data_9BD0 # _entry.id 9BD0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.395 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9BD0 pdb_00009bd0 10.2210/pdb9bd0/pdb WWPDB D_1000283072 ? ? BMRB 52103 ? 10.13018/BMR52103 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-05-29 2 'Structure model' 1 1 2024-06-26 3 'Structure model' 1 2 2024-07-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 3 'Structure model' '_citation.journal_volume' 13 3 'Structure model' '_citation.title' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9BD0 _pdbx_database_status.recvd_initial_deposition_date 2024-04-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 52103 _pdbx_database_related.content_type unspecified # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 geisbrechtb@ksu.edu Brian Geisbrecht V 'principal investigator/group leader' 0000-0002-1775-0727 3 omp@ksu.edu Om Prakash ? 'principal investigator/group leader' 0000-0001-7714-641X # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Mishra, N.B.' 1 0000-0001-8931-7351 'Prakash, O.' 2 0000-0001-7714-641X 'Geisbrecht, B.V.' 3 0000-0002-1775-0727 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Arch.Biochem.Biophys. _citation.journal_id_ASTM ABBIA4 _citation.journal_id_CSD 0158 _citation.journal_id_ISSN 1096-0384 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 758 _citation.language ? _citation.page_first 110060 _citation.page_last 110060 _citation.title ;Staphylococcal peroxidase inhibitor (SPIN): Investigation of the inhibitory N-terminal domain via a stabilizing disulfide insertion. ; _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.abb.2024.110060 _citation.pdbx_database_id_PubMed 38880318 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fatehi, S.' 1 ? primary 'Mishra, N.' 2 ? primary 'Herdendorf, T.J.' 3 ? primary 'Prakash, O.' 4 ? primary 'Geisbrecht, B.V.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Myeloperoxidase inhibitor SPIN' _entity.formula_weight 8775.766 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'V31C, D41C' _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSTGSKCYSQNGLVLHCDANFLEHELSYIDVLLDKNADQATKDNLRSYFADKGLHSIKDIINKAKQDGFDVSKYEHVK _entity_poly.pdbx_seq_one_letter_code_can GSTGSKCYSQNGLVLHCDANFLEHELSYIDVLLDKNADQATKDNLRSYFADKGLHSIKDIINKAKQDGFDVSKYEHVK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 THR n 1 4 GLY n 1 5 SER n 1 6 LYS n 1 7 CYS n 1 8 TYR n 1 9 SER n 1 10 GLN n 1 11 ASN n 1 12 GLY n 1 13 LEU n 1 14 VAL n 1 15 LEU n 1 16 HIS n 1 17 CYS n 1 18 ASP n 1 19 ALA n 1 20 ASN n 1 21 PHE n 1 22 LEU n 1 23 GLU n 1 24 HIS n 1 25 GLU n 1 26 LEU n 1 27 SER n 1 28 TYR n 1 29 ILE n 1 30 ASP n 1 31 VAL n 1 32 LEU n 1 33 LEU n 1 34 ASP n 1 35 LYS n 1 36 ASN n 1 37 ALA n 1 38 ASP n 1 39 GLN n 1 40 ALA n 1 41 THR n 1 42 LYS n 1 43 ASP n 1 44 ASN n 1 45 LEU n 1 46 ARG n 1 47 SER n 1 48 TYR n 1 49 PHE n 1 50 ALA n 1 51 ASP n 1 52 LYS n 1 53 GLY n 1 54 LEU n 1 55 HIS n 1 56 SER n 1 57 ILE n 1 58 LYS n 1 59 