data_9BBJ # _entry.id 9BBJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.409 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9BBJ pdb_00009bbj 10.2210/pdb9bbj/pdb WWPDB D_1000282997 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-12-10 ? 2 'Structure model' 1 1 2025-12-24 ? 3 'Structure model' 1 2 2025-12-31 ? 4 'Structure model' 1 3 2026-01-07 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation_author 3 4 'Structure model' citation 4 4 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 3 'Structure model' '_citation_author.identifier_ORCID' 4 4 'Structure model' '_citation.journal_volume' 5 4 'Structure model' '_citation.page_first' 6 4 'Structure model' '_citation.page_last' 7 4 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9BBJ _pdbx_database_status.recvd_initial_deposition_date 2024-04-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB '6cn8 contains the first ClpC1-NTD-Rufomycin complex' 6cn8 unspecified PDB '6pbs contains the structure of ClpC1-NTD with another cyclo-peptide of interest' 6pbs unspecified # _pdbx_contact_author.id 3 _pdbx_contact_author.email Nader.Fotouhi@tballiance.org _pdbx_contact_author.name_first Nader _pdbx_contact_author.name_last Foutoui _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0009-0001-9314-1704 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Abad-Zapatero, C.' 1 0000-0003-0741-9579 'Ratia, K.' 2 0000-0002-4834-9207 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_patent _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary J.Med.Chem. JMCMAR 0151 0022-2623 ? ? 68 ? 26298 26310 ;Unique Interactions of Novel Rufomycin "Click Chemistry" Analogs with Mtb ClpC1 and Implications. ; 2025 ? 10.1021/acs.jmedchem.5c02416 41384615 ? ? ? ? ? ? ? ? ? US ? ? 1 'ACS Infect Dis' ? ? 2373-8227 ? ? 5 ? 829 840 ;High-Resolution Structure of ClpC1-Rufomycin and Ligand Binding Studies Provide a Framework to Design and Optimize Anti-Tuberculosis Leads. ; 2019 ? 10.1021/acsinfecdis.8b00276 30990022 ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ratia, K.' 1 ? primary 'Jin, S.' 2 ? primary 'Abad-Zapatero, C.' 3 ? primary 'Shetye, G.S.' 4 ? primary 'Demissie, R.' 5 ? primary 'Qader, M.' 6 ? primary 'Beautrait, A.' 7 ? primary 'Nikolic, D.S.' 8 ? primary 'Wolf, N.M.' 9 ? primary 'Rubin, E.J.' 10 ? primary 'Krandor, O.' 11 ? primary 'Serbina, N.' 12 ? primary 'Li, G.' 13 ? primary 'Pauli, G.F.' 14 ? primary 'Klein, L.L.' 15 ? primary 'Cho, S.' 16 ? primary 'Franzblau, S.G.' 17 ? primary 'Fotouhi, N.' 18 ? primary 'Kaneko, T.' 19 ? primary 'Lee, H.' 20 ? 1 'Wolf, N.' 21 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ATP-dependent Clp protease ATP-binding subunit ClpC1' 17529.131 1 ? ? 'N-terminal domain' ? 2 polymer syn 'Click chemistry analog of Rufomycin' 964.204 1 ? ? ? ;The click chemistry analog of Rufomycin is a covalently bonded cyclic dimer from two asymmetric units, through CE2 atom of A1AMB (triazole-containing) residue in one ASU, to CE atom of NLE residue in the other ASU which is not modeled. The last CE atom of NLE was not modeled because -without being covalently bounded- would result in interatomic 'clashes' upon refinement. The final 2Fo-Fc and Fo-Fc calculated with the final refined coordinates show clear evidence for the additional atom (Fo-Fc, positive peak) and also continuous density in the 2Fo-Fc map connecting the two parts of the dimer. The model presented in the asymmetric unit is half of the molecule with a missing carbon atom. The full SMILES string of the molecule is O=C(N(C)[C@H](C(N[C@H](C(N[C@@H](CCCCC1=CN(C[C@H](NC([C@H](CC(C)C)N2C([C@@H]3CCC2)=O)=O)C(N[C@H](C(N(C)[C@H](C(N[C@H](C(N[C@@H](CCCCC4=CN(C5)N=N4)C(N3C)=O)=O)C)=O)CC(C)C)=O)CC6=CN(C(C)(C)C=C)C7=C6C=CC=C7)=O)N=N1)C(N8C)=O)=O)C)=O)CC(C)C)[C@@H](NC([C@H]5NC([C@H](CC(C)C)N9C([C@@H]8CCC9)=O)=O)=O)CC%10=CN(C(C)(C)C=C)C%11=C%10C=CC=C%11 ; # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLESLGISLEGVRSQVEEIIGQGQQAPSGHIPF TPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVAAQVLVKLGAELTRVRQQVIQLLSGYKLAAALEHHHHHH ; ;MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLESLGISLEGVRSQVEEIIGQGQQAPSGHIPF TPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVAAQVLVKLGAELTRVRQQVIQLLSGYKLAAALEHHHHHH ; A ? 2 'polypeptide(L)' no yes '(A1AL8)(MLE)A(NLE)(A1AMC)L(A1AMB)' XLALXLX B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PHE n 1 3 GLU n 1 4 ARG n 1 5 PHE n 1 6 THR n 1 7 ASP n 1 8 ARG n 1 9 ALA n 1 10 ARG n 1 11 ARG n 1 12 VAL n 1 13 VAL n 1 14 VAL n 1 15 LEU n 1 16 ALA n 1 17 GLN n 1 18 GLU n 1 19 GLU n 1 20 ALA n 1 21 ARG n 1 22 MET n 1 23 LEU n 1 24 ASN n 1 25 HIS n 1 26 ASN n 1 27 TYR n 1 28 ILE n 1 29 GLY n 1 30 THR n 1 31 GLU n 1 32 HIS n 1 33 ILE n 1 34 LEU n 1 35 LEU n 1 36 GLY n 1 37 LEU n 1 38 ILE n 1 39 HIS n 1 40 GLU n 1 41 GLY n 1 42 GLU n 1 43 GLY n 1 44 VAL n 1 45 ALA n 1 46 ALA n 1 47 LYS n 1 48 SER n 1 49 LEU n 1 50 GLU n 1 51 SER n 1 52 LEU n 1 53 GLY n 1 54 ILE n 1 55 SER n 1 56 LEU n 1 57 GLU n 1 58 GLY n 1 59 VAL n 1 60 ARG n 1 61 SER n 1 62 GLN n 1 63 VAL n 1 64 GLU n 1 65 GLU n 1 66 ILE n 1 67 ILE n 1 68 GLY n 1 69 GLN n 1 70 GLY n 1 71 GLN n 1 72 GLN n 1 73 ALA n 1 74 PRO n 1 75 SER n 1 76 GLY n 1 77 HIS n 1 78 ILE n 1 79 PRO n 1 80 PHE n 1 81 THR n 1 82 PRO n 1 83 ARG n 1 84 ALA n 1 85 LYS