data_9AYE # _entry.id 9AYE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.403 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9AYE pdb_00009aye 10.2210/pdb9aye/pdb WWPDB D_1000280739 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-05-21 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9AYE _pdbx_database_status.recvd_initial_deposition_date 2024-03-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 3 _pdbx_contact_author.email soichi.wakatsuki@stanford.edu _pdbx_contact_author.name_first Soichi _pdbx_contact_author.name_last Wakatsuki _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-5896-7968 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Mathews, I.I.' 1 0000-0001-6254-3519 'Pokhrel, S.' 2 0000-0003-2258-8768 'Wakatsuki, S.' 3 0000-0001-5896-7968 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 16 _citation.language ? _citation.page_first 4187 _citation.page_last 4187 _citation.title 'A hidden cysteine in Fis1 targeted to prevent excessive mitochondrial fission and dysfunction under oxidative stress.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-025-59434-6 _citation.pdbx_database_id_PubMed 40328741 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pokhrel, S.' 1 0000-0003-2258-8768 primary 'Heo, G.' 2 0000-0001-5324-4074 primary 'Mathews, I.' 3 0000-0001-6254-3519 primary 'Yokoi, S.' 4 0000-0003-2684-3420 primary 'Matsui, T.' 5 0000-0001-7101-5259 primary 'Mitsutake, A.' 6 0000-0002-4194-7255 primary 'Wakatsuki, S.' 7 0000-0001-5896-7968 primary 'Mochly-Rosen, D.' 8 0000-0002-6691-8733 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Mitochondrial fission 1 protein' 15093.330 1 ? T34D ? ? 2 non-polymer nat '2-chloro-N-methyl-N-[3-(10H-phenothiazin-10-yl)propyl]acetamide' 346.874 1 ? ? ? ? 3 water nat water 18.015 50 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'FIS1 homolog,hFis1,Tetratricopeptide repeat protein 11,TPR repeat protein 11' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSDQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVG NYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLLEVLFQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSDQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVG NYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLLEVLFQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '2-chloro-N-methyl-N-[3-(10H-phenothiazin-10-yl)propyl]acetamide' A1AHL 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ALA n 1 4 VAL n 1 5 LEU n 1 6 ASN n 1 7 GLU n 1 8 LEU n 1 9 VAL n 1 10 SER n 1 11 VAL n 1 12 GLU n 1 13 ASP n 1 14 LEU n 1 15 LEU n 1 16 LYS n 1 17 PHE n 1 18 GLU n 1 19 LYS n 1 20 LYS n 1 21 PHE n 1 22 GLN n 1 23 SER n 1 24 GLU n 1 25 LYS n 1 26 ALA n 1 27 ALA n 1 28 GLY n 1 29 SER n 1 30 VAL n 1 31 SER n 1 32 LYS n 1 33 SER n 1 34 ASP n 1 35 GLN n 1 36 PHE n 1 37 GLU n 1 38 TYR n 1 39 ALA n 1 40 TRP n 1 41 CYS n 1 42 LEU n 1 43 VAL n 1 44 ARG n 1 45 SER n 1 46 LYS n 1 47 TYR n 1 48 ASN n 1 49 ASP n 1 50 ASP n 1 51 ILE n 1 52 ARG n 1 53 LYS n 1 54 GLY n 1 55 ILE n 1 56 VAL n 1 57 LEU n 1 58 LEU n 1 59 GLU n 1 60 GLU n 1 61 LEU n 1 62 LEU n 1 63 PRO n 1 64 LYS n 1 65 GLY n 1 66 SER n 1 67 LYS n 1 68 GLU n 1 69 GLU n 1 70 GLN n 1 71 ARG n 1 72 ASP n 1 73 TYR n 1 74 VAL n 1 75 PHE n 1 76 TYR n 1 77 LEU n 1 78 ALA n 1 79 VAL n 1 80 GLY n 1 81 ASN n 1 82 TYR n 1 83 ARG n 1 84 LEU n 1 85 LYS n 1 86 GLU n 1 87 TYR n 1 88 GLU n 1 89 LYS n 1 90 ALA n 1 91 LEU n 1 92 LYS n 1 93 TYR n 1 94 VAL n 1 95 ARG n 1 96 GLY n 1 97 LEU n 1 98 LEU n 1 99 GLN n 1 100 THR n 1 101 GLU n 1 102 PRO n 1 103 GLN n 1 104 ASN n 1 105 ASN n 1 106 GLN n 1 107 ALA n 1 108 LYS n 1 109 GLU n 1 110 LEU n 1 111 GLU n 1 112 ARG n 1 113 LEU n 1 114 ILE n 1 115 ASP n 1 116 LYS n 1 117 ALA n 1 118 MET n 1 119 LYS n 1 120 LYS n 1 121 ASP n 1 122 GLY n 1 123 LEU n 1 124 LEU n 1 125 GLU n 1 126 VAL n 1 127 LEU n 1 128 PHE n 1 129 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 129 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'FIS1, TTC11, CGI-135' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type pET-28a _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1AHL non-polymer . '2-chloro-N-methyl-N-[3-(10H-phenothiazin-10-yl)propyl]acetamide' ? 