 0.934 _refine.B_iso_max ? _refine.B_iso_mean 22.881 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.962 _refine.correlation_coeff_Fo_to_Fc_free 0.951 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9AWV _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.484 _refine.ls_d_res_low 25.443 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 33339 _refine.ls_number_reflns_R_free 1680 _refine.ls_number_reflns_R_work 31659 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.067 _refine.ls_percent_reflns_R_free 5.039 _refine.ls_R_factor_all 0.218 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2446 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2164 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.088 _refine.pdbx_overall_ESU_R_Free 0.088 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 3.003 _refine.overall_SU_ML 0.096 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.484 _refine_hist.d_res_low 25.443 _refine_hist.number_atoms_solvent 86 _refine_hist.number_atoms_total 1725 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1629 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.012 1669 ? r_bond_refined_d ? ? ? 'X-RAY DIFFRACTION' ? 0.001 0.016 1540 ? r_bond_other_d ? ? ? 'X-RAY DIFFRACTION' ? 1.638 1.758 2263 ? r_angle_refined_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.587 1.726 3563 ? r_angle_other_deg ? ? ? 'X-RAY DIFFRACTION' ? 7.201 5.000 222 ? r_dihedral_angle_1_deg ? ? ? 'X-RAY DIFFRACTION' ? 5.960 5.000 3 ? r_dihedral_angle_2_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.312 5.000 1 ? r_dihedral_angle_other_2_deg ? ? ? 'X-RAY DIFFRACTION' ? 14.097 10.000 269 ? r_dihedral_angle_3_deg ? ? ? 'X-RAY DIFFRACTION' ? 12.787 10.000 58 ? r_dihedral_angle_6_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.085 0.200 254 ? r_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.008 0.020 1978 ? r_gen_planes_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 366 ? r_gen_planes_other ? ? ? 'X-RAY DIFFRACTION' ? 0.208 0.200 296 ? r_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.206 0.200 1362 ? r_symmetry_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 0.176 0.200 836 ? r_nbtor_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.087 0.200 937 ? r_symmetry_nbtor_other ? ? ? 'X-RAY DIFFRACTION' ? 0.382 0.200 76 ? r_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.022 0.200 1 ? r_symmetry_xyhbond_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 0.162 0.200 5 ? r_metal_ion_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.259 0.200 10 ? r_symmetry_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.160 0.200 26 ? r_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 0.188 0.200 7 ? r_symmetry_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 2.074 2.196 891 ? r_mcbond_it ? ? ? 'X-RAY DIFFRACTION' ? 2.074 2.196 891 ? r_mcbond_other ? ? ? 'X-RAY DIFFRACTION' ? 3.091 3.941 1112 ? r_mcangle_it ? ? ? 'X-RAY DIFFRACTION' ? 3.090 3.941 1113 ? r_mcangle_other ? ? ? 'X-RAY DIFFRACTION' ? 3.232 2.492 778 ? r_scbond_it ? ? ? 'X-RAY DIFFRACTION' ? 3.230 2.492 779 ? r_scbond_other ? ? ? 'X-RAY DIFFRACTION' ? 4.888 4.404 1151 ? r_scangle_it ? ? ? 'X-RAY DIFFRACTION' ? 4.888 4.404 1151 ? r_scangle_other ? ? ? 'X-RAY DIFFRACTION' ? 