n 1 86 LYS n 1 87 VAL n 1 88 LEU n 1 89 GLU n 1 90 LEU n 1 91 SER n 1 92 LEU n 1 93 ARG n 1 94 GLU n 1 95 ALA n 1 96 LEU n 1 97 GLN n 1 98 LEU n 1 99 GLY n 1 100 HIS n 1 101 ASN n 1 102 TYR n 1 103 ILE n 1 104 GLY n 1 105 THR n 1 106 GLU n 1 107 HIS n 1 108 ILE n 1 109 LEU n 1 110 LEU n 1 111 GLY n 1 112 LEU n 1 113 ILE n 1 114 ARG n 1 115 GLU n 1 116 GLY n 1 117 GLU n 1 118 GLY n 1 119 VAL n 1 120 ALA n 1 121 ALA n 1 122 GLN n 1 123 VAL n 1 124 LEU n 1 125 VAL n 1 126 LYS n 1 127 LEU n 1 128 GLY n 1 129 ALA n 1 130 GLU n 1 131 LEU n 1 132 THR n 1 133 ARG n 1 134 VAL n 1 135 ARG n 1 136 GLN n 1 137 GLN n 1 138 VAL n 1 139 ILE n 1 140 GLN n 1 141 LEU n 1 142 LEU n 1 143 SER n 1 144 GLY n 1 145 TYR n 1 146 LYS n 1 147 LEU n 1 148 ALA n 1 149 ALA n 1 150 ALA n 1 151 LEU n 1 152 GLU n 1 153 HIS n 1 154 HIS n 1 155 HIS n 1 156 HIS n 1 157 HIS n 1 158 HIS n 2 1 A1AL8 n 2 2 MLE n 2 3 ALA n 2 4 NLE n 2 5 A1AMC n 2 6 LEU n 2 7 A1AMB n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 158 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'clpC1, Rv3596c, MTCY07H7B.26' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1773 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 7 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1AL8 'L-peptide linking' n '1-(2-methylbut-3-en-2-yl)-L-tryptophan' ? 'C16 H20 N2 O2' 272.342 A1AMB 'L-peptide linking' n '3-(1H-1,2,3-triazol-1-yl)-L-alanine' ? 'C5 H8 N4 O2' 156.143 A1AMC 'L-peptide linking' n '(2S)-2-(methylamino)pentane-1,1,5-triol' ? 'C6 H13 N O3' 147.172 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MLE 'L-peptide linking' n N-METHYLLEUCINE ? 'C7 H15 N O2' 145.199 NLE 'L-peptide linking' n NORLEUCINE ? 'C6 H13 N O2' 131.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 HIS 100 100 100 HIS HIS A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 TYR 102 102 102 TYR TYR A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 HIS 107 107 107 HIS HIS A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 ARG 114 114 114 ARG ARG A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 ARG 135 135 135 ARG ARG A . n A 1 136 GLN 136 136 136 GLN GLN A . n A 1 137 GLN 137 137 137 GLN GLN A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 GLN 140 140 140 GLN GLN A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 TYR 145 145 145 TYR TYR A . n A 1 146 LYS 146 146 ? ? ? A . n A 1 147 LEU 147 147 ? ? ? A . n A 1 148 ALA 148 148 ? ? ? A . n A 1 149 ALA 149 149 ? ? ? A . n A 1 150 ALA 150 150 ? ? ? A . n A 1 151 LEU 151 151 ? ? ? A . n A 1 152 GLU 152 152 ? ? ? A . n A 1 153 HIS 153 153 ? ? ? A . n A 1 154 HIS 154 154 ? ? ? A . n A 1 155 HIS 155 155 ? ? ? A . n A 1 156 HIS 156 156 ? ? ? A . n A 1 157 HIS 157 157 ? ? ? A . n A 1 158 HIS 158 158 ? ? ? A . n B 2 1 A1AL8 1 1 201 A1AL8 TBA B . n B 2 2 MLE 2 2 201 MLE TBA B . n B 2 3 ALA 3 3 201 ALA TBA B . n B 2 4 NLE 4 4 201 NLE TBA B . n B 2 5 A1AMC 5 5 201 A1AMC TBA B . n B 2 6 LEU 6 6 201 LEU TBA B . n B 2 7 A1AMB 7 7 201 A1AMB TBA B . n # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag Y _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 1 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id B _pdbx_unobs_or_zero_occ_atoms.auth_comp_id NLE _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 4 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id CE _pdbx_unobs_or_zero_occ_atoms.label_alt_id ? _pdbx_unobs_or_zero_occ_atoms.label_asym_id B _pdbx_unobs_or_zero_occ_atoms.label_comp_id NLE _pdbx_unobs_or_zero_occ_atoms.label_seq_id 4 _pdbx_unobs_or_zero_occ_atoms.label_atom_id CE # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18.2_3874 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18.2_3874 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9BBJ _cell.details ? _cell.formula_units_Z ? _cell.length_a 57.970 _cell.length_a_esd ? _cell.length_b 57.970 _cell.length_b_esd ? _cell.length_c 131.970 _cell.length_c_esd ? _cell.volume 443486.413 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9BBJ _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall 'P 4nw 2abw' _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9BBJ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.16 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 61.11 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;22% PEG 3K 0.2M calcium acetate 0.1M Bis-Tris pH 6.5 ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-10-15 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator Diamond _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.12723 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.12723 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-D _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 71.66 _reflns.entry_id 9BBJ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.56 _reflns.d_resolution_low 57.97 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13920 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.0 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.96 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.078 _reflns.pdbx_Rpim_I_all 0.023 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.075 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.56 _reflns_shell.d_res_low 2.67 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all 11912 