ASP n 1 60 ILE n 1 61 ILE n 1 62 ASN n 1 63 LYS n 1 64 ALA n 1 65 LYS n 1 66 GLN n 1 67 ASP n 1 68 GLY n 1 69 PHE n 1 70 ASP n 1 71 VAL n 1 72 SER n 1 73 LYS n 1 74 TYR n 1 75 GLU n 1 76 HIS n 1 77 VAL n 1 78 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 78 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CNH35_02325 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain Newman _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1280 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pT7HMT _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -4 ? ? ? A . n A 1 2 SER 2 -3 ? ? ? A . n A 1 3 THR 3 -2 ? ? ? A . n A 1 4 GLY 4 -1 ? ? ? A . n A 1 5 SER 5 0 ? ? ? A . n A 1 6 LYS 6 1 1 LYS LYS A . n A 1 7 CYS 7 2 2 CYS CYS A . n A 1 8 TYR 8 3 3 TYR TYR A . n A 1 9 SER 9 4 4 SER SER A . n A 1 10 GLN 10 5 5 GLN GLN A . n A 1 11 ASN 11 6 6 ASN ASN A . n A 1 12 GLY 12 7 7 GLY GLY A . n A 1 13 LEU 13 8 8 LEU LEU A . n A 1 14 VAL 14 9 9 VAL VAL A . n A 1 15 LEU 15 10 10 LEU LEU A . n A 1 16 HIS 16 11 11 HIS HIS A . n A 1 17 CYS 17 12 12 CYS CYS A . n A 1 18 ASP 18 13 13 ASP ASP A . n A 1 19 ALA 19 14 14 ALA ALA A . n A 1 20 ASN 20 15 15 ASN ASN A . n A 1 21 PHE 21 16 16 PHE PHE A . n A 1 22 LEU 22 17 17 LEU LEU A . n A 1 23 GLU 23 18 18 GLU GLU A . n A 1 24 HIS 24 19 19 HIS HIS A . n A 1 25 GLU 25 20 20 GLU GLU A . n A 1 26 LEU 26 21 21 LEU LEU A . n A 1 27 SER 27 22 22 SER SER A . n A 1 28 TYR 28 23 23 TYR TYR A . n A 1 29 ILE 29 24 24 ILE ILE A . n A 1 30 ASP 30 25 25 ASP ASP A . n A 1 31 VAL 31 26 26 VAL VAL A . n A 1 32 LEU 32 27 27 LEU LEU A . n A 1 33 LEU 33 28 28 LEU LEU A . n A 1 34 ASP 34 29 29 ASP ASP A . n A 1 35 LYS 35 30 30 LYS LYS A . n A 1 36 ASN 36 31 31 ASN ASN A . n A 1 37 ALA 37 32 32 ALA ALA A . n A 1 38 ASP 38 33 33 ASP ASP A . n A 1 39 GLN 39 34 34 GLN GLN A . n A 1 40 ALA 40 35 35 ALA ALA A . n A 1 41 THR 41 36 36 THR THR A . n A 1 42 LYS 42 37 37 LYS LYS A . n A 1 43 ASP 43 38 38 ASP ASP A . n A 1 44 ASN 44 39 39 ASN ASN A . n A 1 45 LEU 45 40 40 LEU LEU A . n A 1 46 ARG 46 41 41 ARG ARG A . n A 1 47 SER 47 42 42 SER SER A . n A 1 48 TYR 48 43 43 TYR TYR A . n A 1 49 PHE 49 44 44 PHE PHE A . n A 1 50 ALA 50 45 45 ALA ALA A . n A 1 51 ASP 51 46 46 ASP ASP A . n A 1 52 LYS 52 47 47 LYS LYS A . n A 1 53 GLY 53 48 48 GLY GLY A . n A 1 54 LEU 54 49 49 LEU LEU A . n A 1 55 HIS 55 50 50 HIS HIS A . n A 1 56 SER 56 51 51 SER SER A . n A 1 57 ILE 57 52 52 ILE ILE A . n A 1 58 LYS 58 53 53 LYS LYS A . n A 1 59 ASP 59 54 54 ASP ASP A . n A 1 60 ILE 60 55 55 ILE ILE A . n A 1 61 ILE 61 56 56 ILE ILE A . n A 1 62 ASN 62 57 57 ASN ASN A . n A 1 63 LYS 63 58 58 LYS LYS A . n A 1 64 ALA 64 59 59 ALA ALA A . n A 1 65 LYS 65 60 60 LYS LYS A . n A 1 66 GLN 66 61 61 GLN GLN A . n A 1 67 ASP 67 62 62 ASP ASP A . n A 1 68 GLY 68 63 63 GLY GLY A . n A 1 69 PHE 69 64 64 PHE PHE A . n A 1 70 ASP 70 65 65 ASP ASP A . n A 1 71 VAL 71 66 66 VAL VAL A . n A 1 72 SER 72 67 67 SER SER A . n A 1 73 LYS 73 68 68 LYS LYS A . n A 