'C18 H19 Cl N2 O S' 346.874 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 ALA 3 3 ? ? ? A . n A 1 4 VAL 4 4 ? ? ? A . n A 1 5 LEU 5 5 ? ? ? A . n A 1 6 ASN 6 6 ? ? ? A . n A 1 7 GLU 7 7 ? ? ? A . n A 1 8 LEU 8 8 ? ? ? A . n A 1 9 VAL 9 9 ? ? ? A . n A 1 10 SER 10 10 ? ? ? A . n A 1 11 VAL 11 11 ? ? ? A . n A 1 12 GLU 12 12 ? ? ? A . n A 1 13 ASP 13 13 ? ? ? A . n A 1 14 LEU 14 14 ? ? ? A . n A 1 15 LEU 15 15 ? ? ? A . n A 1 16 LYS 16 16 ? ? ? A . n A 1 17 PHE 17 17 ? ? ? A . n A 1 18 GLU 18 18 ? ? ? A . n A 1 19 LYS 19 19 ? ? ? A . n A 1 20 LYS 20 20 ? ? ? A . n A 1 21 PHE 21 21 ? ? ? A . n A 1 22 GLN 22 22 ? ? ? A . n A 1 23 SER 23 23 ? ? ? A . n A 1 24 GLU 24 24 ? ? ? A . n A 1 25 LYS 25 25 ? ? ? A . n A 1 26 ALA 26 26 ? ? ? A . n A 1 27 ALA 27 27 ? ? ? A . n A 1 28 GLY 28 28 ? ? ? A . n A 1 29 SER 29 29 ? ? ? A . n A 1 30 VAL 30 30 ? ? ? A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 TRP 40 40 40 TRP TRP A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 TYR 73 73 73 TYR TYR A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 TYR 82 82 82 TYR TYR A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 TYR 87 87 87 TYR TYR A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 GLN 103 103 103 GLN GLN A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 GLN 106 106 106 GLN GLN A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 ASP 115 115 115 ASP ASP A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 MET 118 118 118 MET MET A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 PHE 128 128 ? ? ? A . n A 1 129 GLN 129 129 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1AHL _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1AHL _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 A1AHL 1 201 150 A1AHL FI9 A . C 3 HOH 1 301 48 HOH HOH A . C 3 HOH 2 302 36 HOH HOH A . C 3 HOH 3 303 29 HOH HOH A . C 3 HOH 4 304 26 HOH HOH A . C 3 HOH 5 305 12 HOH HOH A . C 3 HOH 6 306 34 HOH HOH A . C 3 HOH 7 307 16 HOH HOH A . C 3 HOH 8 308 49 HOH HOH A . C 3 HOH 9 309 4 HOH HOH A . C 3 HOH 10 310 33 HOH HOH A . C 3 HOH 11 311 27 HOH HOH A . C 3 HOH 12 312 47 HOH HOH A . C 3 HOH 13 313 11 HOH HOH A . C 3 HOH 14 314 13 HOH HOH A . C 3 HOH 15 315 1 HOH HOH A . C 3 HOH 16 316 50 HOH HOH A . C 3 HOH 17 317 5 HOH HOH A . C 3 HOH 18 318 20 HOH HOH A . C 3 HOH 19 319 10 HOH HOH A . C 3 HOH 20 320 24 HOH HOH A . C 3 HOH 21 321 14 HOH HOH A . C 3 HOH 22 322 7 HOH HOH A . C 3 HOH 23 323 25 HOH HOH A . C 3 HOH 24 324 6 HOH HOH A . C 3 HOH 25 325 22 HOH HOH A . C 3 HOH 26 326 41 HOH HOH A . C 3 HOH 27 327 23 HOH HOH A . C 3 HOH 28 328 9 HOH HOH A . C 3 HOH 29 329 40 HOH HOH A . C 3 HOH 30 330 28 HOH HOH A . C 3 HOH 31 331 8 HOH HOH A . C 3 HOH 32 332 2 HOH HOH A . C 3 HOH 33 333 15 HOH HOH A . C 3 HOH 34 334 39 HOH HOH A . C 3 HOH 35 335 19 HOH HOH A . C 3 HOH 36 336 30 HOH HOH A . C 3 HOH 37 337 31 HOH HOH A . C 3 HOH 38 338 3 HOH HOH A . C 3 HOH 39 339 42 HOH HOH A . C 3 HOH 40 340 18 HOH HOH A . C 3 HOH 41 341 21 HOH HOH A . C 3 HOH 42 342 17 HOH HOH A . C 3 HOH 43 343 44 HOH HOH A . C 3 HOH 44 344 35 HOH HOH A . C 3 HOH 45 345 45 HOH HOH A . C 3 HOH 46 346 43 HOH HOH A . C 3 HOH 47 347 38 HOH HOH A . C 3 HOH 48 348 46 HOH HOH A . C 3 HOH 49 349 37 HOH HOH A . C 3 HOH 50 350 32 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.20.1_4487: ???)' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9AYE _cell.details ? _cell.formula_units_Z ? _cell.length_a 43.170 _cell.length_a_esd ? _cell.length_b 51.790 _cell.length_b_esd ? _cell.length_c 59.990 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9AYE _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9AYE _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.22 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.69 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.001 M Zinc Sulfate, 0.05M HEPES (pH 7.8), 28% PEG 600' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 292 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details KB _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-12-01 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979460 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL12-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979460 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL12-1 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9AYE _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.9 _reflns.d_resolution_low 35.04 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11085 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.7 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.78 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.083 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.079 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 1.90 1.95 ? ? ? ? ? ? 