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 929 _reflns_shell.percent_possible_obs 100.0 _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 12.8 _reflns_shell.pdbx_chi_squared 0.88 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 3.6 _reflns_shell.pdbx_Rrim_I_all 0.698 _reflns_shell.pdbx_Rpim_I_all 0.194 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.960 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.670 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 108.46 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9BBJ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.56 _refine.ls_d_res_low 39.15 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13919 _refine.ls_number_reflns_R_free 698 _refine.ls_number_reflns_R_work 13221 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.86 _refine.ls_percent_reflns_R_free 5.01 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2610 _refine.ls_R_factor_R_free 0.2942 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2590 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.71 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 38.2746 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2464 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.56 _refine_hist.d_res_low 39.15 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1191 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1125 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 66 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0096 ? 1209 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.5173 ? 1635 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0841 ? 186 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0069 ? 208 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 31.6752 ? 168 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.56 2.75 . . 135 2666 99.75 . . . . 0.3557 . . . . . . . . . . . 0.3546 'X-RAY DIFFRACTION' 2.75 3.03 . . 115 2670 99.86 . . . . 0.3179 . . . . . . . . . . . 0.3784 'X-RAY DIFFRACTION' 3.03 3.47 . . 181 2576 99.86 . . . . 0.3395 . . . . . . . . . . . 0.4050 'X-RAY DIFFRACTION' 3.47 4.37 . . 134 2657 100.00 . . . . 0.2716 . . . . . . . . . . . 0.3070 'X-RAY DIFFRACTION' 4.37 39.15 . . 133 2652 99.86 . . . . 0.2096 . . . . . . . . . . . 0.2296 # _struct.entry_id 9BBJ _struct.title 'M. tuberculosis ClpC1-NTD complexed with a click chemistry analog of Rufomycin' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9BBJ _struct_keywords.text 'M. tuberculosis, ClpC1, Rufomycin, Click-Chemistry, ANTIBIOTIC' _struct_keywords.pdbx_keywords ANTIBIOTIC # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP CLPC1_MYCTU P9WPC9 ? 1 ;MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLESLGISLEGVRSQVEEIIGQGQQAPSGHIPF TPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVAAQVLVKLGAELTRVRQQVIQLLSGY ; 1 2 PDB 9BBJ 9BBJ ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9BBJ A 1 ? 145 ? P9WPC9 1 ? 145 ? 1 145 2 2 9BBJ B 1 ? 7 ? 9BBJ 1 ? 7 ? 1 7 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9BBJ LYS A 146 ? UNP P9WPC9 ? ? 'expression tag' 146 1 1 9BBJ LEU A 147 ? UNP P9WPC9 ? ? 'expression tag' 147 2 1 9BBJ ALA A 148 ? UNP P9WPC9 ? ? 'expression tag' 148 3 1 9BBJ ALA A 149 ? UNP P9WPC9 ? ? 'expression tag' 149 4 1 9BBJ ALA A 150 ? UNP P9WPC9 ? ? 'expression tag' 150 5 1 9BBJ LEU A 151 ? UNP P9WPC9 ? ? 'expression tag' 151 6 1 9BBJ GLU A 152 ? UNP P9WPC9 ? ? 'expression tag' 152 7 1 9BBJ HIS A 153 ? UNP P9WPC9 ? ? 'expression tag' 153 8 1 9BBJ HIS A 154 ? UNP P9WPC9 ? ? 'expression tag' 154 9 1 9BBJ HIS A 155 ? UNP P9WPC9 ? ? 'expression tag' 155 10 1 9BBJ HIS A 156 ? UNP P9WPC9 ? ? 'expression tag' 156 11 1 9BBJ HIS A 157 ? UNP P9WPC9 ? ? 'expression tag' 157 12 1 9BBJ HIS A 158 ? UNP P9WPC9 ? ? 'expression tag' 158 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # _struct_biol.details ;The biological assembly contains two ClpC1-NTD and a click chemistry analog of Rufomycin, which is a covalently bonded cyclic dimer from two asymmetric units, through CE2 atom of A1AMB (triazole-containing) residue in one ASU, to CE atom of NLE residue in the other ASU which is not modeled. The last CE atom of NLE was not modeled because -without being covalently bounded- would result in interatomic 'clashes' upon refinement. The final 2Fo-Fc and Fo-Fc calculated with the final refined coordinates show clear evidence for the additional atom (Fo-Fc, positive peak) and also continuous density in the 2Fo-Fc map connecting the two parts of the dimer. ; _struct_biol.id 1 _struct_biol.pdbx_aggregation_state ? _struct_biol.pdbx_assembly_method ? _struct_biol.pdbx_formula_weight ? _struct_biol.pdbx_formula_weight_method ? _struct_biol.pdbx_parent_biol_id ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MET A 1 ? PHE A 5 ? MET A 1 PHE A 5 5 ? 5 HELX_P HELX_P2 AA2 THR A 6 ? LEU A 23 ? THR A 6 LEU A 23 1 ? 18 HELX_P HELX_P3 AA3 GLY A 29 ? GLY A 41 ? GLY A 29 GLY A 41 1 ? 13 HELX_P HELX_P4 AA4 GLY A 43 ? LEU A 52 ? GLY A 43 LEU A 52 1 ? 10 HELX_P HELX_P5 AA5 SER A 55 ? ILE A 67 ? SER A 55 ILE A 67 1 ? 13 HELX_P HELX_P6 AA6 THR A 81 ? LEU A 98 ? THR A 81 LEU A 98 1 ? 18 HELX_P HELX_P7 AA7 GLY A 104 ? GLY A 116 ? GLY A 104 GLY A 116 1 ? 13 HELX_P HELX_P8 AA8 GLY A 118 ? GLY A 128 ? GLY A 118 GLY A 128 1 ? 