1 74 TYR 74 69 69 TYR TYR A . n A 1 75 GLU 75 70 70 GLU GLU A . n A 1 76 HIS 76 71 71 HIS HIS A . n A 1 77 VAL 77 72 72 VAL VAL A . n A 1 78 LYS 78 73 73 LYS LYS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9BD0 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9BD0 _struct.title 'Solution Structure of a Disulfide Insertion Mutant of S. aureus SPIN' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9BD0 _struct_keywords.text 'myeloperoxidase, inhibitor, immune evasion, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A290QEM1_STAAE _struct_ref.pdbx_db_accession A0A290QEM1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code KVYSQNGLVLHDDANFLEHELSYIDVLLDKNADQATKDNLRSYFADKGLHSIKDIINKAKQDGFDVSKYEHVK _struct_ref.pdbx_align_begin 30 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9BD0 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 78 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A290QEM1 _struct_ref_seq.db_align_beg 30 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 102 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 73 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9BD0 GLY A 1 ? UNP A0A290QEM1 ? ? 'expression tag' -4 1 1 9BD0 SER A 2 ? UNP A0A290QEM1 ? ? 'expression tag' -3 2 1 9BD0 THR A 3 ? UNP A0A290QEM1 ? ? 'expression tag' -2 3 1 9BD0 GLY A 4 ? UNP A0A290QEM1 ? ? 'expression tag' -1 4 1 9BD0 SER A 5 ? UNP A0A290QEM1 ? ? 'expression tag' 0 5 1 9BD0 CYS A 7 ? UNP A0A290QEM1 VAL 31 'engineered mutation' 2 6 1 9BD0 CYS A 17 ? UNP A0A290QEM1 ASP 41 'engineered mutation' 12 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 22 ? SER A 27 ? LEU A 17 SER A 22 1 ? 6 HELX_P HELX_P2 AA2 SER A 27 ? ASP A 34 ? SER A 22 ASP A 29 1 ? 8 HELX_P HELX_P3 AA3 ASP A 38 ? SER A 47 ? ASP A 33 SER A 42 1 ? 10 HELX_P HELX_P4 AA4 SER A 47 ? GLY A 53 ? SER A 42 GLY A 48 1 ? 7 HELX_P HELX_P5 AA5 SER A 56 ? GLY A 68 ? SER A 51 GLY A 63 1 ? 13 HELX_P HELX_P6 AA6 VAL A 71 ? GLU A 75 ? VAL A 66 GLU A 70 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 SG A CYS 2 ? ? SG A CYS 12 ? ? 1.69 2 2 SG A CYS 2 ? ? SG A CYS 12 ? ? 2.07 3 3 SG A CYS 2 ? ? SG A CYS 12 ? ? 2.13 4 4 SG A CYS 2 ? ? SG A CYS 12 ? ? 1.98 5 5 SG A CYS 2 ? ? SG A CYS 12 ? ? 2.05 6 6 SG A CYS 2 ? ? SG A CYS 12 ? ? 2.11 7 7 SG A CYS 2 ? ? SG A CYS 12 ? ? 1.86 8 8 SG A CYS 2 ? ? SG A CYS 12 ? ? 1.61 9 9 SG A CYS 2 ? ? SG A CYS 12 ? ? 2.10 10 10 SG A CYS 2 ? ? SG A CYS 12 ? ? 2.09 11 11 SG A CYS 2 ? ? SG A CYS 12 ? ? 2.04 12 12 SG A CYS 2 ? ? SG A CYS 12 ? ? 1.99 13 13 SG A CYS 2 ? ? SG A CYS 12 ? ? 1.71 14 14 SG A CYS 2 ? ? SG A CYS 12 ? ? 1.75 15 15 SG A CYS 2 ? ? SG A CYS 12 ? ? 2.03 16 16 SG A CYS 2 ? ? SG A CYS 12 ? ? 1.87 17 17 SG A CYS 2 ? ? SG A CYS 12 ? ? 2.06 18 18 SG A CYS 2 ? ? SG A CYS 12 ? ? 1.93 19 19 SG A CYS 2 ? ? SG A CYS 12 ? ? 2.10 20 20 SG A CYS 2 ? ? SG A CYS 12 ? ? 