6.194 24.894 1838 ? r_lrange_it ? ? ? 'X-RAY DIFFRACTION' ? 6.142 24.630 1826 ? r_lrange_other ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.484 1.522 2553 . 87 1680 69.2127 . 0.429 . . 0.431 . . . . . 0.422 . . . . . 20 . 0.837 0.844 0.405 'X-RAY DIFFRACTION' 1.522 1.564 2485 . 91 2084 87.5252 . 0.434 . . 0.434 . . . . . 0.429 . . . . . 20 . 0.803 0.840 0.444 'X-RAY DIFFRACTION' 1.564 1.609 2416 . 102 2066 89.7351 . 0.417 . . 0.417 . . . . . 0.424 . . . . . 20 . 0.820 0.837 0.425 'X-RAY DIFFRACTION' 1.609 1.658 2350 . 102 2096 93.5319 . 0.385 . . 0.385 . . . . . 0.385 . . . . . 20 . 0.854 0.896 0.375 'X-RAY DIFFRACTION' 1.658 1.713 2270 . 103 2087 96.4758 . 0.363 . . 0.362 . . . . . 0.359 . . . . . 20 . 0.884 0.870 0.385 'X-RAY DIFFRACTION' 1.713 1.772 2203 . 127 2041 98.4113 . 0.330 . . 0.328 . . . . . 0.316 . . . . . 20 . 0.911 0.889 0.376 'X-RAY DIFFRACTION' 1.772 1.839 2146 . 109 2006 98.5555 . 0.291 . . 0.288 . . . . . 0.269 . . . . . 20 . 0.934 0.919 0.348 'X-RAY DIFFRACTION' 1.839 1.914 2073 . 126 1923 98.8423 . 0.245 . . 0.244 . . . . . 0.219 . . . . . 20 . 0.957 0.951 0.259 'X-RAY DIFFRACTION' 1.914 1.998 1963 . 93 1858 99.3887 . 0.230 . . 0.227 . . . . . 0.200 . . . . . 20 . 0.963 0.946 0.287 'X-RAY DIFFRACTION' 1.998 2.095 1894 . 109 1773 99.3664 . 0.214 . . 0.211 . . . . . 0.185 . . . . . 20 . 0.970 0.953 0.267 'X-RAY DIFFRACTION' 2.095 2.208 1809 . 74 1727 99.5578 . 0.205 . . 0.202 . . . . . 0.171 . . . . . 20 . 0.972 0.957 0.273 'X-RAY DIFFRACTION' 2.208 2.340 1707 . 82 1620 99.7071 . 0.187 . . 0.185 . . . . . 0.162 . . . . . 20 . 0.977 0.972 0.216 'X-RAY DIFFRACTION' 2.340 2.500 1618 . 94 1520 99.7528 . 0.177 . . 0.176 . . . . . 0.158 . . . . . 20 . 0.980 0.978 0.202 'X-RAY DIFFRACTION' 2.500 2.699 1503 . 74 1427 99.8669 . 0.179 . . 0.178 . . . . . 0.163 . . . . . 20 . 0.980 0.973 0.200 'X-RAY DIFFRACTION' 2.699 2.953 1407 . 72 1334 99.9289 . 0.171 . . 0.171 . . . . . 0.163 . . . . . 20 . 0.982 0.978 0.182 'X-RAY DIFFRACTION' 2.953 3.296 1274 . 55 1218 99.9215 . 0.171 . . 0.169 . . . . . 0.166 . . . . . 20 . 0.981 0.971 0.211 'X-RAY DIFFRACTION' 3.296 3.795 1136 . 61 1074 99.9120 . 0.166 . . 0.163 . . . . . 0.166 . . . . . 20 . 0.983 0.978 0.208 'X-RAY DIFFRACTION' 3.795 4.622 985 . 55 930 100.0000 . 0.163 . . 0.162 . . . . . 0.169 . . . . . 20 . 0.984 0.983 0.185 'X-RAY DIFFRACTION' 4.622 6.432 775 . 44 727 99.4839 . 0.196 . . 0.195 . . . . . 0.211 . . . . . 20 . 0.981 0.978 0.210 'X-RAY DIFFRACTION' 6.432 25.443 492 . 20 468 99.1870 . 0.204 . . 0.202 . . . . . 0.240 . . . . . 20 . 0.972 0.960 0.259 # _struct.entry_id 9AWV _struct.title 'Crystal structure of trypsin at 300 Kelvin with benzamidine (duplicate)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9AWV _struct_keywords.text 'Inhibitor, Benzamidine, Complex, x-ray., HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRY1_BOVIN _struct_ref.pdbx_db_accession P00760 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN ; _struct_ref.pdbx_align_begin 24 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9AWV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 223 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00760 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 246 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 223 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 38 ? TYR A 42 ? ALA A 38 TYR A 42 5 ? 