11 HELX_P HELX_P9 AA9 GLU A 130 ? SER A 143 ? GLU A 130 SER A 143 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B A1AL8 1 C ? ? ? 1_555 B MLE 2 N ? ? B A1AL8 1 B MLE 2 1_555 ? ? ? ? ? ? ? 1.518 ? ? covale2 covale one ? B A1AL8 1 N ? ? ? 1_555 B A1AMB 7 C ? ? B A1AL8 1 B A1AMB 7 1_555 ? ? ? ? ? ? ? 1.454 ? ? covale3 covale both ? B MLE 2 C ? ? ? 1_555 B ALA 3 N ? ? B MLE 2 B ALA 3 1_555 ? ? ? ? ? ? ? 1.493 ? ? covale4 covale both ? B ALA 3 C ? ? ? 1_555 B NLE 4 N ? ? B ALA 3 B NLE 4 1_555 ? ? ? ? ? ? ? 1.497 ? ? covale5 covale one ? B NLE 4 C ? ? ? 1_555 B A1AMC 5 N ? ? B NLE 4 B A1AMC 5 1_555 ? ? ? ? ? ? ? 1.501 ? ? covale6 covale both ? B A1AMC 5 C ? ? ? 1_555 B LEU 6 N ? ? B A1AMC 5 B LEU 6 1_555 ? ? ? ? ? ? ? 1.447 ? ? covale7 covale both ? B A1AMC 5 CD ? ? ? 1_555 B LEU 6 N ? ? B A1AMC 5 B LEU 6 1_555 ? ? ? ? ? ? ? 1.408 ? ? covale8 covale one ? B LEU 6 C ? ? ? 1_555 B A1AMB 7 N ? ? B LEU 6 B A1AMB 7 1_555 ? ? ? ? ? ? ? 1.496 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MLE B 2 ? . . . . MLE B 2 ? 1_555 . . . . . . . LEU 1 MLE Methylation 'Named protein modification' 2 NLE B 4 ? . . . . NLE B 4 ? 1_555 . . . . . . . LEU 1 NLE Norleucine 'Named protein modification' 3 A1AL8 B 1 ? . . . . A1AL8 B 1 ? 1_555 . . . . . . . TRP 1 A1AL8 None 'Non-standard residue' 4 A1AMC B 5 ? . . . . A1AMC B 5 ? 1_555 . . . . . . . ? 1 A1AMC None 'Non-standard residue' 5 A1AMB B 7 ? . . . . A1AMB B 7 ? 1_555 . . . . . . . ? 1 A1AMB None 'Non-standard residue' 6 A1AL8 B 1 ? A1AMB B 7 ? A1AL8 B 1 ? 1_555 A1AMB B 7 ? 1_555 N C . . . None 'Non-standard linkage' 7 A1AMC B 5 ? LEU B 6 ? A1AMC B 5 ? 1_555 LEU B 6 ? 1_555 CD N . . . None 'Non-standard linkage' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id A1AL8 _struct_mon_prot_cis.label_seq_id 1 _struct_mon_prot_cis.label_asym_id B _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id A1AL8 _struct_mon_prot_cis.auth_seq_id 1 _struct_mon_prot_cis.auth_asym_id B _struct_mon_prot_cis.pdbx_label_comp_id_2 MLE _struct_mon_prot_cis.pdbx_label_seq_id_2 2 _struct_mon_prot_cis.pdbx_label_asym_id_2 B _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 MLE _struct_mon_prot_cis.pdbx_auth_seq_id_2 2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 B _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.67 # _pdbx_entry_details.entry_id 9BBJ _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 NH2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ARG _pdbx_validate_close_contact.auth_seq_id_1 21 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 GLY _pdbx_validate_close_contact.auth_seq_id_2 76 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.10 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 C B A1AL8 1 ? ? N B MLE 2 ? ? 1.518 1.336 0.182 0.023 Y 2 1 C B MLE 2 ? ? N B ALA 3 ? ? 1.493 1.336 0.157 0.023 Y 3 1 C B ALA 3 ? ? N B NLE 4 ? ? 1.497 1.336 0.161 0.023 Y 4 1 C B NLE 4 ? ? N B A1AMC 5 ? ? 1.501 1.336 0.165 0.023 Y 5 1 N B LEU 6 ? ? CA B LEU 6 ? ? 1.270 1.459 -0.189 0.020 N 6 1 C B LEU 6 ? ? N B A1AMB 7 ? ? 1.496 1.336 0.160 0.023 Y # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 O _pdbx_validate_rmsd_angle.auth_asym_id_1 B _pdbx_validate_rmsd_angle.auth_comp_id_1 A1AMC _pdbx_validate_rmsd_angle.auth_seq_id_1 5 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 C _pdbx_validate_rmsd_angle.auth_asym_id_2 B _pdbx_validate_rmsd_angle.auth_comp_id_2 A1AMC _pdbx_validate_rmsd_angle.auth_seq_id_2 5 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 N _pdbx_validate_rmsd_angle.auth_asym_id_3 B _pdbx_validate_rmsd_angle.auth_comp_id_3 LEU _pdbx_validate_rmsd_angle.auth_seq_id_3 6 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 106.36 _pdbx_validate_rmsd_angle.angle_target_value 122.70 _pdbx_validate_rmsd_angle.angle_deviation -16.34 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.60 _pdbx_validate_rmsd_angle.linker_flag Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 38 ? ? -53.46 -73.34 2 1 HIS A 39 ? ? -46.52 -17.18 3 1 LEU A 52 ? ? -79.27 35.31 4 1 ARG A 133 ? ? -42.88 -72.97 5 1 NLE B 4 ? ? 179.84 160.52 6 1 A1AMC B 5 ? ? 63.08 -118.62 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id A1AMC _pdbx_validate_main_chain_plane.auth_asym_id B _pdbx_validate_main_chain_plane.auth_seq_id 5 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle -36.99 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+3/4 3 y+1/2,-x+1/2,z+1/4 4 x+1/2,-y+1/2,-z+1/4 5 -x+1/2,y+1/2,-z+3/4 6 -x,-y,z+1/2 7 y,x,-z 8 -y,-x,-z+1/2 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -6.76104913661 _pdbx_refine_tls.origin_y -21.3648685699 _pdbx_refine_tls.origin_z -15.538408357 _pdbx_refine_tls.T[1][1] 1.50231961875 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.294271723544 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.00695145300506 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.193233217797 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0833300935016 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.551273044475 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 0.272786754407 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.0305795428961 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.131544768127 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.761279286806 