2.01 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 2 ? ? -64.54 93.07 2 1 ASN A 6 ? ? -156.62 22.90 3 1 LEU A 8 ? ? -179.02 99.33 4 1 LEU A 10 ? ? -55.76 109.51 5 1 CYS A 12 ? ? -99.17 32.08 6 1 ASN A 15 ? ? -179.61 -74.96 7 1 PHE A 16 ? ? -179.34 34.34 8 1 ALA A 32 ? ? -72.22 -169.00 9 1 SER A 51 ? ? 177.08 -174.06 10 1 HIS A 71 ? ? 37.41 44.50 11 2 GLN A 5 ? ? 74.55 -57.40 12 2 VAL A 9 ? ? -152.60 25.21 13 2 LEU A 10 ? ? 52.46 -170.00 14 2 HIS A 11 ? ? -143.80 26.64 15 2 CYS A 12 ? ? -162.70 65.18 16 2 PHE A 16 ? ? 178.05 48.09 17 2 LEU A 17 ? ? -58.43 171.91 18 2 ALA A 32 ? ? -71.50 -168.77 19 2 SER A 51 ? ? 178.15 -173.53 20 2 VAL A 72 ? ? 36.19 45.37 21 3 GLN A 5 ? ? -153.29 -41.48 22 3 LEU A 8 ? ? -143.28 -74.77 23 3 VAL A 9 ? ? -178.46 129.96 24 3 LEU A 10 ? ? -61.06 -167.86 25 3 CYS A 12 ? ? -51.98 103.09 26 3 ALA A 14 ? ? 55.38 81.84 27 3 ASN A 15 ? ? -174.00 -169.34 28 3 SER A 51 ? ? 175.15 -169.50 29 3 GLU A 70 ? ? -95.10 53.31 30 3 VAL A 72 ? ? 47.88 83.37 31 4 CYS A 2 ? ? -174.00 32.05 32 4 GLN A 5 ? ? -177.78 -43.18 33 4 ASN A 6 ? ? -162.52 33.04 34 4 LEU A 8 ? ? -179.35 -74.71 35 4 HIS A 11 ? ? 63.77 106.63 36 4 ALA A 14 ? ? -96.47 51.28 37 4 ASN A 15 ? ? -104.97 -74.99 38 4 PHE A 16 ? ? -179.63 39.70 39 4 ALA A 32 ? ? -75.19 -169.03 40 4 SER A 51 ? ? 175.34 -172.14 41 4 VAL A 66 ? ? -141.23 16.66 42 4 VAL A 72 ? ? 47.60 80.17 43 5 ASN A 6 ? ? -160.61 25.27 44 5 LEU A 8 ? ? -178.82 99.64 45 5 CYS A 12 ? ? -51.12 107.68 46 5 ALA A 14 ? ? 52.86 86.49 47 5 ASN A 15 ? ? -175.34 -169.30 48 5 LEU A 17 ? ? -58.03 177.16 49 5 ALA A 32 ? ? -71.32 -168.43 50 5 SER A 51 ? ? 175.39 -170.65 51 5 VAL A 72 ? ? 36.41 44.68 52 6 CYS A 2 ? ? -61.25 -167.73 53 6 GLN A 5 ? ? -179.88 -43.33 54 6 LEU A 10 ? ? 62.42 111.85 55 6 HIS A 11 ? ? 177.99 98.88 56 6 ALA A 14 ? ? 66.48 -165.82 57 6 ASN A 15 ? ? 71.98 -72.55 58 6 PHE A 16 ? ? -174.47 51.39 59 6 ALA A 32 ? ? -71.29 -169.40 60 6 SER A 51 ? ? 176.07 -171.30 61 6 VAL A 66 ? ? -95.49 31.84 62 7 CYS A 2 ? ? 55.15 88.68 63 7 GLN A 5 ? ? -169.05 -39.74 64 7 VAL A 9 ? ? -147.93 31.50 65 7 LEU A 10 ? ? 61.25 179.94 66 7 HIS A 11 ? ? -127.80 -74.36 67 7 CYS A 12 ? ? -51.08 103.59 68 7 ALA A 14 ? ? -173.10 -67.18 69 7 ASN A 15 ? ? -179.54 -35.12 70 7 PHE A 16 ? ? -153.00 48.62 71 7 LEU A 17 ? ? -58.86 -175.03 72 7 ALA A 32 ? ? -51.13 170.41 73 7 SER A 51 ? ? 176.86 -173.05 74 8 ASN A 6 ? ? -136.17 -46.79 75 8 LEU A 10 ? ? -89.77 48.62 76 8 ALA A 14 ? ? 51.70 82.19 77 8 ASN A 15 ? ? -178.52 -172.61 78 8 LEU A 17 ? ? -60.28 -171.73 79 8 ALA A 32 ? ? -70.86 -168.49 80 8 SER A 51 ? ? 171.15 -168.16 81 8 HIS A 71 ? ? 36.53 58.91 82 9 GLN A 5 ? ? -179.57 -42.98 83 9 LEU A 8 ? ? 64.20 109.21 84 9 VAL A 9 ? ? -177.72 -34.28 85 9 LEU A 10 ? ? 64.90 112.38 86 9 HIS A 11 ? ? 63.66 102.73 87 9 CYS A 12 ? ? -147.89 44.44 88 9 ASN A 15 ? ? -174.71 -166.58 89 9 LEU A 17 ? ? -57.73 174.37 90 9 ALA A 32 ? ? -74.69 -169.00 91 9 SER A 51 ? ? 177.26 -173.26 92 10 ASN A 6 ? ? -157.11 23.02 93 10 CYS A 12 ? ? 51.86 -168.28 94 10 ASP A 13 ? ? 77.98 -43.88 95 10 ASN A 15 ? ? -127.71 -70.85 96 10 PHE A 16 ? ? -179.34 114.33 97 10 ALA A 32 ? ? -69.59 -168.81 98 10 SER A 51 ? ? 