5 HELX_P HELX_P2 AA2 SER A 144 ? TYR A 152 ? SER A 144 TYR A 152 1 ? 9 HELX_P HELX_P3 AA3 TYR A 212 ? ALA A 221 ? TYR A 212 ALA A 221 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 7 SG ? ? ? 1_555 A CYS 137 SG ? ? A CYS 7 A CYS 137 1_555 ? ? ? ? ? ? ? 2.013 ? ? disulf2 disulf ? ? A CYS 25 SG ? ? ? 1_555 A CYS 41 SG ? ? A CYS 25 A CYS 41 1_555 ? ? ? ? ? ? ? 2.051 ? ? disulf3 disulf ? ? A CYS 109 SG ? ? ? 1_555 A CYS 210 SG ? ? A CYS 109 A CYS 210 1_555 ? ? ? ? ? ? ? 2.042 ? ? disulf4 disulf ? ? A CYS 116 SG ? ? ? 1_555 A CYS 183 SG ? ? A CYS 116 A CYS 183 1_555 ? ? ? ? ? ? ? 2.059 ? ? disulf5 disulf ? ? A CYS 148 SG ? ? ? 1_555 A CYS 162 SG ? ? A CYS 148 A CYS 162 1_555 ? ? ? ? ? ? ? 1.960 ? ? disulf6 disulf ? ? A CYS 173 SG ? ? ? 1_555 A CYS 197 SG ? ? A CYS 173 A CYS 197 1_555 ? ? ? ? ? ? ? 2.072 ? ? metalc1 metalc ? ? A GLU 52 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 52 A CA 301 1_555 ? ? ? ? ? ? ? 2.202 ? ? metalc2 metalc ? ? A ASN 54 O ? ? ? 1_555 B CA . CA ? ? A ASN 54 A CA 301 1_555 ? ? ? ? ? ? ? 2.341 ? ? metalc3 metalc ? ? A VAL 57 O ? ? ? 1_555 B CA . CA ? ? A VAL 57 A CA 301 1_555 ? ? ? ? ? ? ? 2.292 ? ? metalc4 metalc ? ? A GLU 59 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 59 A CA 301 1_555 ? ? ? ? ? ? ? 2.338 ? ? metalc5 metalc ? ? A GLU 62 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 62 A CA 301 1_555 ? ? ? ? ? ? ? 2.262 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 52 ? A GLU 52 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? A ASN 54 ? A ASN 54 ? 1_555 87.9 ? 2 OE1 ? A GLU 52 ? A GLU 52 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? A VAL 57 ? A VAL 57 ? 1_555 159.9 ? 3 O ? A ASN 54 ? A ASN 54 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 O ? A VAL 57 ? A VAL 57 ? 1_555 81.9 ? 4 OE1 ? A GLU 52 ? A GLU 52 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 OE1 ? A GLU 59 ? A GLU 59 ? 1_555 95.1 ? 5 O ? A ASN 54 ? A ASN 54 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 OE1 ? A GLU 59 ? A GLU 59 ? 1_555 84.4 ? 6 O ? A VAL 57 ? A VAL 57 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 OE1 ? A GLU 59 ? A GLU 59 ? 1_555 101.0 ? 7 OE1 ? A GLU 52 ? A GLU 52 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 OE2 ? A GLU 62 ? A GLU 62 ? 1_555 100.1 ? 8 O ? A ASN 54 ? A ASN 54 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 OE2 ? A GLU 62 ? A GLU 62 ? 1_555 166.0 ? 9 O ? A VAL 57 ? A VAL 57 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 OE2 ? A GLU 62 ? A GLU 62 ? 1_555 93.6 ? 10 OE1 ? A GLU 59 ? A GLU 59 ? 1_555 CA ? B CA . ? A CA 301 ? 1_555 OE2 ? A GLU 62 ? A GLU 62 ? 1_555 83.5 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 7 ? CYS A 137 ? CYS A 7 ? 1_555 CYS A 137 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 25 ? CYS A 41 ? CYS A 25 ? 1_555 CYS A 41 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 109 ? CYS A 210 ? CYS A 109 ? 1_555 CYS A 210 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 116 ? CYS A 183 ? CYS A 116 ? 1_555 CYS A 183 ? 1_555 SG SG . . . None 'Disulfide bridge' 5 CYS A 148 ? CYS A 162 ? CYS A 148 ? 1_555 CYS A 162 ? 1_555 SG SG . . . None 'Disulfide bridge' 6 CYS A 173 ? CYS A 197 ? CYS A 173 ? 