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.378066955131 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 0.550144183677 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.102795129784 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.304485142673 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.124029786068 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -1.05291354788 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.232970815541 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.0906002175962 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.971480958373 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.985503244074 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.175597512898 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 1 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id B _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 201 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LYS 146 ? A LYS 146 2 1 Y 1 A LEU 147 ? A LEU 147 3 1 Y 1 A ALA 148 ? A ALA 148 4 1 Y 1 A ALA 149 ? A ALA 149 5 1 Y 1 A ALA 150 ? A ALA 150 6 1 Y 1 A LEU 151 ? A LEU 151 7 1 Y 1 A GLU 152 ? A GLU 152 8 1 Y 1 A HIS 153 ? A HIS 153 9 1 Y 1 A HIS 154 ? A HIS 154 10 1 Y 1 A HIS 155 ? A HIS 155 11 1 Y 1 A HIS 156 ? A HIS 156 12 1 Y 1 A HIS 157 ? A HIS 157 13 1 Y 1 A HIS 158 ? A HIS 158 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1AL8 CB C N N 1 A1AL8 CA C N S 2 A1AL8 C C N N 3 A1AL8 O O N N 4 A1AL8 N N N N 5 A1AL8 C5 C N N 6 A1AL8 C4 C N N 7 A1AL8 C2 C N N 8 A1AL8 CG C Y N 9 A1AL8 CD1 C Y N 10 A1AL8 CD2 C Y N 11 A1AL8 NE1 N Y N 12 A1AL8 CE2 C Y N 13 A1AL8 CE3 C Y N 14 A1AL8 CZ2 C Y N 15 A1AL8 CZ3 C Y N 16 A1AL8 CH2 C Y N 17 A1AL8 C1 C N N 18 A1AL8 C3 C N N 19 A1AL8 OXT O N N 20 A1AL8 HB2 H N N 21 A1AL8 HB3 H N N 22 A1AL8 HA H N N 23 A1AL8 H H N N 24 A1AL8 H2 H N N 25 A1AL8 H7 H N N 26 A1AL8 H8 H N N 27 A1AL8 H9 H N N 28 A1AL8 H10 H N N 29 A1AL8 H11 H N N 30 A1AL8 H12 H N N 31 A1AL8 HD1 H N N 32 A1AL8 HE3 H N N 33 A1AL8 HZ2 H N N 34 A1AL8 HZ3 H N N 35 A1AL8 HH2 H N N 36 A1AL8 H18 H N N 37 A1AL8 H19 H N N 38 A1AL8 H20 H N N 39 A1AL8 HXT H N N 40 A1AMB C C N N 41 A1AMB CA C N S 42 A1AMB N N N N 43 A1AMB CB C N N 44 A1AMB CE2 C Y N 45 A1AMB CD2 C Y N 46 A1AMB ND1 N Y N 47 A1AMB NE1 N Y N 48 A1AMB NG N Y N 49 A1AMB O O N N 50 A1AMB OXT O N N 51 A1AMB HA H N N 52 A1AMB H2 H N N 53 A1AMB H H N N 54 A1AMB HB1 H N N 55 A1AMB HB2 H N N 56 A1AMB H7 H N N 57 A1AMB H8 H N N 58 A1AMB HXT H N N 59 A1AMC C1 C N N 60 A1AMC N N N N 61 A1AMC CA C N S 62 A1AMC C C N N 63 A1AMC O O N N 64 A1AMC CB C N N 65 A1AMC CG C N N 66 A1AMC CD C N N 67 A1AMC OXT O N N 68 A1AMC H1 H N N 69 A1AMC H4 H N N 70 A1AMC H3 H N N 71 A1AMC H H N N 72 A1AMC HA H N N 73 A1AMC HB1 H N N 74 A1AMC HB2 H N N 75 A1AMC H10 H N N 76 A1AMC H11 H N N 77 A1AMC H12 H N N 78 A1AMC H13 H N N 79 A1AMC HXT H N N 80 A1AMC OE O N N 81 A1AMC H5 H N N 82 ALA N N N N 83 ALA CA C N S 84 ALA C C N N 85 ALA O O N N 86 ALA CB C N N 87 ALA OXT O N N 88 ALA H H N N 89 ALA H2 H N N 90 ALA HA H N N 91 ALA HB1 H N N 92 ALA HB2 H N N 93 ALA HB3 H N N 94 ALA HXT H N N 95 ARG N N N N 96 ARG CA C N S 97 ARG C C N N 98 ARG O O N N 99 ARG CB C N N 100 ARG CG C N N 101 ARG CD C N N 102 ARG NE N N N 103 ARG CZ C N N 104 ARG NH1 N N N 105 ARG NH2 N N N 106 ARG OXT O N N 107 ARG H H N N 108 ARG H2 H N N 109 ARG HA H N N 110 ARG HB2 H N N 111 ARG HB3 H N N 112 ARG HG2 H N N 113 ARG HG3 H N N 114 ARG HD2 H N N 115 ARG HD3 H N N 116 ARG HE H N N 117 ARG HH11 H N N 118 ARG HH12 H N N 119 ARG HH21 H N N 120 ARG HH22 H N N 121 ARG HXT H N N 122 ASN N N N N 123 ASN CA C N S 124 ASN C C N N 125 ASN O O N N 126 ASN CB C N N 127 ASN CG C N N 128 ASN OD1 O N N 129 ASN ND2 N N N 130 ASN OXT O N N 131 ASN H H N N 132 ASN H2 H N N 133 ASN HA H N N 134 ASN HB2 H N N 135 ASN HB3 H N N 136 ASN HD21 H N N 137 ASN HD22 H N N 138 ASN HXT H N N 139 ASP N N N N 140 ASP CA C N S 141 ASP C C N N 142 ASP O O N N 143 ASP CB C N N 144 ASP CG C N N 145 ASP OD1 O N N 146 ASP OD2 O N N 147 ASP OXT O N N 148 ASP H H N N 149 ASP H2 H N N 150 ASP HA H N N 151 ASP HB2 H N N 152 ASP HB3 H N N 153 ASP HD2 H N N 154 ASP HXT H N N 155 GLN N N N N 156 GLN CA C N S 157 GLN C C N N 158 GLN O O N N 159 GLN CB C N N 160 GLN CG C N N 161 GLN CD C N N 162 GLN OE1 O N N 163 GLN NE2 N N N 164 GLN OXT O N N 165 GLN H H N N 166 GLN H2 H N N 167 GLN HA H N N 168 GLN HB2 H N N 169 GLN HB3 H N N 170 GLN HG2 H N N 171 GLN HG3 H N N 172 GLN HE21 H N N 173 GLN HE22 H N N 174 GLN HXT H N N 175 GLU N N N N 176 GLU CA C N S 177 GLU C C N N 178 GLU O O N N 179 GLU CB C N N 180 GLU CG C N N 181 GLU CD C N N 182 GLU OE1 O N N 183 GLU OE2 O N N 184 GLU OXT O N N 185 GLU H H N N 186 GLU H2 H N N 187 GLU HA H N N 188 GLU HB2 H N N 189 GLU HB3 H N N 190 GLU HG2 H N N 191 GLU HG3 H N N 192 GLU HE2 H N N 193 GLU HXT H N N 194 GLY N N N N 195 GLY CA C N N 196 GLY C C N N 197 GLY O O N N 198 GLY OXT O N N 199 GLY H H N N 200 GLY H2 H N N 201 GLY HA2 H N N 202 GLY HA3 H N N 203 GLY HXT H N N 204 HIS N N N N 205 HIS CA C N S 206 HIS C C N N 207 HIS O O N N 208 HIS CB C N N 209 HIS CG C Y N 210 HIS ND1 N Y N 211 HIS CD2 C Y N 212 HIS CE1 C Y N 213 HIS NE2 N Y N 214 HIS OXT O N N 215 HIS H H N N 216 HIS H2 H N N 217 HIS HA H N N 218 HIS HB2 H N N 219 HIS HB3 H N N 220 HIS HD1 H N N 221 HIS HD2 H N N 222 