176.53 -175.31 99 10 VAL A 72 ? ? 36.37 45.06 100 11 GLN A 5 ? ? -174.88 -38.45 101 11 ASN A 6 ? ? -144.12 25.84 102 11 LEU A 8 ? ? -124.55 -74.44 103 11 VAL A 9 ? ? -177.46 127.52 104 11 LEU A 10 ? ? 59.17 93.28 105 11 HIS A 11 ? ? -174.27 101.00 106 11 ASP A 13 ? ? -93.49 41.02 107 11 ALA A 14 ? ? -65.31 88.59 108 11 ASN A 15 ? ? -175.22 -167.74 109 11 ALA A 32 ? ? -70.90 -169.00 110 11 SER A 51 ? ? 175.92 -172.75 111 12 ASN A 6 ? ? -158.71 24.03 112 12 LEU A 10 ? ? -72.49 -74.62 113 12 HIS A 11 ? ? 51.95 78.13 114 12 CYS A 12 ? ? -51.00 103.84 115 12 ALA A 14 ? ? 51.78 82.94 116 12 ASN A 15 ? ? -170.81 -169.79 117 12 ALA A 32 ? ? -63.38 -169.80 118 12 SER A 51 ? ? 175.26 -173.45 119 12 GLU A 70 ? ? -89.10 49.41 120 12 VAL A 72 ? ? 47.91 83.97 121 13 CYS A 2 ? ? -160.49 28.50 122 13 ASN A 6 ? ? -160.51 25.23 123 13 VAL A 9 ? ? 62.48 101.34 124 13 HIS A 11 ? ? -176.33 49.29 125 13 CYS A 12 ? ? -69.93 85.59 126 13 ASN A 15 ? ? -119.85 -169.75 127 13 ALA A 32 ? ? -57.41 -176.31 128 13 SER A 51 ? ? 175.81 -171.32 129 13 HIS A 71 ? ? 37.86 45.12 130 14 GLN A 5 ? ? -158.60 23.99 131 14 ASN A 6 ? ? -179.48 -34.43 132 14 VAL A 9 ? ? 61.37 101.26 133 14 LEU A 10 ? ? 61.30 97.81 134 14 CYS A 12 ? ? -51.41 104.89 135 14 ASN A 15 ? ? 45.03 75.74 136 14 PHE A 16 ? ? -174.61 30.16 137 14 ALA A 32 ? ? -60.95 -169.64 138 14 SER A 51 ? ? 171.59 -174.70 139 14 VAL A 66 ? ? -140.90 19.96 140 14 HIS A 71 ? ? 38.15 42.94 141 15 CYS A 2 ? ? 58.86 91.90 142 15 LEU A 8 ? ? 62.86 89.76 143 15 LEU A 10 ? ? 51.94 88.01 144 15 LEU A 17 ? ? -57.94 -175.37 145 15 ALA A 32 ? ? -57.71 -175.49 146 15 SER A 51 ? ? 175.04 -169.10 147 16 GLN A 5 ? ? -158.55 23.91 148 16 ASN A 6 ? ? -179.65 -34.37 149 16 LEU A 10 ? ? 62.54 93.75 150 16 ASP A 13 ? ? -94.51 38.15 151 16 ASN A 15 ? ? -156.19 -76.72 152 16 PHE A 16 ? ? 179.09 52.93 153 16 ALA A 32 ? ? -77.03 -168.34 154 16 SER A 51 ? ? 172.56 -168.34 155 16 VAL A 72 ? ? -172.88 120.79 156 17 ASN A 6 ? ? -173.99 -41.87 157 17 LEU A 8 ? ? 69.14 -74.79 158 17 LEU A 10 ? ? 56.76 93.78 159 17 HIS A 11 ? ? -60.61 -74.03 160 17 CYS A 12 ? ? 52.15 87.03 161 17 ALA A 14 ? ? 51.72 79.00 162 17 ASN A 15 ? ? -169.60 -169.34 163 17 SER A 51 ? ? 175.79 -169.94 164 18 GLN A 5 ? ? -177.85 -35.60 165 18 LEU A 8 ? ? 52.34 74.54 166 18 HIS A 11 ? ? 62.77 98.93 167 18 CYS A 12 ? ? -92.80 51.37 168 18 ASP A 13 ? ? -95.57 35.99 169 18 ASN A 15 ? ? -113.00 -74.58 170 18 PHE A 16 ? ? -179.36 113.40 171 18 ALA A 32 ? ? -57.71 -175.88 172 18 SER A 51 ? ? 174.59 -173.10 173 18 HIS A 71 ? ? -155.10 21.77 174 18 VAL A 72 ? ? -105.43 75.04 175 19 CYS A 2 ? ? -170.15 30.30 176 19 GLN A 5 ? ? -179.23 -35.04 177 19 ASN A 6 ? ? -158.56 24.03 178 19 VAL A 9 ? ? 65.31 113.94 179 19 HIS A 11 ? ? 64.10 101.59 180 19 ASP A 13 ? ? -98.93 36.25 181 19 ASN A 15 ? ? 69.42 -75.68 182 19 PHE A 16 ? ? -179.24 45.63 183 19 LEU A 17 ? ? -57.89 174.09 184 19 SER A 51 ? ? 176.75 -174.62 185 20 ASN A 6 ? ? -157.58 23.51 186 20 CYS A 12 ? ? 