802 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1.767 ? ? 1 1 0.6920000000000001 ? ? ? ? 1.694 ? ? ? ? ? ? ? ? ? 1.95 2.0 ? ? ? ? ? ? 789 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1.198 ? ? 2 1 0.858 ? ? ? ? 1.148 ? ? ? ? ? ? ? ? ? 2.00 2.06 ? ? ? ? ? ? 762 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.847 ? ? 3 1 0.907 ? ? ? ? 0.812 ? ? ? ? ? ? ? ? ? 2.06 2.12 ? ? ? ? ? ? 724 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.57 ? ? 4 1 0.958 ? ? ? ? 0.547 ? ? ? ? ? ? ? ? ? 2.12 2.19 ? ? ? ? ? ? 733 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.38299999999999995 ? ? 5 1 0.973 ? ? ? ? 0.36700000000000005 ? ? ? ? ? ? ? ? ? 2.19 2.27 ? ? ? ? ? ? 696 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.294 ? ? 6 1 0.983 ? ? ? ? 0.282 ? ? ? ? ? ? ? ? ? 2.27 2.36 ? ? ? ? ? ? 663 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.22899999999999998 ? ? 7 1 0.9890000000000001 ? ? ? ? 0.218 ? ? ? ? ? ? ? ? ? 2.36 2.45 ? ? ? ? ? ? 660 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.18 ? ? 8 1 0.9940000000000001 ? ? ? ? 0.17300000000000001 ? ? ? ? ? ? ? ? ? 2.45 2.56 ? ? ? ? ? ? 623 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.154 ? ? 9 1 0.993 ? ? ? ? 0.14800000000000002 ? ? ? ? ? ? ? ? ? 2.56 2.69 ? ? ? ? ? ? 595 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.136 ? ? 10 1 0.993 ? ? ? ? 0.13 ? ? ? ? ? ? ? ? ? 2.69 2.83 ? ? ? ? ? ? 580 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.11800000000000001 ? ? 11 1 0.996 ? ? ? ? 0.113 ? ? ? ? ? ? ? ? ? 2.83 3.0 ? ? ? ? ? ? 541 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.10300000000000001 ? ? 12 1 0.996 ? ? ? ? 0.099 ? ? ? ? ? ? ? ? ? 3.00 3.21 ? ? ? ? ? ? 509 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.09300000000000001 ? ? 13 1 0.996 ? ? ? ? 0.08800000000000001 ? ? ? ? ? ? ? ? ? 3.21 3.47 ? ? ? ? ? ? 479 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.081 ? ? 14 1 0.997 ? ? ? ? 0.077 ? ? ? ? ? ? ? ? ? 3.47 3.8 ? ? ? ? ? ? 442 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.08199999999999999 ? ? 15 1 0.997 ? ? ? ? 0.079 ? ? ? ? ? ? ? ? ? 3.80 4.25 ? ? ? ? ? ? 406 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.08 ? ? 16 1 0.997 ? ? ? ? 0.077 ? ? ? ? ? ? ? ? ? 4.25 4.91 ? ? ? ? ? ? 370 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.083 ? ? 17 1 0.997 ? ? ? ? 0.079 ? ? ? ? ? ? ? ? ? 4.91 6.01 ? ? ? ? ? ? 312 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.076 ? ? 18 1 0.998 ? ? ? ? 0.073 ? ? ? ? ? ? ? ? ? 6.01 8.5 ? ? ? ? ? ? 250 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.064 ? ? 19 1 0.9990000000000001 ? ? ? ? 0.061 ? ? ? ? ? ? ? ? ? 8.50 35.04 ? ? ? ? ? ? 149 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 0.059000000000000004 ? ? 20 1 0.997 ? ? ? ? 0.054000000000000006 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9AYE _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.90 _refine.ls_d_res_low 35.04 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11078 _refine.ls_number_reflns_R_free 554 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.91 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2126 _refine.ls_R_factor_R_free 0.2538 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2105 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 37.73 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.33 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.90 _refine_hist.d_res_low 35.04 _refine_hist.number_atoms_solvent 50 _refine_hist.number_atoms_total 880 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 808 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 22 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 844 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.032 ? 1131 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 5.430 ? 114 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.048 ? 117 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 ? 145 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.90 2.09 . . 136 2573 100.00 . . . . 0.3555 . . . . . . . . . . . 0.4154 'X-RAY DIFFRACTION' 2.09 2.39 . . 137 2594 100.00 . . . . 0.2863 . . . . . . . . . . . 0.2905 'X-RAY DIFFRACTION' 2.39 3.02 . . 137 2614 100.00 . . . . 0.2728 . . . . . . . . . . . 0.3097 'X-RAY DIFFRACTION' 3.02 35.04 . . 144 2743 100.00 . . . . 0.1792 . . . . . . . . . . . 