1_555 CYS A 197 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 5 ? THR A 6 ? TYR A 5 THR A 6 AA1 2 LYS A 136 ? PRO A 141 ? LYS A 136 PRO A 141 AA1 3 GLN A 115 ? GLY A 120 ? GLN A 115 GLY A 120 AA1 4 PRO A 180 ? CYS A 183 ? PRO A 180 CYS A 183 AA1 5 LYS A 186 ? TRP A 193 ? LYS A 186 TRP A 193 AA1 6 GLY A 204 ? LYS A 208 ? GLY A 204 LYS A 208 AA1 7 MET A 160 ? ALA A 163 ? MET A 160 ALA A 163 AA2 1 GLN A 15 ? ASN A 19 ? GLN A 15 ASN A 19 AA2 2 HIS A 23 ? ASN A 31 ? HIS A 23 ASN A 31 AA2 3 TRP A 34 ? SER A 37 ? TRP A 34 SER A 37 AA2 4 MET A 86 ? LEU A 90 ? MET A 86 LEU A 90 AA2 5 GLN A 63 ? VAL A 72 ? GLN A 63 VAL A 72 AA2 6 GLN A 47 ? LEU A 50 ? GLN A 47 LEU A 50 AA2 7 GLN A 15 ? ASN A 19 ? GLN A 15 ASN A 19 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TYR A 5 ? N TYR A 5 O CYS A 137 ? O CYS A 137 AA1 2 3 O LEU A 138 ? O LEU A 138 N ILE A 118 ? N ILE A 118 AA1 3 4 N LEU A 117 ? N LEU A 117 O VAL A 182 ? O VAL A 182 AA1 4 5 N CYS A 183 ? N CYS A 183 O LYS A 186 ? O LYS A 186 AA1 5 6 N TRP A 193 ? N TRP A 193 O VAL A 205 ? O VAL A 205 AA1 6 7 O TYR A 206 ? O TYR A 206 N PHE A 161 ? N PHE A 161 AA2 1 2 N LEU A 18 ? N LEU A 18 O CYS A 25 ? O CYS A 25 AA2 2 3 N SER A 28 ? N SER A 28 O VAL A 36 ? O VAL A 36 AA2 3 4 N VAL A 35 ? N VAL A 35 O ILE A 88 ? O ILE A 88 AA2 4 5 O LEU A 87 ? O LEU A 87 N ILE A 71 ? N ILE A 71 AA2 5 6 O ILE A 65 ? O ILE A 65 N VAL A 48 ? N VAL A 48 AA2 6 7 O ARG A 49 ? O ARG A 49 N SER A 17 ? N SER A 17 # _pdbx_entry_details.entry_id 9AWV _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 455 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 473 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.19 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 49 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 49 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH1 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 49 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 117.27 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation -3.03 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 53 ? ? -118.67 -70.22 2 1 SER A 177 ? ? -39.91 138.19 3 1 SER A 192 ? ? -120.38 -67.57 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 49 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.086 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BEN C1 C Y N 74 BEN C2 C Y N 75 BEN C3 C Y N 76 BEN C4 C Y N 77 BEN C5 C Y N 78 BEN C6 C Y N 79 BEN C C N N 80 BEN N1 N N N 81 BEN N2 N N N 82 BEN H2 H N N 83 BEN H3 H N N 84 BEN H4 H N N 85 BEN H5 H N N 86 BEN H6 H N N 87 BEN HN1 H N N 88 BEN HN21 H N N 89 BEN HN22 H N N 90 CA CA CA N N 91 CYS N N N N 92 CYS CA C N R 93 CYS C C N N 94 CYS O O N N 95 CYS CB C N N 96 CYS SG S N N 97 CYS OXT O N N 98 CYS H H N N 99 CYS H2 H N N 100 CYS HA H N N 101 CYS HB2 H N N 102 CYS HB3 H N N 103 CYS HG H N N 104 CYS HXT H N N 105 GLN N N N N 106 GLN CA C N S 107 GLN C C N N 108 GLN O O N N 109 GLN CB C N N 110 GLN CG C N N 111 GLN CD C N N 112 GLN OE1 O N N 113 GLN NE2 N N N 114 GLN OXT O N N 115 GLN H H N N 116 GLN H2 H N N 117 GLN HA H N N 118 GLN HB2 H N N 119 GLN HB3 H N N 120 GLN HG2 H N N 121 GLN HG3 H N N 122 GLN HE21 H N N 123 GLN HE22 H N N 124 GLN HXT H N N 125 GLU N N N N 126 GLU CA C N S 127 GLU C C N N 128 GLU O O