32.75 50.22 187 20 ALA A 14 ? ? 52.51 71.89 188 20 ASN A 15 ? ? -177.52 -169.87 189 20 SER A 51 ? ? 174.89 -167.87 # _pdbx_nmr_ensemble.entry_id 9BD0 _pdbx_nmr_ensemble.conformers_calculated_total_number 300 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9BD0 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM [U-100% 13C; U-100% 15N] SPIN-CYS, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' _pdbx_nmr_sample_details.label SPIN-CYS_15N_13C _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details '1 mM SPIN-CYS in 50 mM sodium phosphate, 50 mM NaCl, 5 % (v/v) D2O (pH: 6.5)' # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component SPIN-CYS _pdbx_nmr_exptl_sample.concentration 1 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-100% 13C; U-100% 15N]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.details '1 mM SPIN-CYS in 50 mM sodium phosphate, 50 mM NaCl, 5 % (v/v) D2O (pH: 6.5)' _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label 1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D Dispi-TOCSY' 1 isotropic 3 1 1 '3D C(CO)NH' 1 isotropic 4 1 1 '3D H(CCO)NH' 1 isotropic 5 1 1 '3D HNCA' 1 isotropic 10 1 1 '3D HNCACB' 1 isotropic 9 1 1 '3D HN(CO)CA' 1 isotropic 8 1 1 '3D HNCO' 1 isotropic 7 1 1 '3D 1H-15N NOESY' 1 isotropic # _pdbx_nmr_refine.entry_id 9BD0 _pdbx_nmr_refine.method 'distance geometry' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 4 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin 4.1 'Bruker Biospin' 2 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 3 'chemical shift assignment' CARA 1.9.1 'Keller and Wuthrich' 4 refinement CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' 5 'structure calculation' CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' 6 'peak picking' CARA 1.9.1 'Keller and Wuthrich' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -4 ? A GLY 1 2 1 Y 1 A SER -3 ? A SER 2 3 1 Y 1 A THR -2 ? A THR 3 4 1 Y 1 A GLY -1 ? A GLY 4 5 1 Y 1 A SER 0 ? A SER 5 6 2 Y 1 A GLY -4 ? A GLY 1 7 2 Y 1 A SER -3 ? A SER 2 8 2 Y 1 A THR -2 ? A THR 3 9 2 Y 1 A GLY -1 ? A GLY 4 10 2 Y 1 A SER 0 ? A SER 5 11 3 Y 1 A GLY -4 ? A GLY 1 12 3 Y 1 A SER -3 ? A SER 2 13 3 Y 1 A THR -2 ? A THR 3 14 3 Y 1 A GLY -1 ? A GLY 4 15 3 Y 1 A SER 0 ? A SER 5 16 4 Y 1 A GLY -4 ? A GLY 1 17 4 Y 1 A SER -3 ? A SER 2 18 4 Y 1 A THR -2 ? A THR 3 19 4 Y 1 A GLY -1 ? A GLY 4 20 4 Y 1 A SER 0 ? A SER 5 21 5 Y 1 A GLY -4 ? A GLY 1 22 5 Y 1 A SER -3 ? A SER 2 23 5 Y 1 A THR -2 ? A THR 3 24 5 Y 1 A GLY -1 ? A GLY 4 25 5 Y 1 A SER 0 ? A SER 5 26 6 Y 1 A GLY -4 ? A GLY 1 27 6 Y 1 A SER -3 ? A SER 2 28 6 Y 1 A THR -2 ? A THR 3 29 6 Y 1 A GLY -1 ? A GLY 4 30 6 Y 1 A SER 0 ? A SER 5 31 7 Y 1 A GLY -4 ? A GLY 1 32 7 Y 1 A SER -3 ? A SER 2 33 7 Y 1 A THR -2 ? A THR 3 34 7 Y 1 A GLY -1 ? A GLY 4 35 7 Y 1 A SER 0 ? A SER 5 36 8 Y 1 A GLY -4 ? A GLY 1 37 8 Y 1 A SER -3 ? A SER 2 38 8 Y 1 A THR -2 ? A THR 3 39 8 Y 1 A GLY -1 ? A GLY 4 40 8 Y 1 A SER 0 ? A SER 5 41 9 Y 1 A