0.2249 # _struct.entry_id 9AYE _struct.title 'FIS1 T34D Covalent inhibitor complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9AYE _struct_keywords.text 'Fis1 Structure, Covalent inhibitor, Drug Design mitochondrial fission, UNKNOWN FUNCTION, UNKNOWN FUNCTION-INHIBITOR complex' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION/INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FIS1_HUMAN _struct_ref.pdbx_db_accession Q9Y3D6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVG NYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGL ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9AYE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 123 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9Y3D6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 123 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 123 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9AYE ASP A 34 ? UNP Q9Y3D6 THR 34 'engineered mutation' 34 1 1 9AYE LEU A 124 ? UNP Q9Y3D6 ? ? 'expression tag' 124 2 1 9AYE GLU A 125 ? UNP Q9Y3D6 ? ? 'expression tag' 125 3 1 9AYE VAL A 126 ? UNP Q9Y3D6 ? ? 'expression tag' 126 4 1 9AYE LEU A 127 ? UNP Q9Y3D6 ? ? 'expression tag' 127 5 1 9AYE PHE A 128 ? UNP Q9Y3D6 ? ? 'expression tag' 128 6 1 9AYE GLN A 129 ? UNP Q9Y3D6 ? ? 'expression tag' 129 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 31 ? ARG A 44 ? SER A 31 ARG A 44 1 ? 14 HELX_P HELX_P2 AA2 TYR A 47 ? LEU A 62 ? TYR A 47 LEU A 62 1 ? 16 HELX_P HELX_P3 AA3 PRO A 63 ? GLY A 65 ? PRO A 63 GLY A 65 5 ? 3 HELX_P HELX_P4 AA4 SER A 66 ? LEU A 84 ? SER A 66 LEU A 84 1 ? 19 HELX_P HELX_P5 AA5 GLU A 86 ? GLU A 101 ? GLU A 86 GLU A 101 1 ? 16 HELX_P HELX_P6 AA6 ASN A 104 ? VAL A 126 ? ASN A 104 VAL A 126 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag one _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 41 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id A1AHL _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C20 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 41 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id A1AHL _struct_conn.ptnr2_auth_seq_id 201 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.767 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id A1AHL _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 41 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id A1AHL _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 201 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 41 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom C20 _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id A1AHL _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Covalent chemical modification' # _pdbx_entry_details.entry_id 9AYE _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 NZ _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 LYS _pdbx_validate_close_contact.auth_seq_id_1 46 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 301 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.19 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id GLU _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 101 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -118.57 _pdbx_validate_torsion.psi 77.09 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -4.7216 _pdbx_refine_tls.origin_y -12.0463 _pdbx_refine_tls.origin_z 9.1836 _pdbx_refine_tls.T[1][1] 0.6528 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0213 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0606 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.2772 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0351 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.5117 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 4.5522 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.8276 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 1.5313 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 3.6537 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.6753 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 2.9553 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.0456 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.3963 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.0600 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.3955 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.0089 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.0041 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.2735 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.1070 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.0497 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A