HIS HE1 H N N 223 HIS HE2 H N N 224 HIS HXT H N N 225 ILE N N N N 226 ILE CA C N S 227 ILE C C N N 228 ILE O O N N 229 ILE CB C N S 230 ILE CG1 C N N 231 ILE CG2 C N N 232 ILE CD1 C N N 233 ILE OXT O N N 234 ILE H H N N 235 ILE H2 H N N 236 ILE HA H N N 237 ILE HB H N N 238 ILE HG12 H N N 239 ILE HG13 H N N 240 ILE HG21 H N N 241 ILE HG22 H N N 242 ILE HG23 H N N 243 ILE HD11 H N N 244 ILE HD12 H N N 245 ILE HD13 H N N 246 ILE HXT H N N 247 LEU N N N N 248 LEU CA C N S 249 LEU C C N N 250 LEU O O N N 251 LEU CB C N N 252 LEU CG C N N 253 LEU CD1 C N N 254 LEU CD2 C N N 255 LEU OXT O N N 256 LEU H H N N 257 LEU H2 H N N 258 LEU HA H N N 259 LEU HB2 H N N 260 LEU HB3 H N N 261 LEU HG H N N 262 LEU HD11 H N N 263 LEU HD12 H N N 264 LEU HD13 H N N 265 LEU HD21 H N N 266 LEU HD22 H N N 267 LEU HD23 H N N 268 LEU HXT H N N 269 LYS N N N N 270 LYS CA C N S 271 LYS C C N N 272 LYS O O N N 273 LYS CB C N N 274 LYS CG C N N 275 LYS CD C N N 276 LYS CE C N N 277 LYS NZ N N N 278 LYS OXT O N N 279 LYS H H N N 280 LYS H2 H N N 281 LYS HA H N N 282 LYS HB2 H N N 283 LYS HB3 H N N 284 LYS HG2 H N N 285 LYS HG3 H N N 286 LYS HD2 H N N 287 LYS HD3 H N N 288 LYS HE2 H N N 289 LYS HE3 H N N 290 LYS HZ1 H N N 291 LYS HZ2 H N N 292 LYS HZ3 H N N 293 LYS HXT H N N 294 MET N N N N 295 MET CA C N S 296 MET C C N N 297 MET O O N N 298 MET CB C N N 299 MET CG C N N 300 MET SD S N N 301 MET CE C N N 302 MET OXT O N N 303 MET H H N N 304 MET H2 H N N 305 MET HA H N N 306 MET HB2 H N N 307 MET HB3 H N N 308 MET HG2 H N N 309 MET HG3 H N N 310 MET HE1 H N N 311 MET HE2 H N N 312 MET HE3 H N N 313 MET HXT H N N 314 MLE N N N N 315 MLE CN C N N 316 MLE CA C N S 317 MLE CB C N N 318 MLE CG C N N 319 MLE CD1 C N N 320 MLE CD2 C N N 321 MLE C C N N 322 MLE O O N N 323 MLE OXT O N N 324 MLE H H N N 325 MLE HN1 H N N 326 MLE HN2 H N N 327 MLE HN3 H N N 328 MLE HA H N N 329 MLE HB2 H N N 330 MLE HB3 H N N 331 MLE HG H N N 332 MLE HD11 H N N 333 MLE HD12 H N N 334 MLE HD13 H N N 335 MLE HD21 H N N 336 MLE HD22 H N N 337 MLE HD23 H N N 338 MLE HXT H N N 339 NLE N N N N 340 NLE CA C N S 341 NLE C C N N 342 NLE O O N N 343 NLE OXT O N N 344 NLE CB C N N 345 NLE CG C N N 346 NLE CD C N N 347 NLE CE C N N 348 NLE H H N N 349 NLE H2 H N N 350 NLE HA H N N 351 NLE HXT H N N 352 NLE HB2 H N N 353 NLE HB3 H N N 354 NLE HG2 H N N 355 NLE HG3 H N N 356 NLE HD2 H N N 357 NLE HD3 H N N 358 NLE HE1 H N N 359 NLE HE2 H N N 360 NLE HE3 H N N 361 PHE N N N N 362 PHE CA C N S 363 PHE C C N N 364 PHE O O N N 365 PHE CB C N N 366 PHE CG C Y N 367 PHE CD1 C Y N 368 PHE CD2 C Y N 369 PHE CE1 C Y N 370 PHE CE2 C Y N 371 PHE CZ C Y N 372 PHE OXT O N N 373 PHE H H N N 374 PHE H2 H N N 375 PHE HA H N N 376 PHE HB2 H N N 377 PHE HB3 H N N 378 PHE HD1 H N N 379 PHE HD2 H N N 380 PHE HE1 H N N 381 PHE HE2 H N N 382 PHE HZ H N N 383 PHE HXT H N N 384 PRO N N N N 385 PRO CA C N S 386 PRO C C N N 387 PRO O O N N 388 PRO CB C N N 389 PRO CG C N N 390 PRO CD C N N 391 PRO OXT O N N 392 PRO H H N N 393 PRO HA H N N 394 PRO HB2 H N N 395 PRO HB3 H N N 396 PRO HG2 H N N 397 PRO HG3 H N N 398 PRO HD2 H N N 399 PRO HD3 H N N 400 PRO HXT H N N 401 SER N N N N 402 SER CA C N S 403 SER C C N N 404 SER O O N N 405 SER CB C N N 406 SER OG O N N 407 SER OXT O N N 408 SER H H N N 409 SER H2 H N N 410 SER HA H N N 411 SER HB2 H N N 412 SER HB3 H N N 413 SER HG H N N 414 SER HXT H N N 415 THR N N N N 416 THR CA C N S 417 THR C C N N 418 THR O O N N 419 THR CB C N R 420 THR OG1 O N N 421 THR CG2 C N N 422 THR OXT O N N 423 THR H H N N 424 THR H2 H N N 425 THR HA H N N 426 THR HB H N N 427 THR HG1 H N N 428 THR HG21 H N N 429 THR HG22 H N N 430 THR HG23 H N N 431 THR HXT H N N 432 TYR N N N N 433 TYR CA C N S 434 TYR C C N N 435 TYR O O N N 436 TYR CB C N N 437 TYR CG C Y N 438 TYR CD1 C Y N 439 TYR CD2 C Y N 440 TYR CE1 C Y N 441 TYR CE2 C Y N 442 TYR CZ C Y N 443 TYR OH O N N 444 TYR OXT O N N 445 TYR H H N N 446 TYR H2 H N N 447 TYR HA H N N 448 TYR HB2 H N N 449 TYR HB3 H N N 450 TYR HD1 H N N 451 TYR HD2 H N N 452 TYR HE1 H N N 453 TYR HE2 H N N 454 TYR HH H N N 455 TYR HXT H N N 456 VAL N N N N 457 VAL CA C N S 458 VAL C C N N 459 VAL O O N N 460 VAL CB C N N 461 VAL CG1 C N N 462 VAL CG2 C N N 463 VAL OXT O N N 464 VAL H H N N 465 VAL H2 H N N 466 VAL HA H N N 467 VAL HB H N N 468 VAL HG11 H N N 469 VAL HG12 H N N 470 VAL HG13 H N N 471 VAL HG21 H N N 472 VAL HG22 H N N 473 VAL HG23 H N N 474 VAL HXT H N N 475 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1AL8 CH2 CZ2 doub Y N 1 A1AL8 CH2 CZ3 sing Y N 2 A1AL8 CZ2 CE2 sing Y N 3 A1AL8 C2 C1 sing N N 4 A1AL8 CZ3 CE3 doub Y N 5 A1AL8 CE2 CD2 doub Y N 6 A1AL8 CE2 NE1 sing Y N 7 A1AL8 C5 C4 doub N N 8 A1AL8 CE3 CD2 sing Y N 9 A1AL8 C1 NE1 sing N N 10 A1AL8 C1 C4 sing N N 11 A1AL8 C1 C3 sing N N 12 A1AL8 CD2 CG sing Y N 13 A1AL8 NE1 CD1 sing Y N 14 A1AL8 CG CD1 doub Y N 15 A1AL8 CG CB sing N N 16 A1AL8 CA C sing N N 17 A1AL8 CA CB sing N N 18 A1AL8 CA N sing N N 19 A1AL8 C O doub N N 20 A1AL8 C OXT sing N N 21 A1AL8 CB HB2 sing N N 22 A1AL8 CB HB3 sing N N 23 A1AL8 CA HA sing N N 24 A1AL8 N H sing N N 25 A1AL8 N H2 sing N N 26 A1AL8 C5 H7 sing N N 27 A1AL8 C5 H8 sing N N 28 A1AL8 C4 H9 sing N N 29 A1AL8 C2 H10 sing N N 30 A1AL8 C2 H11 sing N N 31 A1AL8 C2 H12 sing N N 32 A1AL8 CD1 HD1 sing N N 33 A1AL8 CE3 HE3 sing N