GLY -4 ? A GLY 1 42 9 Y 1 A SER -3 ? A SER 2 43 9 Y 1 A THR -2 ? A THR 3 44 9 Y 1 A GLY -1 ? A GLY 4 45 9 Y 1 A SER 0 ? A SER 5 46 10 Y 1 A GLY -4 ? A GLY 1 47 10 Y 1 A SER -3 ? A SER 2 48 10 Y 1 A THR -2 ? A THR 3 49 10 Y 1 A GLY -1 ? A GLY 4 50 10 Y 1 A SER 0 ? A SER 5 51 11 Y 1 A GLY -4 ? A GLY 1 52 11 Y 1 A SER -3 ? A SER 2 53 11 Y 1 A THR -2 ? A THR 3 54 11 Y 1 A GLY -1 ? A GLY 4 55 11 Y 1 A SER 0 ? A SER 5 56 12 Y 1 A GLY -4 ? A GLY 1 57 12 Y 1 A SER -3 ? A SER 2 58 12 Y 1 A THR -2 ? A THR 3 59 12 Y 1 A GLY -1 ? A GLY 4 60 12 Y 1 A SER 0 ? A SER 5 61 13 Y 1 A GLY -4 ? A GLY 1 62 13 Y 1 A SER -3 ? A SER 2 63 13 Y 1 A THR -2 ? A THR 3 64 13 Y 1 A GLY -1 ? A GLY 4 65 13 Y 1 A SER 0 ? A SER 5 66 14 Y 1 A GLY -4 ? A GLY 1 67 14 Y 1 A SER -3 ? A SER 2 68 14 Y 1 A THR -2 ? A THR 3 69 14 Y 1 A GLY -1 ? A GLY 4 70 14 Y 1 A SER 0 ? A SER 5 71 15 Y 1 A GLY -4 ? A GLY 1 72 15 Y 1 A SER -3 ? A SER 2 73 15 Y 1 A THR -2 ? A THR 3 74 15 Y 1 A GLY -1 ? A GLY 4 75 15 Y 1 A SER 0 ? A SER 5 76 16 Y 1 A GLY -4 ? A GLY 1 77 16 Y 1 A SER -3 ? A SER 2 78 16 Y 1 A THR -2 ? A THR 3 79 16 Y 1 A GLY -1 ? A GLY 4 80 16 Y 1 A SER 0 ? A SER 5 81 17 Y 1 A GLY -4 ? A GLY 1 82 17 Y 1 A SER -3 ? A SER 2 83 17 Y 1 A THR -2 ? A THR 3 84 17 Y 1 A GLY -1 ? A GLY 4 85 17 Y 1 A SER 0 ? A SER 5 86 18 Y 1 A GLY -4 ? A GLY 1 87 18 Y 1 A SER -3 ? A SER 2 88 18 Y 1 A THR -2 ? A THR 3 89 18 Y 1 A GLY -1 ? A GLY 4 90 18 Y 1 A SER 0 ? A SER 5 91 19 Y 1 A GLY -4 ? A GLY 1 92 19 Y 1 A SER -3 ? A SER 2 93 19 Y 1 A THR -2 ? A THR 3 94 19 Y 1 A GLY -1 ? A GLY 4 95 19 Y 1 A SER 0 ? A SER 5 96 20 Y 1 A GLY -4 ? A GLY 1 97 20 Y 1 A SER -3 ? A SER 2 98 20 Y 1 A THR -2 ? A THR 3 99 20 Y 1 A GLY -1 ? A GLY 4 100 20 Y 1 A SER 0 ? A SER 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 PHE N N N N 227 PHE CA C N S 228 PHE C C N N 229 PHE O O N N 230 PHE CB C N N 231 PHE CG C Y N 232 PHE CD1 C Y N 233 PHE CD2 C Y N 234 PHE CE1 C Y N 235 PHE CE2 C Y N 236 PHE CZ C Y N 237 PHE OXT O N N 238 PHE H H N N 239 PHE H2 H N N 240 PHE HA H N N 241 PHE HB2 H N N 242 PHE HB3 H N N 243 PHE HD1 H N N 244 PHE HD2 H N N 245 PHE HE1 H N N 246 PHE HE2 H N N 247 PHE HZ H N N 248 PHE HXT H N N 249 SER N N N N 250 SER CA C N S 251 SER C C N N 252 SER O O N N 253 SER CB C N N 254 SER OG O N N 255 SER OXT O N N 256 SER H H N N 257 SER H2 H N N 258 SER HA H N N 259 SER HB2 H N N 260 SER HB3 H N N 261 SER HG H N N 262 SER HXT H N N 263 THR N N N N 264 THR CA C N S 265 THR C C N N 266 THR O O N N 267 THR CB C N R 268 THR OG1 O N N 269 THR CG2 C N N 270 THR OXT O N N 271 THR H H N N 272 THR H2 H N N 273 THR HA H N N 274 THR HB H N N 275 THR HG1 H N N 276 THR HG21 H N N 277 THR HG22 H N N 278 THR HG23 H N N 279 THR HXT H N N 280 TYR N N N N 281 TYR CA C N S 282 TYR C C N N 283 TYR O O N N 284 TYR CB C N N 285 TYR CG C Y N 286 TYR CD1 C Y N 287 TYR CD2 C Y N 288 TYR CE1 C Y N 289 TYR CE2 C Y N 290 TYR CZ C Y N 291 TYR OH O N N 292 TYR OXT O N N 293 TYR H H N N 294 TYR H2 H N N 295 TYR HA H N N 296 TYR HB2 