ALA 3 ? A ALA 3 4 1 Y 1 A VAL 4 ? A VAL 4 5 1 Y 1 A LEU 5 ? A LEU 5 6 1 Y 1 A ASN 6 ? A ASN 6 7 1 Y 1 A GLU 7 ? A GLU 7 8 1 Y 1 A LEU 8 ? A LEU 8 9 1 Y 1 A VAL 9 ? A VAL 9 10 1 Y 1 A SER 10 ? A SER 10 11 1 Y 1 A VAL 11 ? A VAL 11 12 1 Y 1 A GLU 12 ? A GLU 12 13 1 Y 1 A ASP 13 ? A ASP 13 14 1 Y 1 A LEU 14 ? A LEU 14 15 1 Y 1 A LEU 15 ? A LEU 15 16 1 Y 1 A LYS 16 ? A LYS 16 17 1 Y 1 A PHE 17 ? A PHE 17 18 1 Y 1 A GLU 18 ? A GLU 18 19 1 Y 1 A LYS 19 ? A LYS 19 20 1 Y 1 A LYS 20 ? A LYS 20 21 1 Y 1 A PHE 21 ? A PHE 21 22 1 Y 1 A GLN 22 ? A GLN 22 23 1 Y 1 A SER 23 ? A SER 23 24 1 Y 1 A GLU 24 ? A GLU 24 25 1 Y 1 A LYS 25 ? A LYS 25 26 1 Y 1 A ALA 26 ? A ALA 26 27 1 Y 1 A ALA 27 ? A ALA 27 28 1 Y 1 A GLY 28 ? A GLY 28 29 1 Y 1 A SER 29 ? A SER 29 30 1 Y 1 A VAL 30 ? A VAL 30 31 1 Y 1 A PHE 128 ? A PHE 128 32 1 Y 1 A GLN 129 ? A GLN 129 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1AHL C11 C Y N 1 A1AHL C12 C Y N 2 A1AHL C13 C Y N 3 A1AHL C16 C N N 4 A1AHL C1 C Y N 5 A1AHL C14 C Y N 6 A1AHL C15 C N N 7 A1AHL C17 C N N 8 A1AHL C19 C N N 9 A1AHL C2 C Y N 10 A1AHL C20 C N N 11 A1AHL C22 C N N 12 A1AHL C3 C Y N 13 A1AHL C4 C Y N 14 A1AHL C5 C Y N 15 A1AHL C6 C Y N 16 A1AHL C8 C Y N 17 A1AHL C9 C Y N 18 A1AHL N1 N N N 19 A1AHL N2 N N N 20 A1AHL O1 O N N 21 A1AHL S1 S N N 22 A1AHL H1 H N N 23 A1AHL H2 H N N 24 A1AHL H3 H N N 25 A1AHL H4 H N N 26 A1AHL H5 H N N 27 A1AHL H6 H N N 28 A1AHL H7 H N N 29 A1AHL H8 H N N 30 A1AHL H9 H N N 31 A1AHL H10 H N N 32 A1AHL H11 H N N 33 A1AHL H12 H N N 34 A1AHL H13 H N N 35 A1AHL H14 H N N 36 A1AHL H16 H N N 37 A1AHL H17 H N N 38 A1AHL H18 H N N 39 A1AHL H19 H N N 40 A1AHL H20 H N N 41 A1AHL CL1 CL N N 42 ALA N N N N 43 ALA CA C N S 44 ALA C C N N 45 ALA O O N N 46 ALA CB C N N 47 ALA OXT O N N 48 ALA H H N N 49 ALA H2 H N N 50 ALA HA H N N 51 ALA HB1 H N N 52 ALA HB2 H N N 53 ALA HB3 H N N 54 ALA HXT H N N 55 ARG N N N N 56 ARG CA C N S 57 ARG C C N N 58 ARG O O N N 59 ARG CB C N N 60 ARG CG C N N 61 ARG CD C N N 62 ARG NE N N N 63 ARG CZ C N N 64 ARG NH1 N N N 65 ARG NH2 N N N 66 ARG OXT O N N 67 ARG H H N N 68 ARG H2 H N N 69 ARG HA H N N 70 ARG HB2 H N N 71 ARG HB3 H N N 72 ARG HG2 H N N 73 ARG HG3 H N N 74 ARG HD2 H N N 75 ARG HD3 H N N 76 ARG HE H N N 77 ARG HH11 H N N 78 ARG HH12 H N N 79 ARG HH21 H N N 80 ARG HH22 H N N 81 ARG HXT H N N 82 ASN N N N N 83 ASN CA C N S 84 ASN C C N N 85 ASN O O N N 86 ASN CB C N N 87 ASN CG C N N 88 ASN OD1 O N N 89 ASN ND2 N N N 90 ASN OXT O N N 91 ASN H H N N 92 ASN H2 H N N 93 ASN HA H N N 94 ASN HB2 H N N 95 ASN HB3 H N N 96 ASN HD21 H N N 97 ASN HD22 H N N 98 ASN HXT H N N 99 ASP N N N N 100 ASP CA C N S 101 ASP C C N N 102 ASP O O N N 103 ASP CB C N N 104 ASP CG C N N 105 ASP OD1 O N N 106 ASP OD2 O N N 107 ASP OXT O N N 108 ASP H H N N 109 ASP H2 H N N 110 ASP HA H N N 111 ASP HB2 H N N 112 ASP HB3 H N N 113 ASP HD2 H N N 114 ASP HXT H N N 115 CYS N N N N 116 CYS CA C N R 117 CYS C C N N 118 CYS O O N N 119 CYS CB C N N 120 CYS SG S N N 121 CYS OXT O N N 122 CYS H H N N 123 CYS H2 H N N 124 CYS HA H N N 125 CYS HB2 H N N 126 CYS HB3 H N N 127 CYS HG H N N 128 CYS HXT H N N 129 GLN N N N N 130 GLN CA C N S 131 GLN C C N N 132 GLN O O N N 133 GLN CB C N N 134 GLN CG C N N 135 GLN CD C N N 136 GLN OE1 O N N 137 GLN NE2 N N N 138 GLN OXT O N N 139 GLN H H N N 140 GLN H2 H N N 141 GLN HA H N N 142 GLN HB2 H N N 143 GLN HB3 H N N 144 GLN HG2 H N N 145 GLN HG3 H N N 146 GLN HE21 H N N 147 GLN HE22 H N N 148 GLN HXT H N N 149 GLU N N N N 150 GLU CA C N S 151 GLU C C N N 152 GLU O O N N 153 GLU CB C N N 154 GLU CG C N N 155 GLU CD C N N 156 GLU OE1 O N N 157 GLU OE2 O N N 158 GLU OXT O N N 159 GLU H H N N 160 GLU H2 H N N 161 GLU HA H N N 162 GLU HB2 H N N 163 GLU HB3 H N N 164 GLU HG2 H N N 165 GLU HG3 H N N 166 GLU HE2 H N N 167 GLU HXT H N N 168 GLY N N N N 169 GLY CA C N N 170 GLY C C N N 171 GLY O O N N 172 GLY OXT O N N 173 GLY H H N N 174 GLY H2 H N N 175 GLY HA2 H N N 176 GLY HA3 H N N 177 GLY HXT H N N 178 HOH O O N N 179 HOH H1 H N N 180 HOH H2 H N N 181 ILE N N N N 182 ILE CA C N S 183 ILE C C N N 184 ILE O O N N 185 ILE CB C N S 186 ILE CG1 C N N 187 ILE CG2 C N N 188 ILE CD1 C N N 189 ILE OXT O N N 190 ILE H H N N 191 ILE H2 H N N 192 ILE HA H N N 193 ILE HB H N N 194 ILE HG12 H N N 195 ILE HG13 H N N 196 ILE HG21 H N N 197 ILE HG22 H N N 198 ILE HG23 H N N 199 ILE HD11 H N N 200 ILE HD12 H N N 201 ILE HD13 H N N 202 ILE HXT H N N 203 LEU N N N N 204 LEU CA C N S 205 LEU C C N N 206 LEU O O N N 207 LEU CB C N N 