N N 129 GLU CB C N N 130 GLU CG C N N 131 GLU CD C N N 132 GLU OE1 O N N 133 GLU OE2 O N N 134 GLU OXT O N N 135 GLU H H N N 136 GLU H2 H N N 137 GLU HA H N N 138 GLU HB2 H N N 139 GLU HB3 H N N 140 GLU HG2 H N N 141 GLU HG3 H N N 142 GLU HE2 H N N 143 GLU HXT H N N 144 GLY N N N N 145 GLY CA C N N 146 GLY C C N N 147 GLY O O N N 148 GLY OXT O N N 149 GLY H H N N 150 GLY H2 H N N 151 GLY HA2 H N N 152 GLY HA3 H N N 153 GLY HXT H N N 154 HIS N N N N 155 HIS CA C N S 156 HIS C C N N 157 HIS O O N N 158 HIS CB C N N 159 HIS CG C Y N 160 HIS ND1 N Y N 161 HIS CD2 C Y N 162 HIS CE1 C Y N 163 HIS NE2 N Y N 164 HIS OXT O N N 165 HIS H H N N 166 HIS H2 H N N 167 HIS HA H N N 168 HIS HB2 H N N 169 HIS HB3 H N N 170 HIS HD1 H N N 171 HIS HD2 H N N 172 HIS HE1 H N N 173 HIS HE2 H N N 174 HIS HXT H N N 175 HOH O O N N 176 HOH H1 H N N 177 HOH H2 H N N 178 ILE N N N N 179 ILE CA C N S 180 ILE C C N N 181 ILE O O N N 182 ILE CB C N S 183 ILE CG1 C N N 184 ILE CG2 C N N 185 ILE CD1 C N N 186 ILE OXT O N N 187 ILE H H N N 188 ILE H2 H N N 189 ILE HA H N N 190 ILE HB H N N 191 ILE HG12 H N N 192 ILE HG13 H N N 193 ILE HG21 H N N 194 ILE HG22 H N N 195 ILE HG23 H N N 196 ILE HD11 H N N 197 ILE HD12 H N N 198 ILE HD13 H N N 199 ILE HXT H N N 200 LEU N N N N 201 LEU CA C N S 202 LEU C C N N 203 LEU O O N N 204 LEU CB C N N 205 LEU CG C N N 206 LEU CD1 C N N 207 LEU CD2 C N N 208 LEU OXT O N N 209 LEU H H N N 210 LEU H2 H N N 211 LEU HA H N N 212 LEU HB2 H N N 213 LEU HB3 H N N 214 LEU HG H N N 215 LEU HD11 H N N 216 LEU HD12 H N N 217 LEU HD13 H N N 218 LEU HD21 H N N 219 LEU HD22 H N N 220 LEU HD23 H N N 221 LEU HXT H N N 222 LYS N N N N 223 LYS CA C N S 224 LYS C C N N 225 LYS O O N N 226 LYS CB C N N 227 LYS CG C N N 228 LYS CD C N N 229 LYS CE C N N 230 LYS NZ N N N 231 LYS OXT O N N 232 LYS H H N N 233 LYS H2 H N N 234 LYS HA H N N 235 LYS HB2 H N N 236 LYS HB3 H N N 237 LYS HG2 H N N 238 LYS HG3 H N N 239 LYS HD2 H N N 240 LYS HD3 H N N 241 LYS HE2 H N N 242 LYS HE3 H N N 243 LYS HZ1 H N N 244 LYS HZ2 H N N 245 LYS HZ3 H N N 246 LYS HXT H N N 247 MET N N N N 248 MET CA C N S 249 MET C C N N 250 MET O O N N 251 MET CB C N N 252 MET CG C N N 253 MET SD S N N 254 MET CE C N N 255 MET OXT O N N 256 MET H H N N 257 MET H2 H N N 258 MET HA H N N 259 MET HB2 H N N 260 MET HB3 H N N 261 MET HG2 H N N 262 MET HG3 H N N 263 MET HE1 H N N 264 MET HE2 H N N 265 MET HE3 H N N 266 MET HXT H N N 267 PHE N N N N 268 PHE CA C N S 269 PHE C C N N 270 PHE O O N N 271 PHE CB C N N 272 PHE CG C Y N 273 PHE CD1 C Y N 274 PHE CD2 C Y N 275 PHE CE1 C Y N 276 PHE CE2 C Y N 277 PHE CZ C Y N 278 PHE OXT O N N 279 PHE H H N N 280 PHE H2 H N N 281 PHE HA H N N 282 PHE HB2 H N N 283 PHE HB3 H N N 284 PHE HD1 H N N 285 PHE HD2 H N N 286 PHE HE1 H N N 287 PHE HE2 H N N 288 PHE HZ H N N 289 PHE HXT H N N 290 PRO N N N N 291 PRO CA C N S 292 PRO C C N N 293 PRO O O N N 294 PRO CB C N N 295 PRO CG C N N 296 PRO CD C N N 297 PRO OXT O N N 298 PRO H H N N 299 PRO HA H N N 300 PRO HB2 H N N 301 PRO HB3 H N N 302 PRO HG2 H N N 303 PRO HG3 H N N 304 PRO HD2 H N N 305 PRO HD3 H N N 306 PRO HXT H N N 307 SER N N N N 308 SER CA C N S 309 SER C C N N 310 SER O O N N 311 SER CB C N N 312 SER OG O N N 313 SER OXT O N N 314 SER H H N N 315 SER H2 H N N 316 SER HA H N N 317 SER HB2 H N N 318 SER HB3 H N N 319 SER HG H N N 320 SER HXT H N N 321 THR N N N N 322 THR CA C N S 323 THR C C N N 324 THR O O N N 325 THR CB C N R 326 THR OG1 O N N 327 THR CG2 C N N 328 THR OXT O N N 329 THR H H N N 330 THR H2 H N N 331 THR HA H N N 332 THR HB H N N 333 THR HG1 H N N 334 THR HG21 H N N 335 THR HG22 H N N 336 THR HG23 H N N 337 THR HXT H N N 338 TRP N N N N 339 TRP CA C N S 340 TRP C C N N 341 TRP O O N N 342 TRP CB C N N 343 TRP CG C Y N 344 TRP CD1 C Y N 345 TRP CD2 C Y N 346 TRP NE1 N Y N 347 TRP CE2 C Y N 348 TRP CE3 C Y N 349 TRP CZ2 C Y N 350 TRP CZ3 C Y N 351 TRP CH2 C Y N 352 TRP OXT O N N 353 TRP H H N N 354 TRP H2 H N N 355 TRP HA H N N 356 TRP HB2 H N N 357 TRP HB3 H N N 358 TRP HD1 H N N 359 TRP HE1 H N N 360 TRP HE3 H N N 361 TRP HZ2 H N N 362 TRP HZ3 H N N 363 TRP HH2 H N N 364 TRP HXT H N N 365 TYR N N N N 366 TYR CA C N S 367 TYR C C N N 368 TYR O O N N 369 TYR CB C N N 370 TYR CG C Y N 371 TYR CD1 C Y N 372 TYR CD2 C Y N 373 TYR CE1 C Y N 374 TYR CE2 C Y N 375 TYR CZ C Y N 376 TYR OH O N N 377 TYR OXT O N N 378 TYR H H N N 379 TYR H2 H N N 380 TYR HA H N N 381 TYR HB2 H N N 382 TYR HB3 H N N 383 TYR HD1 H N N 384 TYR HD2 H N N 385 TYR HE1 H N N 386 TYR HE2 H N N 387 TYR HH H N N 388 TYR HXT H N N 389 VAL N N N N 390 VAL CA C N S 391 VAL C C N N 392 VAL O O N N 393 VAL CB C N N 394 VAL CG1 C N N 395 VAL CG2 C N N 396 VAL OXT O N N 397 VAL H H N N 398 VAL H2 H N N 399 VAL HA H N N 400 VAL HB H N N 401 VAL HG11 H N N 402 VAL HG12 H N N 403 VAL HG13 H N N 404 VAL HG21 H N N 405 VAL HG22 H N N 406 VAL HG23 H N N 407 VAL HXT H N N 408 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BEN C1 C2 doub Y N 70 BEN C1 C6 sing Y N 71 BEN C1 C sing N N 72 BEN C2 C3 sing Y N 73 BEN C2 H2 sing N N 74 BEN C3 C4 doub Y N 75 BEN C3 H3 sing N N 76 BEN C4 C5 sing Y N 77 BEN C4 H4 sing N N 78 BEN C5 C6 doub Y N 79 BEN C5 H5 sing N N 80 BEN C6 H6 sing N N 81 BEN C N1 doub N E 82 BEN C N2 sing N N 83 BEN N1 HN1 sing N N 84 BEN N2 HN21 sing N N 85 BEN N2 HN22 sing N N 86 CYS N CA sing N N 87 CYS N H sing N N 88 CYS N H2 sing N N 89 CYS CA C sing N N 90 CYS CA CB sing N N 91 CYS CA HA sing N N 92 CYS C O doub N N 93 CYS C OXT sing N N 94 CYS CB SG sing N N 95 CYS CB HB2 sing N N 96 CYS CB HB3 sing N N 97 CYS SG HG sing N N 98 CYS OXT HXT sing N N 99 GLN N CA sing N N 100 GLN N H sing N N 101 GLN N H2 sing N N 102 GLN CA C sing N N 103 GLN CA CB sing N N 104 GLN CA HA sing N N 105 GLN C O doub N N 106 GLN C OXT sing N N 107 GLN CB CG sing N N 108 GLN CB HB2 sing N N 109 GLN CB HB3 sing N N 110 GLN CG CD sing N N 111 GLN CG HG2 sing N N 112 GLN CG HG3 sing N N 113 GLN CD OE1 doub N N 114 GLN CD NE2 sing N N 115 GLN NE2 HE21 sing N N 116 GLN NE2 HE22 sing N N 117 GLN OXT HXT sing N N 118 GLU N CA sing N N 119 GLU N H sing N N 120 GLU N H2 sing N N 121 GLU CA C sing N N 122 GLU CA CB sing N N 123 GLU CA HA sing N N 124 GLU C O doub N N 125 GLU C OXT sing N N 126 GLU CB CG sing N N 127 GLU CB HB2 sing N N 128 GLU CB HB3 sing N N 129 GLU CG CD sing N N 130 GLU CG HG2 sing N N 131 GLU CG HG3 sing N N 132 GLU CD OE1 doub N N 133 GLU CD OE2 sing N N 134 GLU OE2 HE2 sing N N 135 GLU OXT HXT sing N N 136 GLY N CA sing N N 137 GLY N H sing N N 138 GLY N H2 sing N N 139 GLY CA C sing N N 140 GLY CA HA2 sing N N 141 GLY CA HA3 sing N N 142 GLY C O doub N N 143 GLY C OXT sing N N 144 GLY OXT HXT sing N N 145 HIS N CA sing N N 146 HIS N H sing N N 147 HIS N H2 sing N N 148 HIS CA C sing N N 149 HIS CA CB sing N N 150 HIS CA HA sing N N 151 HIS C O doub N N 152 HIS C OXT sing N N 153 HIS CB CG sing N N 154 HIS CB HB2 sing N N 155 HIS CB HB3 sing N N 156 HIS CG ND1 sing Y N 157 HIS CG CD2 doub Y N 158 HIS ND1 CE1 doub Y N 159 HIS ND1 HD1 sing N N 160 HIS CD2 NE2 sing Y N 161 HIS CD2 HD2 sing N N 162 HIS CE1 NE2 sing Y N 163 HIS CE1 HE1 sing N N 164 HIS NE2 HE2 sing N N 165 HIS OXT HXT sing N N 166 HOH O H1 sing N N 167 HOH O H2 sing N N 168 ILE N CA sing N N 169 ILE N H sing N N 170 ILE N H2 sing N N 171 ILE CA C sing N N 172 ILE CA CB sing N N 173 ILE CA HA sing N N 174 ILE C O doub N N 175 ILE C OXT sing N N 176 ILE CB CG1 sing N N 177 ILE CB CG2 sing N N 178 ILE CB HB sing N N 179 ILE CG1 CD1 sing N N 180 ILE CG1 HG12 sing N N 181 ILE CG1 HG13 sing N N 182 ILE CG2 HG21 sing N N 183 ILE CG2 HG22 sing N N 184 ILE CG2 HG23 sing N N 185 ILE CD1 HD11 sing N N 186 ILE CD1 HD12 sing N N 187 ILE CD1 HD13 sing N N 188 ILE OXT HXT sing N N 189 LEU N CA sing N N 190 LEU N H sing N N 191 LEU N H2 sing N N 192 LEU CA C sing N N 193 LEU CA CB sing N N 194 LEU CA HA sing N N 195 LEU C O doub N N 196 LEU C OXT sing N N 197 LEU CB CG sing N N 198 LEU CB HB2 sing N N 199 LEU CB HB3 sing N N 200 LEU CG CD1 sing N N 201 LEU CG CD2 sing N N 202 LEU CG HG sing N N 203 LEU CD1 HD11 sing N N 204 LEU CD1 HD12 sing N N 205 LEU CD1 HD13 sing N N 206 LEU CD2 HD21 sing N N 207 LEU CD2 HD22 sing N N 208 LEU CD2 HD23 sing N N 209 LEU OXT HXT sing N N 210 LYS N CA sing N N 211 LYS N H sing N N 212 LYS N H2 sing N N 213 LYS CA C sing N N 214 LYS CA CB sing N N 215 LYS CA HA sing N N 216 LYS C O doub N N 217 LYS C OXT sing N N 218 LYS CB CG sing N N 219 LYS CB HB2 sing N N 220 LYS CB HB3 sing N N 221 LYS CG CD sing N N 222 LYS CG HG2 sing N N 223 LYS CG HG3 sing N N 224 LYS CD CE sing N N 225 LYS CD HD2 sing N N 226 LYS CD HD3 sing N N 227 LYS CE NZ sing N N 228 LYS CE HE2 sing N N 229 LYS CE HE3 sing N N 230 LYS NZ HZ1 sing N N 231 LYS NZ HZ2 sing N N 232 LYS NZ HZ3 sing N N 233 LYS OXT HXT sing N N 234 MET N CA sing N N 235 MET N H sing N N 236 MET N H2 sing N N 237 MET CA C sing N N 238 MET CA CB sing N N 239 MET CA HA sing N N 240 MET C O doub N N 241 MET C OXT sing N N 242 MET CB CG sing N N 243 MET CB HB2 sing N N 244 MET CB HB3 sing N N 245 MET CG SD sing N N 246 MET CG HG2 sing N N 247 MET CG HG3 sing N N 248 MET SD CE sing N N 249 MET CE HE1 sing N N 250 MET CE HE2 sing N N 251 MET CE HE3 sing N N 252 MET OXT HXT sing N N 253 PHE N CA sing N N 254 PHE N H sing N N 255 PHE N H2 sing N N 256 PHE CA C sing N N 257 PHE CA CB sing N N 258 PHE CA HA sing N N 259 PHE C O doub N N 260 PHE C OXT sing N N 261 PHE CB CG sing N N 262 PHE CB HB2 sing N N 263 PHE CB HB3 sing N N 264 PHE CG CD1 doub Y N 265 PHE CG CD2 sing Y N 266 PHE CD1 CE1 sing Y N 267 PHE CD1 HD1 sing N N 268 PHE CD2 CE2 doub Y N 269 PHE CD2 HD2 sing N N 270 PHE CE1 CZ doub Y N 271 PHE CE1 HE1 sing N N 272 PHE CE2 CZ sing Y N 273 PHE CE2 HE2 sing N N 274 PHE CZ HZ sing N N 275 PHE OXT HXT sing N N 276 PRO N CA sing N N 277 PRO N CD sing N N 278 PRO N H sing N N 279 PRO CA C sing N N 280 PRO CA CB sing