H N N 297 TYR HB3 H N N 298 TYR HD1 H N N 299 TYR HD2 H N N 300 TYR HE1 H N N 301 TYR HE2 H N N 302 TYR HH H N N 303 TYR HXT H N N 304 VAL N N N N 305 VAL CA C N S 306 VAL C C N N 307 VAL O O N N 308 VAL CB C N N 309 VAL CG1 C N N 310 VAL CG2 C N N 311 VAL OXT O N N 312 VAL H H N N 313 VAL H2 H N N 314 VAL HA H N N 315 VAL HB H N N 316 VAL HG11 H N N 317 VAL HG12 H N N 318 VAL HG13 H N N 319 VAL HG21 H N N 320 VAL HG22 H N N 321 VAL HG23 H N N 322 VAL HXT H N N 323 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 PHE N CA sing N N 216 PHE N H sing N N 217 PHE N H2 sing N N 218 PHE CA C sing N N 219 PHE CA CB sing N N 220 PHE CA HA sing N N 221 PHE C O doub N N 222 PHE C OXT sing N N 223 PHE CB CG sing N N 224 PHE CB HB2 sing N N 225 PHE CB HB3 sing N N 226 PHE CG CD1 doub Y N 227 PHE CG CD2 sing Y N 228 PHE CD1 CE1 sing Y N 229 PHE CD1 HD1 sing N N 230 PHE CD2 CE2 doub Y N 231 PHE CD2 HD2 sing N N 232 PHE CE1 CZ doub Y N 233 PHE CE1 HE1 sing N N 234 PHE CE2 CZ sing Y N 235 PHE CE2 HE2 sing N N 236 PHE CZ HZ sing N N 237 PHE OXT HXT sing N N 238 SER N CA sing N N 239 SER N H sing N N 240 SER N H2 sing N N 241 SER CA C sing N N 242 SER CA CB sing N N 243 SER CA HA sing N N 244 SER C O doub N N 245 SER C OXT sing N N 246 SER CB OG sing N N 247 SER CB HB2 sing N N 248 SER CB HB3 sing N N 249 SER OG HG sing N N 250 SER OXT HXT sing N N 251 THR N CA sing N N 252 THR N H sing N N 253 THR N H2 sing N N 254 THR CA C sing N N 255 THR CA CB sing N N 256 THR CA HA sing N N 257 THR C O doub N N 258 THR C OXT sing N N 259 THR CB OG1 sing N N 260 THR CB CG2 sing N N 261 THR CB HB sing N N 262 THR OG1 HG1 sing N N 263 THR CG2 HG21 sing N N 264 THR CG2 HG22 sing N N 265 THR CG2 HG23 sing N N 266 THR OXT HXT sing N N 267 TYR N CA sing N N 268 TYR N H sing N N 269 TYR N H2 sing N N 270 TYR CA C sing N N 271 TYR CA CB sing N N 272 TYR CA HA sing N N 273 TYR C O doub N N 274 TYR C OXT sing N N 275 TYR CB CG sing N N 276 TYR CB HB2 sing N N 277 TYR CB HB3 sing N N 278 TYR CG CD1 doub Y N 279 TYR CG CD2 sing Y N 280 TYR CD1 CE1 sing Y N 281 TYR CD1 HD1 sing N N 282 TYR CD2 CE2 doub Y N 283 TYR CD2 HD2 sing N N 284 TYR CE1 CZ doub Y N 285 TYR CE1 HE1 sing N N 286 TYR CE2 CZ sing Y N 287 TYR CE2 HE2 sing N N 288 TYR CZ OH sing N N 289 TYR OH HH sing N N 290 TYR OXT HXT sing N N 291 VAL N CA sing N N 292 VAL N H sing N N 293 VAL N H2 sing N N 294 VAL CA C sing N N 295 VAL CA CB sing N N 296 VAL CA HA sing N N 297 VAL C O doub N N 298 VAL C OXT sing N N 299 VAL CB CG1 sing N N 300 VAL CB CG2 sing N N 301 VAL CB HB sing N N 302 VAL CG1 HG11 sing N N 303 VAL CG1 HG12 sing N N 304 VAL CG1 HG13 sing N N 305 VAL CG2 HG21 sing N N 306 VAL CG2 HG22 sing N N 307 VAL CG2 HG23 sing N N 308 VAL OXT HXT sing N N 309 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number R35GM140852 _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE NEO' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 9BD0 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_