208 LEU CG C N N 209 LEU CD1 C N N 210 LEU CD2 C N N 211 LEU OXT O N N 212 LEU H H N N 213 LEU H2 H N N 214 LEU HA H N N 215 LEU HB2 H N N 216 LEU HB3 H N N 217 LEU HG H N N 218 LEU HD11 H N N 219 LEU HD12 H N N 220 LEU HD13 H N N 221 LEU HD21 H N N 222 LEU HD22 H N N 223 LEU HD23 H N N 224 LEU HXT H N N 225 LYS N N N N 226 LYS CA C N S 227 LYS C C N N 228 LYS O O N N 229 LYS CB C N N 230 LYS CG C N N 231 LYS CD C N N 232 LYS CE C N N 233 LYS NZ N N N 234 LYS OXT O N N 235 LYS H H N N 236 LYS H2 H N N 237 LYS HA H N N 238 LYS HB2 H N N 239 LYS HB3 H N N 240 LYS HG2 H N N 241 LYS HG3 H N N 242 LYS HD2 H N N 243 LYS HD3 H N N 244 LYS HE2 H N N 245 LYS HE3 H N N 246 LYS HZ1 H N N 247 LYS HZ2 H N N 248 LYS HZ3 H N N 249 LYS HXT H N N 250 MET N N N N 251 MET CA C N S 252 MET C C N N 253 MET O O N N 254 MET CB C N N 255 MET CG C N N 256 MET SD S N N 257 MET CE C N N 258 MET OXT O N N 259 MET H H N N 260 MET H2 H N N 261 MET HA H N N 262 MET HB2 H N N 263 MET HB3 H N N 264 MET HG2 H N N 265 MET HG3 H N N 266 MET HE1 H N N 267 MET HE2 H N N 268 MET HE3 H N N 269 MET HXT H N N 270 PHE N N N N 271 PHE CA C N S 272 PHE C C N N 273 PHE O O N N 274 PHE CB C N N 275 PHE CG C Y N 276 PHE CD1 C Y N 277 PHE CD2 C Y N 278 PHE CE1 C Y N 279 PHE CE2 C Y N 280 PHE CZ C Y N 281 PHE OXT O N N 282 PHE H H N N 283 PHE H2 H N N 284 PHE HA H N N 285 PHE HB2 H N N 286 PHE HB3 H N N 287 PHE HD1 H N N 288 PHE HD2 H N N 289 PHE HE1 H N N 290 PHE HE2 H N N 291 PHE HZ H N N 292 PHE HXT H N N 293 PRO N N N N 294 PRO CA C N S 295 PRO C C N N 296 PRO O O N N 297 PRO CB C N N 298 PRO CG C N N 299 PRO CD C N N 300 PRO OXT O N N 301 PRO H H N N 302 PRO HA H N N 303 PRO HB2 H N N 304 PRO HB3 H N N 305 PRO HG2 H N N 306 PRO HG3 H N N 307 PRO HD2 H N N 308 PRO HD3 H N N 309 PRO HXT H N N 310 SER N N N N 311 SER CA C N S 312 SER C C N N 313 SER O O N N 314 SER CB C N N 315 SER OG O N N 316 SER OXT O N N 317 SER H H N N 318 SER H2 H N N 319 SER HA H N N 320 SER HB2 H N N 321 SER HB3 H N N 322 SER HG H N N 323 SER HXT H N N 324 THR N N N N 325 THR CA C N S 326 THR C C N N 327 THR O O N N 328 THR CB C N R 329 THR OG1 O N N 330 THR CG2 C N N 331 THR OXT O N N 332 THR H H N N 333 THR H2 H N N 334 THR HA H N N 335 THR HB H N N 336 THR HG1 H N N 337 THR HG21 H N N 338 THR HG22 H N N 339 THR HG23 H N N 340 THR HXT H N N 341 TRP N N N N 342 TRP CA C N S 343 TRP C C N N 344 TRP O O N N 345 TRP CB C N N 346 TRP CG C Y N 347 TRP CD1 C Y N 348 TRP CD2 C Y N 349 TRP NE1 N Y N 350 TRP CE2 C Y N 351 TRP CE3 C Y N 352 TRP CZ2 C Y N 353 TRP CZ3 C Y N 354 TRP CH2 C Y N 355 TRP OXT O N N 356 TRP H H N N 357 TRP H2 H N N 358 TRP HA H N N 359 TRP HB2 H N N 360 TRP HB3 H N N 361 TRP HD1 H N N 362 TRP HE1 H N N 363 TRP HE3 H N N 364 TRP HZ2 H N N 365 TRP HZ3 H N N 366 TRP HH2 H N N 367 TRP HXT H N N 368 TYR N N N N 369 TYR CA C N S 370 TYR C C N N 371 TYR O O N N 372 TYR CB C N N 373 TYR CG C Y N 374 TYR CD1 C Y N 375 TYR CD2 C Y N 376 TYR CE1 C Y N 377 TYR CE2 C Y N 378 TYR CZ C Y N 379 TYR OH O N N 380 TYR OXT O N N 381 TYR H H N N 382 TYR H2 H N N 383 TYR HA H N N 384 TYR HB2 H N N 385 TYR HB3 H N N 386 TYR HD1 H N N 387 TYR HD2 H N N 388 TYR HE1 H N N 389 TYR HE2 H N N 390 TYR HH H N N 391 TYR HXT H N N 392 VAL N N N N 393 VAL CA C N S 394 VAL C C N N 395 VAL O O N N 396 VAL CB C N N 397 VAL CG1 C N N 398 VAL CG2 C N N 399 VAL OXT O N N 400 VAL H H N N 401 VAL H2 H N N 402 VAL HA H N N 403 VAL HB H N N 404 VAL HG11 H N N 405 VAL HG12 H N N 406 VAL HG13 H N N 407 VAL HG21 H N N 408 VAL HG22 H N N 409 VAL HG23 H N N 410 VAL HXT H N N 411 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1AHL C20 C19 sing N N 1 A1AHL C19 O1 doub N N 2 A1AHL C19 N2 sing N N 3 A1AHL C22 N2 sing N N 4 A1AHL N2 C17 sing N N 5 A1AHL C17 C16 sing N N 6 A1AHL C16 C15 sing N N 7 A1AHL C15 N1 sing N N 8 A1AHL C4 C3 doub Y N 9 A1AHL C4 C5 sing Y N 10 A1AHL C3 C2 sing Y N 11 A1AHL N1 C5 sing N N 12 A1AHL N1 C9 sing N N 13 A1AHL C5 C6 doub Y N 14 A1AHL C14 C9 doub Y N 15 A1AHL C14 C13 sing Y N 16 A1AHL C9 C8 sing Y N 17 A1AHL C2 C1 doub Y N 18 A1AHL C13 C12 doub Y N 19 A1AHL C6 C1 sing Y N 20 A1AHL C6 S1 sing N N 21 A1AHL C8 S1 sing N N 22 A1AHL C8 C11 doub Y N 23 A1AHL C12 C11 sing Y N 24 A1AHL C11 H1 sing N N 25 A1AHL C12 H2 sing N N 26 A1AHL C13 H3 sing N N 27 A1AHL C16 H4 sing N N 28 A1AHL C16 H5 sing N N 29 A1AHL C1 H6 sing N N 30 A1AHL C14 H7 sing N N 31 A1AHL C15 H8 sing N N 32 A1AHL C15 H9 sing N N 33 A1AHL C17 H10 sing N N 34 A1AHL C17 H11 sing N N 35 A1AHL C2 H12 sing N N 36 A1AHL C20 