N N 281 PRO CA HA sing N N 282 PRO C O doub N N 283 PRO C OXT sing N N 284 PRO CB CG sing N N 285 PRO CB HB2 sing N N 286 PRO CB HB3 sing N N 287 PRO CG CD sing N N 288 PRO CG HG2 sing N N 289 PRO CG HG3 sing N N 290 PRO CD HD2 sing N N 291 PRO CD HD3 sing N N 292 PRO OXT HXT sing N N 293 SER N CA sing N N 294 SER N H sing N N 295 SER N H2 sing N N 296 SER CA C sing N N 297 SER CA CB sing N N 298 SER CA HA sing N N 299 SER C O doub N N 300 SER C OXT sing N N 301 SER CB OG sing N N 302 SER CB HB2 sing N N 303 SER CB HB3 sing N N 304 SER OG HG sing N N 305 SER OXT HXT sing N N 306 THR N CA sing N N 307 THR N H sing N N 308 THR N H2 sing N N 309 THR CA C sing N N 310 THR CA CB sing N N 311 THR CA HA sing N N 312 THR C O doub N N 313 THR C OXT sing N N 314 THR CB OG1 sing N N 315 THR CB CG2 sing N N 316 THR CB HB sing N N 317 THR OG1 HG1 sing N N 318 THR CG2 HG21 sing N N 319 THR CG2 HG22 sing N N 320 THR CG2 HG23 sing N N 321 THR OXT HXT sing N N 322 TRP N CA sing N N 323 TRP N H sing N N 324 TRP N H2 sing N N 325 TRP CA C sing N N 326 TRP CA CB sing N N 327 TRP CA HA sing N N 328 TRP C O doub N N 329 TRP C OXT sing N N 330 TRP CB CG sing N N 331 TRP CB HB2 sing N N 332 TRP CB HB3 sing N N 333 TRP CG CD1 doub Y N 334 TRP CG CD2 sing Y N 335 TRP CD1 NE1 sing Y N 336 TRP CD1 HD1 sing N N 337 TRP CD2 CE2 doub Y N 338 TRP CD2 CE3 sing Y N 339 TRP NE1 CE2 sing Y N 340 TRP NE1 HE1 sing N N 341 TRP CE2 CZ2 sing Y N 342 TRP CE3 CZ3 doub Y N 343 TRP CE3 HE3 sing N N 344 TRP CZ2 CH2 doub Y N 345 TRP CZ2 HZ2 sing N N 346 TRP CZ3 CH2 sing Y N 347 TRP CZ3 HZ3 sing N N 348 TRP CH2 HH2 sing N N 349 TRP OXT HXT sing N N 350 TYR N CA sing N N 351 TYR N H sing N N 352 TYR N H2 sing N N 353 TYR CA C sing N N 354 TYR CA CB sing N N 355 TYR CA HA sing N N 356 TYR C O doub N N 357 TYR C OXT sing N N 358 TYR CB CG sing N N 359 TYR CB HB2 sing N N 360 TYR CB HB3 sing N N 361 TYR CG CD1 doub Y N 362 TYR CG CD2 sing Y N 363 TYR CD1 CE1 sing Y N 364 TYR CD1 HD1 sing N N 365 TYR CD2 CE2 doub Y N 366 TYR CD2 HD2 sing N N 367 TYR CE1 CZ doub Y N 368 TYR CE1 HE1 sing N N 369 TYR CE2 CZ sing Y N 370 TYR CE2 HE2 sing N N 371 TYR CZ OH sing N N 372 TYR OH HH sing N N 373 TYR OXT HXT sing N N 374 VAL N CA sing N N 375 VAL N H sing N N 376 VAL N H2 sing N N 377 VAL CA C sing N N 378 VAL CA CB sing N N 379 VAL CA HA sing N N 380 VAL C O doub N N 381 VAL C OXT sing N N 382 VAL CB CG1 sing N N 383 VAL CB CG2 sing N N 384 VAL CB HB sing N N 385 VAL CG1 HG11 sing N N 386 VAL CG1 HG12 sing N N 387 VAL CG1 HG13 sing N N 388 VAL CG2 HG21 sing N N 389 VAL CG2 HG22 sing N N 390 VAL CG2 HG23 sing N N 391 VAL OXT HXT sing N N 392 # _pdbx_audit_support.funding_organization 'Brazilian National Council for Scientific and Technological Development (CNPq)' _pdbx_audit_support.country Brazil _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1s0r _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9AWV _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.018445 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017418 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015022 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 CA 20 20 8.627 10.442 7.387 0.660 1.590 85.748 1.021 178.437 1.375 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 0.867 # loop_ #