N 34 A1AL8 CZ2 HZ2 sing N N 35 A1AL8 CZ3 HZ3 sing N N 36 A1AL8 CH2 HH2 sing N N 37 A1AL8 C3 H18 sing N N 38 A1AL8 C3 H19 sing N N 39 A1AL8 C3 H20 sing N N 40 A1AL8 OXT HXT sing N N 41 A1AMB O C doub N N 42 A1AMB C CA sing N N 43 A1AMB N CA sing N N 44 A1AMB CA CB sing N N 45 A1AMB CB NG sing N N 46 A1AMB NG ND1 sing Y N 47 A1AMB NG CD2 sing Y N 48 A1AMB ND1 NE1 doub Y N 49 A1AMB CD2 CE2 doub Y N 50 A1AMB NE1 CE2 sing Y N 51 A1AMB C OXT sing N N 52 A1AMB CA HA sing N N 53 A1AMB N H2 sing N N 54 A1AMB N H sing N N 55 A1AMB CB HB1 sing N N 56 A1AMB CB HB2 sing N N 57 A1AMB CE2 H7 sing N N 58 A1AMB CD2 H8 sing N N 59 A1AMB OXT HXT sing N N 60 A1AMC C1 N sing N N 61 A1AMC N CA sing N N 62 A1AMC O C doub N N 63 A1AMC CA C sing N N 64 A1AMC CA CB sing N N 65 A1AMC CB CG sing N N 66 A1AMC CG CD sing N N 67 A1AMC C OXT sing N N 68 A1AMC C1 H1 sing N N 69 A1AMC C1 H4 sing N N 70 A1AMC C1 H3 sing N N 71 A1AMC N H sing N N 72 A1AMC CA HA sing N N 73 A1AMC CB HB1 sing N N 74 A1AMC CB HB2 sing N N 75 A1AMC CG H10 sing N N 76 A1AMC CG H11 sing N N 77 A1AMC CD H12 sing N N 78 A1AMC CD H13 sing N N 79 A1AMC OXT HXT sing N N 80 A1AMC CD OE sing N N 81 A1AMC OE H5 sing N N 82 ALA N CA sing N N 83 ALA N H sing N N 84 ALA N H2 sing N N 85 ALA CA C sing N N 86 ALA CA CB sing N N 87 ALA CA HA sing N N 88 ALA C O doub N N 89 ALA C OXT sing N N 90 ALA CB HB1 sing N N 91 ALA CB HB2 sing N N 92 ALA CB HB3 sing N N 93 ALA OXT HXT sing N N 94 ARG N CA sing N N 95 ARG N H sing N N 96 ARG N H2 sing N N 97 ARG CA C sing N N 98 ARG CA CB sing N N 99 ARG CA HA sing N N 100 ARG C O doub N N 101 ARG C OXT sing N N 102 ARG CB CG sing N N 103 ARG CB HB2 sing N N 104 ARG CB HB3 sing N N 105 ARG CG CD sing N N 106 ARG CG HG2 sing N N 107 ARG CG HG3 sing N N 108 ARG CD NE sing N N 109 ARG CD HD2 sing N N 110 ARG CD HD3 sing N N 111 ARG NE CZ sing N N 112 ARG NE HE sing N N 113 ARG CZ NH1 sing N N 114 ARG CZ NH2 doub N N 115 ARG NH1 HH11 sing N N 116 ARG NH1 HH12 sing N N 117 ARG NH2 HH21 sing N N 118 ARG NH2 HH22 sing N N 119 ARG OXT HXT sing N N 120 ASN N CA sing N N 121 ASN N H sing N N 122 ASN N H2 sing N N 123 ASN CA C sing N N 124 ASN CA CB sing N N 125 ASN CA HA sing N N 126 ASN C O doub N N 127 ASN C OXT sing N N 128 ASN CB CG sing N N 129 ASN CB HB2 sing N N 130 ASN CB HB3 sing N N 131 ASN CG OD1 doub N N 132 ASN CG ND2 sing N N 133 ASN ND2 HD21 sing N N 134 ASN ND2 HD22 sing N N 135 ASN OXT HXT sing N N 136 ASP N CA sing N N 137 ASP N H sing N N 138 ASP N H2 sing N N 139 ASP CA C sing N N 140 ASP CA CB sing N N 141 ASP CA HA sing N N 142 ASP C O doub N N 143 ASP C OXT sing N N 144 ASP CB CG sing N N 145 ASP CB HB2 sing N N 146 ASP CB HB3 sing N N 147 ASP CG OD1 doub N N 148 ASP CG OD2 sing N N 149 ASP OD2 HD2 sing N N 150 ASP OXT HXT sing N N 151 GLN N CA sing N N 152 GLN N H sing N N 153 GLN N H2 sing N N 154 GLN CA C sing N N 155 GLN CA CB sing N N 156 GLN CA HA sing N N 157 GLN C O doub N N 158 GLN C OXT sing N N 159 GLN CB CG sing N N 160 GLN CB HB2 sing N N 161 GLN CB HB3 sing N N 162 GLN CG CD sing N N 163 GLN CG HG2 sing N N 164 GLN CG HG3 sing N N 165 GLN CD OE1 doub N N 166 GLN CD NE2 sing N N 167 GLN NE2 HE21 sing N N 168 GLN NE2 HE22 sing N N 169 GLN OXT HXT sing N N 170 GLU N CA sing N N 171 GLU N H sing N N 172 GLU N H2 sing N N 173 GLU CA C sing N N 174 GLU CA CB sing N N 175 GLU CA HA sing N N 176 GLU C O doub N N 177 GLU C OXT sing N N 178 GLU CB CG sing N N 179 GLU CB HB2 sing N N 180 GLU CB HB3 sing N N 181 GLU CG CD sing N N 182 GLU CG HG2 sing N N 183 GLU CG HG3 sing N N 184 GLU CD OE1 doub N N 185 GLU CD OE2 sing N N 186 GLU OE2 HE2 sing N N 187 GLU OXT HXT sing N N 188 GLY N CA sing N N 189 GLY N H sing N N 190 GLY N H2 sing N N 191 GLY CA C sing N N 192 GLY CA HA2 sing N N 193 GLY CA HA3 sing N N 194 GLY C O doub N N 195 GLY C OXT sing N N 196 GLY OXT HXT sing N N 197 HIS N CA sing N N 198 HIS N H sing N N 199 HIS N H2 sing N N 200 HIS CA C sing N N 201 HIS CA CB sing N N 202 HIS CA HA sing N N 203 HIS C O doub N N 204 HIS C OXT sing N N 205 HIS CB CG sing N N 206 HIS CB HB2 sing N N 207 HIS CB HB3 sing N N 208 HIS CG ND1 sing Y N 209 HIS CG CD2 doub Y N 210 HIS ND1 CE1 doub Y N 211 HIS ND1 HD1 sing N N 212 HIS CD2 NE2 sing Y N 213 HIS CD2 HD2 sing N N 214 HIS CE1 NE2 sing Y N 215 HIS CE1 HE1 sing N N 216 HIS NE2 HE2 sing N N 217 HIS OXT HXT sing N N 218 ILE N CA sing N N 219 ILE N H sing N N 220 ILE N H2 sing N N 221 ILE CA C sing N N 222 ILE CA CB sing N N 223 ILE CA HA sing N N 224 ILE C O doub N N 225 ILE C OXT sing N N 226 ILE CB CG1 sing N N 227 ILE CB CG2 sing N N 228 ILE CB HB sing N N 229 ILE CG1 CD1 sing N N 230 ILE CG1 HG12 sing N N 231 ILE CG1 HG13 sing N N 232 ILE CG2 HG21 sing N N 233 ILE CG2 HG22 sing N N 234 ILE CG2 HG23 sing N N 235 ILE CD1 HD11 sing N N 236 ILE CD1 HD12 sing N N 237 ILE CD1 HD13 sing N N 238 ILE OXT HXT sing N N 239 LEU N CA sing N N 240 LEU N H sing N N 241 LEU N H2 sing N N 242 LEU CA C sing N N 243 LEU CA CB sing N N 244 LEU CA HA sing N N 245 LEU C O doub N N 246 LEU C OXT sing N N 247 LEU CB CG sing N N 248 LEU CB HB2 sing N N 249 LEU CB HB3 sing N N 250 LEU CG CD1 sing N N 251 LEU CG CD2 sing N N 252 LEU CG HG sing N N 253 LEU CD1 HD11 sing N N 254 LEU CD1 HD12 sing N N 255 LEU CD1 HD13 sing N N 256 LEU CD2 HD21 sing N N 257 LEU CD2 HD22 sing N N 258 LEU