H13 sing N N 37 A1AHL C20 H14 sing N N 38 A1AHL C22 H16 sing N N 39 A1AHL C22 H17 sing N N 40 A1AHL C22 H18 sing N N 41 A1AHL C3 H19 sing N N 42 A1AHL C4 H20 sing N N 43 A1AHL C20 CL1 sing N N 44 ALA N CA sing N N 45 ALA N H sing N N 46 ALA N H2 sing N N 47 ALA CA C sing N N 48 ALA CA CB sing N N 49 ALA CA HA sing N N 50 ALA C O doub N N 51 ALA C OXT sing N N 52 ALA CB HB1 sing N N 53 ALA CB HB2 sing N N 54 ALA CB HB3 sing N N 55 ALA OXT HXT sing N N 56 ARG N CA sing N N 57 ARG N H sing N N 58 ARG N H2 sing N N 59 ARG CA C sing N N 60 ARG CA CB sing N N 61 ARG CA HA sing N N 62 ARG C O doub N N 63 ARG C OXT sing N N 64 ARG CB CG sing N N 65 ARG CB HB2 sing N N 66 ARG CB HB3 sing N N 67 ARG CG CD sing N N 68 ARG CG HG2 sing N N 69 ARG CG HG3 sing N N 70 ARG CD NE sing N N 71 ARG CD HD2 sing N N 72 ARG CD HD3 sing N N 73 ARG NE CZ sing N N 74 ARG NE HE sing N N 75 ARG CZ NH1 sing N N 76 ARG CZ NH2 doub N N 77 ARG NH1 HH11 sing N N 78 ARG NH1 HH12 sing N N 79 ARG NH2 HH21 sing N N 80 ARG NH2 HH22 sing N N 81 ARG OXT HXT sing N N 82 ASN N CA sing N N 83 ASN N H sing N N 84 ASN N H2 sing N N 85 ASN CA C sing N N 86 ASN CA CB sing N N 87 ASN CA HA sing N N 88 ASN C O doub N N 89 ASN C OXT sing N N 90 ASN CB CG sing N N 91 ASN CB HB2 sing N N 92 ASN CB HB3 sing N N 93 ASN CG OD1 doub N N 94 ASN CG ND2 sing N N 95 ASN ND2 HD21 sing N N 96 ASN ND2 HD22 sing N N 97 ASN OXT HXT sing N N 98 ASP N CA sing N N 99 ASP N H sing N N 100 ASP N H2 sing N N 101 ASP CA C sing N N 102 ASP CA CB sing N N 103 ASP CA HA sing N N 104 ASP C O doub N N 105 ASP C OXT sing N N 106 ASP CB CG sing N N 107 ASP CB HB2 sing N N 108 ASP CB HB3 sing N N 109 ASP CG OD1 doub N N 110 ASP CG OD2 sing N N 111 ASP OD2 HD2 sing N N 112 ASP OXT HXT sing N N 113 CYS N CA sing N N 114 CYS N H sing N N 115 CYS N H2 sing N N 116 CYS CA C sing N N 117 CYS CA CB sing N N 118 CYS CA HA sing N N 119 CYS C O doub N N 120 CYS C OXT sing N N 121 CYS CB SG sing N N 122 CYS CB HB2 sing N N 123 CYS CB HB3 sing N N 124 CYS SG HG sing N N 125 CYS OXT HXT sing N N 126 GLN N CA sing N N 127 GLN N H sing N N 128 GLN N H2 sing N N 129 GLN CA C sing N N 130 GLN CA CB sing N N 131 GLN CA HA sing N N 132 GLN C O doub N N 133 GLN C OXT sing N N 134 GLN CB CG sing N N 135 GLN CB HB2 sing N N 136 GLN CB HB3 sing N N 137 GLN CG CD sing N N 138 GLN CG HG2 sing N N 139 GLN CG HG3 sing N N 140 GLN CD OE1 doub N N 141 GLN CD NE2 sing N N 142 GLN NE2 HE21 sing N N 143 GLN NE2 HE22 sing N N 144 GLN OXT HXT sing N N 145 GLU N CA sing N N 146 GLU N H sing N N 147 GLU N H2 sing N N 148 GLU CA C sing N N 149 GLU CA CB sing N N 150 GLU CA HA sing N N 151 GLU C O doub N N 152 GLU C OXT sing N N 153 GLU CB CG sing N N 154 GLU CB HB2 sing N N 155 GLU CB HB3 sing N N 156 GLU CG CD sing N N 157 GLU CG HG2 sing N N 158 GLU CG HG3 sing N N 159 GLU CD OE1 doub N N 160 GLU CD OE2 sing N N 161 GLU OE2 HE2 sing N N 162 GLU OXT HXT sing N N 163 GLY N CA sing N N 164 GLY N H sing N N 165 GLY N H2 sing N N 166 GLY CA C sing N N 167 GLY CA HA2 sing N N 168 GLY CA HA3 sing N N 169 GLY C O doub N N 170 GLY C OXT sing N N 171 GLY OXT HXT sing N N 172 HOH O H1 sing N N 173 HOH O H2 sing N N 174 ILE N CA sing N N 175 ILE N H sing N N 176 ILE N H2 sing N N 177 ILE CA C sing N N 178 ILE CA CB sing N N 179 ILE CA HA sing N N 180 ILE C O doub N N 181 ILE C OXT sing N N 182 ILE CB CG1 sing N N 183 ILE CB CG2 sing N N 184 ILE CB HB sing N N 185 ILE CG1 CD1 sing N N 186 ILE CG1 HG12 sing N N 187 ILE CG1 HG13 sing N N 188 ILE CG2 HG21 sing N N 189 ILE CG2 HG22 sing N N 190 ILE CG2 HG23 sing N N 191 ILE CD1 HD11 sing N N 192 ILE CD1 HD12 sing N N 193 ILE CD1 HD13 sing N N 194 ILE OXT HXT sing N N 195 LEU N CA sing N N 196 LEU N H sing N N 197 LEU N H2 sing N N 198 LEU CA C sing N N 199 LEU CA CB sing N N 200 LEU CA HA sing N N 201 LEU C O doub N N 202 LEU C OXT sing N N 203 LEU CB CG sing N N 204 LEU CB HB2 sing N N 205 LEU CB HB3 sing N N 206 LEU CG CD1 sing N N 207 LEU CG CD2 sing N N 208 LEU CG HG sing N N 209 LEU CD1 HD11 sing N N 210 LEU CD1 HD12 sing N N 211 LEU CD1 HD13 sing N N 212 LEU CD2 HD21 sing N N 213 LEU CD2 HD22 sing N N 214 LEU CD2 HD23 sing N N 215 LEU OXT HXT sing N N 216 LYS N CA sing N N 217 LYS N H sing N N 218 LYS N H2 sing N N 219 LYS CA C sing N N 220 LYS CA CB sing N N 221 LYS CA HA sing N N 222 LYS C O doub N N 223 LYS C OXT sing N N 224 LYS CB CG sing N N 225 LYS CB HB2 sing N N 226 LYS CB HB3 sing N N 227 LYS CG CD sing N N 228 LYS CG HG2 sing N N 229 LYS CG HG3 sing N N 230 LYS CD CE sing N N 231 LYS CD HD2 sing N N 232 LYS CD HD3 sing N N 233 LYS CE NZ sing N N 234 LYS CE HE2 sing N N 235 LYS CE HE3 sing N N 236 LYS NZ HZ1 sing N N 237 LYS NZ HZ2 sing N N 238 LYS NZ HZ3 sing N N 239 LYS OXT HXT sing N N 240 MET N CA sing N N 241 MET N H sing N N 242 MET N H2 sing N N 243 MET CA C sing N N 244 MET CA CB sing N N 245 MET CA HA sing N N 246 MET C O doub N N 247 MET C OXT sing N N 248 MET CB CG sing N N 249 MET CB HB2 sing N N 250 MET CB HB3 sing N N 251 MET CG SD sing N N 252 MET CG HG2 sing N N 253 MET CG HG3 sing N N 254 MET SD CE sing N N 255 MET CE HE1 sing N N 256 MET CE HE2 sing N N 257 MET CE HE3 sing N N 258 MET OXT HXT sing N N 259 PHE N CA sing N N 260 PHE N H sing N N 261 PHE N H2 sing N N 262 PHE CA C sing N N 263 PHE CA CB sing N N 264 PHE CA HA sing N N 265 PHE C O doub N N 266 PHE C OXT sing N N 267 PHE CB CG sing N N 268 PHE CB HB2 sing N N 269 PHE CB HB3 sing N N 270 PHE CG CD1 doub Y N 271 PHE CG CD2 sing Y N 272 PHE CD1 CE1 sing Y N 273 PHE CD1 HD1 sing N N 274 PHE CD2 CE2 doub Y N 275 PHE CD2 HD2 sing N N 276 PHE CE1 CZ doub Y N 277 PHE CE1 HE1 sing N N 278 PHE CE2 CZ sing Y N 279 PHE CE2 HE2 sing N N 280 PHE CZ HZ sing N N 281 PHE OXT HXT sing N N 282 PRO N CA sing N N 283 PRO N CD sing N N 284 PRO N H sing N N 285 PRO CA C sing N N 286 PRO CA CB sing N N 287 PRO CA HA sing N N 288 PRO C O doub N N 289 PRO C OXT sing N N 290 PRO CB CG sing N N 291 PRO CB HB2 sing N N 292 PRO CB HB3 sing N N 293 PRO CG CD sing N N 294 PRO CG HG2 sing N N 295 PRO CG HG3 sing N N 296 PRO CD HD2 sing N N 297 PRO CD HD3 sing N N 298 PRO OXT HXT sing N N 299 SER N CA sing N N 300 SER N H sing N N 301 SER N H2 sing N N 302 SER CA C sing N N 303 SER CA CB sing N N 304 SER CA HA sing N N 305 SER C O doub N N 306 SER C OXT sing N N 307 SER CB OG sing N N 308 SER CB HB2 sing N N 309 SER CB HB3 sing N N 310 SER OG HG sing N N 311 SER OXT HXT sing N N 312 THR N CA sing N N 313 THR N H sing N N 314 THR N H2 sing N N 315 THR CA C sing N N 316 THR CA CB sing N N 317 THR CA HA sing N N 318 THR C O doub N N 319 THR C OXT sing N N 320 THR CB OG1 sing N N 321 THR CB CG2 sing N N 322 THR CB HB sing N N 323 THR OG1 HG1 sing N N 324 THR CG2 HG21 sing N N 325 THR CG2 HG22 sing N N 326 THR CG2 HG23 sing N N 327 THR OXT HXT sing N N 328 TRP N CA sing N N 329 TRP N H sing N N 330 TRP N H2 sing N N 331 TRP CA C sing N N 332 TRP CA CB sing N N 333 TRP CA HA sing N N 334 TRP C O doub N N 335 TRP C OXT sing N N 336 TRP CB CG sing N N 337 TRP CB HB2 sing N N 338 TRP CB HB3 sing N N 339 TRP CG CD1 doub Y N 340 TRP CG CD2 sing Y N 341 TRP CD1 NE1 sing Y N 342 TRP CD1 HD1 sing N N 343 TRP CD2 CE2 doub Y N 344 TRP CD2 CE3 sing Y N 345 TRP NE1 CE2 sing Y N 346 TRP NE1 HE1 sing N N 347 TRP CE2 CZ2 sing Y N 348 TRP CE3 CZ3 doub Y N 349 TRP CE3 HE3 sing N N 350 TRP CZ2 CH2 doub Y N 351 TRP CZ2 HZ2 sing N N 352 TRP CZ3 CH2 sing Y N 353 TRP CZ3 HZ3 sing N N 354 TRP CH2 HH2 sing N N 355 TRP OXT HXT sing N N 356 TYR N CA sing N N 357 TYR N H sing N N 358 TYR N H2 sing N N 359 TYR CA C sing N N 360 TYR CA CB sing N N 361 TYR CA HA sing N N 362 TYR C O doub N N 363 TYR C OXT sing N N 364 TYR CB CG sing N N 365 TYR CB HB2 sing N N 366 TYR CB HB3 sing N N 367 TYR CG CD1 doub Y N 368 TYR CG CD2 sing Y N 369 TYR CD1 CE1 sing Y N 370 TYR CD1 HD1 sing N N 371 TYR CD2 CE2 doub Y N 372 TYR CD2 HD2 sing N N 373 TYR CE1 CZ doub Y N 374 TYR CE1 HE1 sing N N 375 TYR CE2 CZ sing Y N 376 TYR CE2 HE2 sing N N 377 TYR CZ OH sing N N 378 TYR OH HH sing N N 379 TYR OXT HXT sing N N 380 VAL N CA sing N N 381 VAL N H sing N N 382 VAL N H2 sing N N 383 VAL CA C sing N N 384 VAL CA CB sing N N 385 VAL CA HA sing N N 386 VAL C O doub N N 387 VAL C OXT sing N N 388 VAL CB CG1 sing N N 389 VAL CB CG2 sing N N 390 VAL CB HB sing N N 391 VAL CG1 HG11 sing N N 392 VAL CG1 HG12 sing N N 393 VAL CG1 HG13 sing N N 394 VAL CG2 HG21 sing N N 395 VAL CG2 HG22 sing N N 396 VAL CG2 HG23 sing N N 397 VAL OXT HXT sing N N 398 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Department of Energy (DOE, United States)' 'United States' DE-AC02-76SF00515 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' P30GM133894 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'Wild type structure' # _atom_sites.entry_id 9AYE _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.023164 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019309 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016669 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ # loop_ #