CD2 HD23 sing N N 259 LEU OXT HXT sing N N 260 LYS N CA sing N N 261 LYS N H sing N N 262 LYS N H2 sing N N 263 LYS CA C sing N N 264 LYS CA CB sing N N 265 LYS CA HA sing N N 266 LYS C O doub N N 267 LYS C OXT sing N N 268 LYS CB CG sing N N 269 LYS CB HB2 sing N N 270 LYS CB HB3 sing N N 271 LYS CG CD sing N N 272 LYS CG HG2 sing N N 273 LYS CG HG3 sing N N 274 LYS CD CE sing N N 275 LYS CD HD2 sing N N 276 LYS CD HD3 sing N N 277 LYS CE NZ sing N N 278 LYS CE HE2 sing N N 279 LYS CE HE3 sing N N 280 LYS NZ HZ1 sing N N 281 LYS NZ HZ2 sing N N 282 LYS NZ HZ3 sing N N 283 LYS OXT HXT sing N N 284 MET N CA sing N N 285 MET N H sing N N 286 MET N H2 sing N N 287 MET CA C sing N N 288 MET CA CB sing N N 289 MET CA HA sing N N 290 MET C O doub N N 291 MET C OXT sing N N 292 MET CB CG sing N N 293 MET CB HB2 sing N N 294 MET CB HB3 sing N N 295 MET CG SD sing N N 296 MET CG HG2 sing N N 297 MET CG HG3 sing N N 298 MET SD CE sing N N 299 MET CE HE1 sing N N 300 MET CE HE2 sing N N 301 MET CE HE3 sing N N 302 MET OXT HXT sing N N 303 MLE N CN sing N N 304 MLE N CA sing N N 305 MLE N H sing N N 306 MLE CN HN1 sing N N 307 MLE CN HN2 sing N N 308 MLE CN HN3 sing N N 309 MLE CA CB sing N N 310 MLE CA C sing N N 311 MLE CA HA sing N N 312 MLE CB CG sing N N 313 MLE CB HB2 sing N N 314 MLE CB HB3 sing N N 315 MLE CG CD1 sing N N 316 MLE CG CD2 sing N N 317 MLE CG HG sing N N 318 MLE CD1 HD11 sing N N 319 MLE CD1 HD12 sing N N 320 MLE CD1 HD13 sing N N 321 MLE CD2 HD21 sing N N 322 MLE CD2 HD22 sing N N 323 MLE CD2 HD23 sing N N 324 MLE C O doub N N 325 MLE C OXT sing N N 326 MLE OXT HXT sing N N 327 NLE N CA sing N N 328 NLE N H sing N N 329 NLE N H2 sing N N 330 NLE CA C sing N N 331 NLE CA CB sing N N 332 NLE CA HA sing N N 333 NLE C O doub N N 334 NLE C OXT sing N N 335 NLE OXT HXT sing N N 336 NLE CB CG sing N N 337 NLE CB HB2 sing N N 338 NLE CB HB3 sing N N 339 NLE CG CD sing N N 340 NLE CG HG2 sing N N 341 NLE CG HG3 sing N N 342 NLE CD CE sing N N 343 NLE CD HD2 sing N N 344 NLE CD HD3 sing N N 345 NLE CE HE1 sing N N 346 NLE CE HE2 sing N N 347 NLE CE HE3 sing N N 348 PHE N CA sing N N 349 PHE N H sing N N 350 PHE N H2 sing N N 351 PHE CA C sing N N 352 PHE CA CB sing N N 353 PHE CA HA sing N N 354 PHE C O doub N N 355 PHE C OXT sing N N 356 PHE CB CG sing N N 357 PHE CB HB2 sing N N 358 PHE CB HB3 sing N N 359 PHE CG CD1 doub Y N 360 PHE CG CD2 sing Y N 361 PHE CD1 CE1 sing Y N 362 PHE CD1 HD1 sing N N 363 PHE CD2 CE2 doub Y N 364 PHE CD2 HD2 sing N N 365 PHE CE1 CZ doub Y N 366 PHE CE1 HE1 sing N N 367 PHE CE2 CZ sing Y N 368 PHE CE2 HE2 sing N N 369 PHE CZ HZ sing N N 370 PHE OXT HXT sing N N 371 PRO N CA sing N N 372 PRO N CD sing N N 373 PRO N H sing N N 374 PRO CA C sing N N 375 PRO CA CB sing N N 376 PRO CA HA sing N N 377 PRO C O doub N N 378 PRO C OXT sing N N 379 PRO CB CG sing N N 380 PRO CB HB2 sing N N 381 PRO CB HB3 sing N N 382 PRO CG CD sing N N 383 PRO CG HG2 sing N N 384 PRO CG HG3 sing N N 385 PRO CD HD2 sing N N 386 PRO CD HD3 sing N N 387 PRO OXT HXT sing N N 388 SER N CA sing N N 389 SER N H sing N N 390 SER N H2 sing N N 391 SER CA C sing N N 392 SER CA CB sing N N 393 SER CA HA sing N N 394 SER C O doub N N 395 SER C OXT sing N N 396 SER CB OG sing N N 397 SER CB HB2 sing N N 398 SER CB HB3 sing N N 399 SER OG HG sing N N 400 SER OXT HXT sing N N 401 THR N CA sing N N 402 THR N H sing N N 403 THR N H2 sing N N 404 THR CA C sing N N 405 THR CA CB sing N N 406 THR CA HA sing N N 407 THR C O doub N N 408 THR C OXT sing N N 409 THR CB OG1 sing N N 410 THR CB CG2 sing N N 411 THR CB HB sing N N 412 THR OG1 HG1 sing N N 413 THR CG2 HG21 sing N N 414 THR CG2 HG22 sing N N 415 THR CG2 HG23 sing N N 416 THR OXT HXT sing N N 417 TYR N CA sing N N 418 TYR N H sing N N 419 TYR N H2 sing N N 420 TYR CA C sing N N 421 TYR CA CB sing N N 422 TYR CA HA sing N N 423 TYR C O doub N N 424 TYR C OXT sing N N 425 TYR CB CG sing N N 426 TYR CB HB2 sing N N 427 TYR CB HB3 sing N N 428 TYR CG CD1 doub Y N 429 TYR CG CD2 sing Y N 430 TYR CD1 CE1 sing Y N 431 TYR CD1 HD1 sing N N 432 TYR CD2 CE2 doub Y N 433 TYR CD2 HD2 sing N N 434 TYR CE1 CZ doub Y N 435 TYR CE1 HE1 sing N N 436 TYR CE2 CZ sing Y N 437 TYR CE2 HE2 sing N N 438 TYR CZ OH sing N N 439 TYR OH HH sing N N 440 TYR OXT HXT sing N N 441 VAL N CA sing N N 442 VAL N H sing N N 443 VAL N H2 sing N N 444 VAL CA C sing N N 445 VAL CA CB sing N N 446 VAL CA HA sing N N 447 VAL C O doub N N 448 VAL C OXT sing N N 449 VAL CB CG1 sing N N 450 VAL CB CG2 sing N N 451 VAL CB HB sing N N 452 VAL CG1 HG11 sing N N 453 VAL CG1 HG12 sing N N 454 VAL CG1 HG13 sing N N 455 VAL CG2 HG21 sing N N 456 VAL CG2 HG22 sing N N 457 VAL CG2 HG23 sing N N 458 VAL OXT HXT sing N N 459 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number U19AI142735 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6cn8 _pdbx_initial_refinement_model.details 'Rufomycin removed' # _space_group.name_H-M_alt 'P 43 21 2' _space_group.name_Hall 'P 4nw 2abw' _space_group.IT_number 96 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 9BBJ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.017250 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017250 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007577 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #