data_9C7Z # _entry.id 9C7Z # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.408 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9C7Z pdb_00009c7z 10.2210/pdb9c7z/pdb WWPDB D_1000283977 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-05-21 ? 2 'Structure model' 1 1 2025-12-10 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9C7Z _pdbx_database_status.recvd_initial_deposition_date 2024-06-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email dabaker@uw.edu _pdbx_contact_author.name_first David _pdbx_contact_author.name_last Baker _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7896-6217 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ragotte, R.' 1 0000-0002-6463-1595 'Bera, A.' 2 0000-0001-9473-2912 'Milles, L.F.' 3 0000-0001-8417-3205 'Wicky, B.I.M.' 4 0000-0002-2501-7875 'Baker, D.' 5 0000-0001-7896-6217 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Cell Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2211-1247 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 44 _citation.language ? _citation.page_first 115760 _citation.page_last 115760 _citation.title 'Designed miniproteins potently inhibit and protect against MERS-CoV.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.celrep.2025.115760 _citation.pdbx_database_id_PubMed 40450691 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ragotte, R.J.' 1 ? primary 'Tortorici, M.A.' 2 ? primary 'Catanzaro, N.J.' 3 ? primary 'Addetia, A.' 4 ? primary 'Coventry, B.' 5 ? primary 'Froggatt, H.M.' 6 ? primary 'Lee, J.' 7 ? primary 'Stewart, C.' 8 ? primary 'Brown, J.T.' 9 ? primary 'Goreshnik, I.' 10 ? primary 'Sims, J.N.' 11 ? primary 'Milles, L.F.' 12 ? primary 'Wicky, B.I.M.' 13 ? primary 'Glogl, M.' 14 ? primary 'Gerben, S.' 15 ? primary 'Kang, A.' 16 ? primary 'Bera, A.K.' 17 ? primary 'Sharkey, W.' 18 ? primary 'Schafer, A.' 19 ? primary 'Harkema, J.R.' 20 ? primary 'Baric, R.S.' 21 ? primary 'Baker, D.' 22 ? primary 'Veesler, D.' 23 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man HALC3_919 8078.268 2 ? ? ? ? 2 non-polymer syn 'TETRAETHYLENE GLYCOL' 194.226 1 ? ? ? ? 3 water nat water 18.015 23 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MSGSEELLEELRELLERLQELLELIEQGKITPEQLREAIALLIEVLQILYEALRELAEQLQRLREELGS _entity_poly.pdbx_seq_one_letter_code_can MSGSEELLEELRELLERLQELLELIEQGKITPEQLREAIALLIEVLQILYEALRELAEQLQRLREELGS _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'TETRAETHYLENE GLYCOL' PG4 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLY n 1 4 SER n 1 5 GLU n 1 6 GLU n 1 7 LEU n 1 8 LEU n 1 9 GLU n 1 10 GLU n 1 11 LEU n 1 12 ARG n 1 13 GLU n 1 14 LEU n 1 15 LEU n 1 16 GLU n 1 17 ARG n 1 18 LEU n 1 19 GLN n 1 20 GLU n 1 21 LEU n 1 22 LEU n 1 23 GLU n 1 24 LEU n 1 25 ILE n 1 26 GLU n 1 27 GLN n 1 28 GLY n 1 29 LYS n 1 30 ILE n 1 31 THR n 1 32 PRO n 1 33 GLU n 1 34 GLN n 1 35 LEU n 1 36 ARG n 1 37 GLU n 1 38 ALA n 1 39 ILE n 1 40 ALA n 1 41 LEU n 1 42 LEU n 1 43 ILE n 1 44 GLU n 1 45 VAL n 1 46 LEU n 1 47 GLN n 1 48 ILE n 1 49 LEU n 1 50 TYR n 1 51 GLU n 1 52 ALA n 1 53 LEU n 1 54 ARG n 1 55 GLU n 1 56 LEU n 1 57 ALA n 1 58 GLU n 1 59 GLN n 1 60 LEU n 1 61 GLN n 1 62 ARG n 1 63 LEU n 1 64 ARG n 1 65 GLU n 1 66 GLU n 1 67 LEU n 1 68 GLY n 1 69 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 69 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PG4 non-polymer . 'TETRAETHYLENE GLYCOL' ? 'C8 H18 O5' 194.226 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 ILE 48 48 48 ILE ILE A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 GLY 68 68 ? ? ? A . n A 1 69 SER 69 69 ? ? ? A . n B 1 1 MET 1 1 ? ? ? B . n B 1 2 SER 2 2 ? ? ? B . n B 1 3 GLY 3 3 ? ? ? B . n B 1 4 SER 4 4 4 SER SER B . n B 1 5 GLU 5 5 5 GLU GLU B . n B 1 6 GLU 6 6 6 GLU GLU B . n B 1 7 LEU 7 7 7 LEU LEU B . n B 1 8 LEU 8 8 8 LEU LEU B . n B 1 9 GLU 9 9 9 GLU GLU B . n B 1 10 GLU 10 10 10 GLU GLU B . n B 1 11 LEU 11 11 11 LEU LEU B . n B 1 12 ARG 12 12 12 ARG ARG B . n B 1 13 GLU 13 13 13 GLU GLU B . n B 1 14 LEU 14 14 14 LEU LEU B . n B 1 15 LEU 15 15 15 LEU LEU B . n B 1 16 GLU 16 16 16 GLU GLU B . n B 1 17 ARG 17 17 17 ARG ARG B . n B 1 18 LEU 18 18 18 LEU LEU B . n B 1 19 GLN 19 19 19 GLN GLN B . n B 1 20 GLU 20 20 20 GLU GLU B . n B 1 21 LEU 21 21 21 LEU LEU B . n B 1 22 LEU 22 22 22 LEU LEU B . n B 1 23 GLU 23 23 23 GLU GLU B . n B 1 24 LEU 24 24 24 LEU LEU B . n B 1 25 ILE 25 25 25 ILE ILE B . n B 1 26 GLU 26 26 26 GLU GLU B . n B 1 27 GLN 27 27 27 GLN GLN B . n B 1 28 GLY 28 28 28 GLY GLY B . n B 1 29 LYS 29 29 29 LYS LYS B . n B 1 30 ILE 30 30 30 ILE ILE B . n B 1 31 THR 31 31 31 THR THR B . n B 1 32 PRO 32 32 32 PRO PRO B . n B 1 33 GLU 33 33 33 GLU GLU B . n B 1 34 GLN 34 34 34 GLN GLN B . n B 1 35 LEU 35 35 35 LEU LEU B . n B 1 36 ARG 36 36 36 ARG ARG B . n B 1 37 GLU 37 37 37 GLU GLU B . n B 1 38 ALA 38 38 38 ALA ALA B . n B 1 39 ILE 39 39 39 ILE ILE B . n B 1 40 ALA 40 40 40 ALA ALA B . n B 1 41 LEU 41 41 41 LEU LEU B . n B 1 42 LEU 42 42 42 LEU LEU B . n B 1 43 ILE 43 43 43 ILE ILE B . n B 1 44 GLU 44 44 44 GLU GLU B . n B 1 45 VAL 45 45 45 VAL VAL B . n B 1 46 LEU 46 46 46 LEU LEU B . n B 1 47 GLN 47 47 47 GLN GLN B . n B 1 48 ILE 48 48 48 ILE ILE B . n B 1 49 LEU 49 49 49 LEU LEU B . n B 1 50 TYR 50 50 50 TYR TYR B . n B 1 51 GLU 51 51 51 GLU GLU B . n B 1 52 ALA 52 52 52 ALA ALA B . n B 1 53 LEU 53 53 53 LEU LEU B . n B 1 54 ARG 54 54 54 ARG ARG B . n B 1 55 GLU 55 55 55 GLU GLU B . n B 1 56 LEU 56 56 56 LEU LEU B . n B 1 57 ALA 57 57 57 ALA ALA B . n B 1 58 GLU 58 58 58 GLU GLU B . n B 1 59 GLN 59 59 59 GLN GLN B . n B 1 60 LEU 60 60 60 LEU LEU B . n B 1 61 GLN 61 61 61 GLN GLN B . n B 1 62 ARG 62 62 62 ARG ARG B . n B 1 63 LEU 63 63 63 LEU LEU B . n B 1 64 ARG 64 64 64 ARG ARG B . n B 1 65 GLU 65 65 65 GLU GLU B . n B 1 66 GLU 66 66 66 GLU GLU B . n B 1 67 LEU 67 67 67 LEU LEU B . n B 1 68 GLY 68 68 68 GLY GLY B . n B 1 69 SER 69 69 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 PG4 1 101 104 PG4 PG4 A . D 3 HOH 1 201 41 HOH HOH A . D 3 HOH 2 202 93 HOH HOH A . D 3 HOH 3 203 9 HOH HOH A . D 3 HOH 4 204 10 HOH HOH A . D 3 HOH 5 205 94 HOH HOH A . D 3 HOH 6 206 82 HOH HOH A . D 3 HOH 7 207 15 HOH HOH A . D 3 HOH 8 208 2 HOH HOH A . D 3 HOH 9 209 18 HOH HOH A . D 3 HOH 10 210 13 HOH HOH A . D 3 HOH 11 211 16 HOH HOH A . D 3 HOH 12 212 19 HOH HOH A . D 3 HOH 13 213 14 HOH HOH A . E 3 HOH 1 101 20 HOH HOH B . E 3 HOH 2 102 79 HOH HOH B . E 3 HOH 3 103 45 HOH HOH B . E 3 HOH 4 104 5 HOH HOH B . E 3 HOH 5 105 96 HOH HOH B . E 3 HOH 6 106 17 HOH HOH B . E 3 HOH 7 107 21 HOH HOH B . E 3 HOH 8 108 8 HOH HOH B . E 3 HOH 9 109 3 HOH HOH B . E 3 HOH 10 110 95 HOH HOH B . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 5 ? CG ? A GLU 5 CG 2 1 Y 1 A GLU 5 ? CD ? A GLU 5 CD 3 1 Y 1 A GLU 5 ? OE1 ? A GLU 5 OE1 4 1 Y 1 A GLU 5 ? OE2 ? A GLU 5 OE2 5 1 Y 1 A GLU 6 ? CG ? A GLU 6 CG 6 1 Y 1 A GLU 6 ? CD ? A GLU 6 CD 7 1 Y 1 A GLU 6 ? OE1 ? A GLU 6 OE1 8 1 Y 1 A GLU 6 ? OE2 ? A GLU 6 OE2 9 1 Y 1 A GLU 9 ? CG ? A GLU 9 CG 10 1 Y 1 A GLU 9 ? CD ? A GLU 9 CD 11 1 Y 1 A GLU 9 ? OE1 ? A GLU 9 OE1 12 1 Y 1 A GLU 9 ? OE2 ? A GLU 9 OE2 13 1 Y 1 A GLU 10 ? CG ? A GLU 10 CG 14 1 Y 1 A GLU 10 ? CD ? A GLU 10 CD 15 1 Y 1 A GLU 10 ? OE1 ? A GLU 10 OE1 16 1 Y 1 A GLU 10 ? OE2 ? A GLU 10 OE2 17 1 Y 1 A ARG 12 ? NE ? A ARG 12 NE 18 1 Y 1 A ARG 12 ? CZ ? A ARG 12 CZ 19 1 Y 1 A ARG 12 ? NH1 ? A ARG 12 NH1 20 1 Y 1 A ARG 12 ? NH2 ? A ARG 12 NH2 21 1 Y 1 A GLU 16 ? CD ? A GLU 16 CD 22 1 Y 1 A GLU 16 ? OE1 ? A GLU 16 OE1 23 1 Y 1 A GLU 16 ? OE2 ? A GLU 16 OE2 24 1 Y 1 A LYS 29 ? CE ? A LYS 29 CE 25 1 Y 1 A LYS 29 ? NZ ? A LYS 29 NZ 26 1 Y 1 A LEU 49 ? CG ? A LEU 49 CG 27 1 Y 1 A LEU 49 ? CD1 ? A LEU 49 CD1 28 1 Y 1 A LEU 49 ? CD2 ? A LEU 49 CD2 29 1 Y 1 A GLU 51 ? CG ? A GLU 51 CG 30 1 Y 1 A GLU 51 ? CD ? A GLU 51 CD 31 1 Y 1 A GLU 51 ? OE1 ? A GLU 51 OE1 32 1 Y 1 A GLU 51 ? OE2 ? A GLU 51 OE2 33 1 Y 1 A GLU 58 ? CD ? A GLU 58 CD 34 1 Y 1 A GLU 58 ? OE1 ? A GLU 58 OE1 35 1 Y 1 A GLU 58 ? OE2 ? A GLU 58 OE2 36 1 Y 1 A LEU 60 ? CG ? A LEU 60 CG 37 1 Y 1 A LEU 60 ? CD1 ? A LEU 60 CD1 38 1 Y 1 A LEU 60 ? CD2 ? A LEU 60 CD2 39 1 Y 1 A ARG 62 ? CG ? A ARG 62 CG 40 1 Y 1 A ARG 62 ? CD ? A ARG 62 CD 41 1 Y 1 A ARG 62 ? NE ? A ARG 62 NE 42 1 Y 1 A ARG 62 ? CZ ? A ARG 62 CZ 43 1 Y 1 A ARG 62 ? NH1 ? A ARG 62 NH1 44 1 Y 1 A ARG 62 ? NH2 ? A ARG 62 NH2 45 1 Y 1 A GLU 65 ? CG ? A GLU 65 CG 46 1 Y 1 A GLU 65 ? CD ? A GLU 65 CD 47 1 Y 1 A GLU 65 ? OE1 ? A GLU 65 OE1 48 1 Y 1 A GLU 65 ? OE2 ? A GLU 65 OE2 49 1 Y 1 A GLU 66 ? CG ? A GLU 66 CG 50 1 Y 1 A GLU 66 ? CD ? A GLU 66 CD 51 1 Y 1 A GLU 66 ? OE1 ? A GLU 66 OE1 52 1 Y 1 A GLU 66 ? OE2 ? A GLU 66 OE2 53 1 Y 1 A LEU 67 ? CG ? A LEU 67 CG 54 1 Y 1 A LEU 67 ? CD1 ? A LEU 67 CD1 55 1 Y 1 A LEU 67 ? CD2 ? A LEU 67 CD2 56 1 Y 1 B GLU 5 ? CG ? B GLU 5 CG 57 1 Y 1 B GLU 5 ? CD ? B GLU 5 CD 58 1 Y 1 B GLU 5 ? OE1 ? B GLU 5 OE1 59 1 Y 1 B GLU 5 ? OE2 ? B GLU 5 OE2 60 1 Y 1 B GLU 6 ? CG ? B GLU 6 CG 61 1 Y 1 B GLU 6 ? CD ? B GLU 6 CD 62 1 Y 1 B GLU 6 ? OE1 ? B GLU 6 OE1 63 1 Y 1 B GLU 6 ? OE2 ? B GLU 6 OE2 64 1 Y 1 B GLU 10 ? CG ? B GLU 10 CG 65 1 Y 1 B GLU 10 ? CD ? B GLU 10 CD 66 1 Y 1 B GLU 10 ? OE1 ? B GLU 10 OE1 67 1 Y 1 B GLU 10 ? OE2 ? B GLU 10 OE2 68 1 Y 1 B ARG 12 ? CD ? B ARG 12 CD 69 1 Y 1 B ARG 12 ? NE ? B ARG 12 NE 70 1 Y 1 B ARG 12 ? CZ ? B ARG 12 CZ 71 1 Y 1 B ARG 12 ? NH1 ? B ARG 12 NH1 72 1 Y 1 B ARG 12 ? NH2 ? B ARG 12 NH2 73 1 Y 1 B GLU 13 ? CG ? B GLU 13 CG 74 1 Y 1 B GLU 13 ? CD ? B GLU 13 CD 75 1 Y 1 B GLU 13 ? OE1 ? B GLU 13 OE1 76 1 Y 1 B GLU 13 ? OE2 ? B GLU 13 OE2 77 1 Y 1 B LYS 29 ? CD ? B LYS 29 CD 78 1 Y 1 B LYS 29 ? CE ? B LYS 29 CE 79 1 Y 1 B LYS 29 ? NZ ? B LYS 29 NZ 80 1 Y 1 B GLU 51 ? CG ? B GLU 51 CG 81 1 Y 1 B GLU 51 ? CD ? B GLU 51 CD 82 1 Y 1 B GLU 51 ? OE1 ? B GLU 51 OE1 83 1 Y 1 B GLU 51 ? OE2 ? B GLU 51 OE2 84 1 Y 1 B GLU 58 ? CG ? B GLU 58 CG 85 1 Y 1 B GLU 58 ? CD ? B GLU 58 CD 86 1 Y 1 B GLU 58 ? OE1 ? B GLU 58 OE1 87 1 Y 1 B GLU 58 ? OE2 ? B GLU 58 OE2 88 1 Y 1 B ARG 62 ? CG ? B ARG 62 CG 89 1 Y 1 B ARG 62 ? CD ? B ARG 62 CD 90 1 Y 1 B ARG 62 ? NE ? B ARG 62 NE 91 1 Y 1 B ARG 62 ? CZ ? B ARG 62 CZ 92 1 Y 1 B ARG 62 ? NH1 ? B ARG 62 NH1 93 1 Y 1 B ARG 62 ? NH2 ? B ARG 62 NH2 94 1 Y 1 B ARG 64 ? NE ? B ARG 64 NE 95 1 Y 1 B ARG 64 ? CZ ? B ARG 64 CZ 96 1 Y 1 B ARG 64 ? NH1 ? B ARG 64 NH1 97 1 Y 1 B ARG 64 ? NH2 ? B ARG 64 NH2 98 1 Y 1 B GLU 65 ? CG ? B GLU 65 CG 99 1 Y 1 B GLU 65 ? CD ? B GLU 65 CD 100 1 Y 1 B GLU 65 ? OE1 ? B GLU 65 OE1 101 1 Y 1 B GLU 65 ? OE2 ? B GLU 65 OE2 102 1 N 1 A PG4 101 ? C6 ? C PG4 1 C6 103 1 N 1 A PG4 101 ? O4 ? C PG4 1 O4 104 1 N 1 A PG4 101 ? C7 ? C PG4 1 C7 105 1 N 1 A PG4 101 ? C8 ? C PG4 1 C8 106 1 N 1 A PG4 101 ? O5 ? C PG4 1 O5 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21.1_5286 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9C7Z _cell.details ? _cell.formula_units_Z ? _cell.length_a 78.373 _cell.length_a_esd ? _cell.length_b 78.373 _cell.length_b_esd ? _cell.length_c 78.373 _cell.length_c_esd ? _cell.volume 481392.604 _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9C7Z _symmetry.cell_setting ? _symmetry.Int_Tables_number 198 _symmetry.space_group_name_Hall 'P 2ac 2ab 3' _symmetry.space_group_name_H-M 'P 21 3' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9C7Z _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.45 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.76 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.2 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Lithium sulfate monohydrate, 0.1 M Sodium citrate tribasic dihydrate pH 4.2, 20% w/v PEG 1000' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-03-13 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9792 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9792 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 48.68 _reflns.entry_id 9C7Z _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.95 _reflns.d_resolution_low 55.42 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9601 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.89 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.059 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.1 _reflns_shell.d_res_low 2.16 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.1 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1344 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.681 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 99.41 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.988 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 62.77 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9C7Z _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.10 _refine.ls_d_res_low 55.42 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9601 _refine.ls_number_reflns_R_free 974 _refine.ls_number_reflns_R_work 8627 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.89 _refine.ls_percent_reflns_R_free 10.14 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2337 _refine.ls_R_factor_R_free 0.2386 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2332 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.5467 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2226 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.10 _refine_hist.d_res_low 55.42 _refine_hist.number_atoms_solvent 23 _refine_hist.number_atoms_total 1019 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 988 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 8 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0090 ? 997 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.1141 ? 1347 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0460 ? 176 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0065 ? 171 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.6806 ? 379 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.10 2.21 . . 131 1213 99.41 . . . . 0.2704 . . . . . . . . . . . 0.2597 'X-RAY DIFFRACTION' 2.21 2.35 . . 137 1209 100.00 . . . . 0.2405 . . . . . . . . . . . 0.2354 'X-RAY DIFFRACTION' 2.35 2.53 . . 138 1227 100.00 . . . . 0.2345 . . . . . . . . . . . 0.2142 'X-RAY DIFFRACTION' 2.53 2.78 . . 137 1216 99.93 . . . . 0.2622 . . . . . . . . . . . 0.2946 'X-RAY DIFFRACTION' 2.79 3.19 . . 141 1221 99.93 . . . . 0.2831 . . . . . . . . . . . 0.3007 'X-RAY DIFFRACTION' 3.19 4.02 . . 139 1245 100.00 . . . . 0.2328 . . . . . . . . . . . 0.2325 'X-RAY DIFFRACTION' 4.03 55.42 . . 151 1296 99.93 . . . . 0.2108 . . . . . . . . . . . 0.2163 # _struct.entry_id 9C7Z _struct.title 'Hallucinated C3 protein assembly HALC3_919' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9C7Z _struct_keywords.text 'trimer, hallucination, de novo, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 3 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 9C7Z _struct_ref.pdbx_db_accession 9C7Z _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9C7Z A 1 ? 69 ? 9C7Z 1 ? 69 ? 1 69 2 1 9C7Z B 1 ? 69 ? 9C7Z 1 ? 69 ? 1 69 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly PISA trimeric 3 2 author_defined_assembly PISA trimeric 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5900 ? 1 MORE -58 ? 1 'SSA (A^2)' 10420 ? 2 'ABSA (A^2)' 6620 ? 2 MORE -55 ? 2 'SSA (A^2)' 10620 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1,3,5 A,C,D 2 1,2,4 B,E # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 3 'crystal symmetry operation' 7_555 -z+1/2,-x,y+1/2 0.0000000000 0.0000000000 -1.0000000000 39.1865000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 39.1865000000 4 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 5 'crystal symmetry operation' 10_545 -y,z-1/2,-x+1/2 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 -39.1865000000 -1.0000000000 0.0000000000 0.0000000000 39.1865000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 2 ? GLY A 28 ? SER A 2 GLY A 28 1 ? 27 HELX_P HELX_P2 AA2 THR A 31 ? GLU A 65 ? THR A 31 GLU A 65 1 ? 35 HELX_P HELX_P3 AA3 GLU B 5 ? GLN B 27 ? GLU B 5 GLN B 27 1 ? 23 HELX_P HELX_P4 AA4 THR B 31 ? GLY B 68 ? THR B 31 GLY B 68 1 ? 38 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _pdbx_entry_details.entry_id 9C7Z _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification N # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 B _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 108 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 B _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 109 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.13 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 z,x,y 3 y,z,x 4 -y+1/2,-z,x+1/2 5 z+1/2,-x+1/2,-y 6 -y,z+1/2,-x+1/2 7 -z+1/2,-x,y+1/2 8 -z,x+1/2,-y+1/2 9 y+1/2,-z+1/2,-x 10 x+1/2,-y+1/2,-z 11 -x,y+1/2,-z+1/2 12 -x+1/2,-y,z+1/2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 68 ? A GLY 68 3 1 Y 1 A SER 69 ? A SER 69 4 1 Y 1 B MET 1 ? B MET 1 5 1 Y 1 B SER 2 ? B SER 2 6 1 Y 1 B GLY 3 ? B GLY 3 7 1 Y 1 B SER 69 ? B SER 69 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 GLN N N N N 41 GLN CA C N S 42 GLN C C N N 43 GLN O O N N 44 GLN CB C N N 45 GLN CG C N N 46 GLN CD C N N 47 GLN OE1 O N N 48 GLN NE2 N N N 49 GLN OXT O N N 50 GLN H H N N 51 GLN H2 H N N 52 GLN HA H N N 53 GLN HB2 H N N 54 GLN HB3 H N N 55 GLN HG2 H N N 56 GLN HG3 H N N 57 GLN HE21 H N N 58 GLN HE22 H N N 59 GLN HXT H N N 60 GLU N N N N 61 GLU CA C N S 62 GLU C C N N 63 GLU O O N N 64 GLU CB C N N 65 GLU CG C N N 66 GLU CD C N N 67 GLU OE1 O N N 68 GLU OE2 O N N 69 GLU OXT O N N 70 GLU H H N N 71 GLU H2 H N N 72 GLU HA H N N 73 GLU HB2 H N N 74 GLU HB3 H N N 75 GLU HG2 H N N 76 GLU HG3 H N N 77 GLU HE2 H N N 78 GLU HXT H N N 79 GLY N N N N 80 GLY CA C N N 81 GLY C C N N 82 GLY O O N N 83 GLY OXT O N N 84 GLY H H N N 85 GLY H2 H N N 86 GLY HA2 H N N 87 GLY HA3 H N N 88 GLY HXT H N N 89 HOH O O N N 90 HOH H1 H N N 91 HOH H2 H N N 92 ILE N N N N 93 ILE CA C N S 94 ILE C C N N 95 ILE O O N N 96 ILE CB C N S 97 ILE CG1 C N N 98 ILE CG2 C N N 99 ILE CD1 C N N 100 ILE OXT O N N 101 ILE H H N N 102 ILE H2 H N N 103 ILE HA H N N 104 ILE HB H N N 105 ILE HG12 H N N 106 ILE HG13 H N N 107 ILE HG21 H N N 108 ILE HG22 H N N 109 ILE HG23 H N N 110 ILE HD11 H N N 111 ILE HD12 H N N 112 ILE HD13 H N N 113 ILE HXT H N N 114 LEU N N N N 115 LEU CA C N S 116 LEU C C N N 117 LEU O O N N 118 LEU CB C N N 119 LEU CG C N N 120 LEU CD1 C N N 121 LEU CD2 C N N 122 LEU OXT O N N 123 LEU H H N N 124 LEU H2 H N N 125 LEU HA H N N 126 LEU HB2 H N N 127 LEU HB3 H N N 128 LEU HG H N N 129 LEU HD11 H N N 130 LEU HD12 H N N 131 LEU HD13 H N N 132 LEU HD21 H N N 133 LEU HD22 H N N 134 LEU HD23 H N N 135 LEU HXT H N N 136 LYS N N N N 137 LYS CA C N S 138 LYS C C N N 139 LYS O O N N 140 LYS CB C N N 141 LYS CG C N N 142 LYS CD C N N 143 LYS CE C N N 144 LYS NZ N N N 145 LYS OXT O N N 146 LYS H H N N 147 LYS H2 H N N 148 LYS HA H N N 149 LYS HB2 H N N 150 LYS HB3 H N N 151 LYS HG2 H N N 152 LYS HG3 H N N 153 LYS HD2 H N N 154 LYS HD3 H N N 155 LYS HE2 H N N 156 LYS HE3 H N N 157 LYS HZ1 H N N 158 LYS HZ2 H N N 159 LYS HZ3 H N N 160 LYS HXT H N N 161 MET N N N N 162 MET CA C N S 163 MET C C N N 164 MET O O N N 165 MET CB C N N 166 MET CG C N N 167 MET SD S N N 168 MET CE C N N 169 MET OXT O N N 170 MET H H N N 171 MET H2 H N N 172 MET HA H N N 173 MET HB2 H N N 174 MET HB3 H N N 175 MET HG2 H N N 176 MET HG3 H N N 177 MET HE1 H N N 178 MET HE2 H N N 179 MET HE3 H N N 180 MET HXT H N N 181 PG4 O1 O N N 182 PG4 C1 C N N 183 PG4 C2 C N N 184 PG4 O2 O N N 185 PG4 C3 C N N 186 PG4 C4 C N N 187 PG4 O3 O N N 188 PG4 C5 C N N 189 PG4 C6 C N N 190 PG4 O4 O N N 191 PG4 C7 C N N 192 PG4 C8 C N N 193 PG4 O5 O N N 194 PG4 HO1 H N N 195 PG4 H11 H N N 196 PG4 H12 H N N 197 PG4 H21 H N N 198 PG4 H22 H N N 199 PG4 H31 H N N 200 PG4 H32 H N N 201 PG4 H41 H N N 202 PG4 H42 H N N 203 PG4 H51 H N N 204 PG4 H52 H N N 205 PG4 H61 H N N 206 PG4 H62 H N N 207 PG4 H71 H N N 208 PG4 H72 H N N 209 PG4 H81 H N N 210 PG4 H82 H N N 211 PG4 HO5 H N N 212 PRO N N N N 213 PRO CA C N S 214 PRO C C N N 215 PRO O O N N 216 PRO CB C N N 217 PRO CG C N N 218 PRO CD C N N 219 PRO OXT O N N 220 PRO H H N N 221 PRO HA H N N 222 PRO HB2 H N N 223 PRO HB3 H N N 224 PRO HG2 H N N 225 PRO HG3 H N N 226 PRO HD2 H N N 227 PRO HD3 H N N 228 PRO HXT H N N 229 SER N N N N 230 SER CA C N S 231 SER C C N N 232 SER O O N N 233 SER CB C N N 234 SER OG O N N 235 SER OXT O N N 236 SER H H N N 237 SER H2 H N N 238 SER HA H N N 239 SER HB2 H N N 240 SER HB3 H N N 241 SER HG H N N 242 SER HXT H N N 243 THR N N N N 244 THR CA C N S 245 THR C C N N 246 THR O O N N 247 THR CB C N R 248 THR OG1 O N N 249 THR CG2 C N N 250 THR OXT O N N 251 THR H H N N 252 THR H2 H N N 253 THR HA H N N 254 THR HB H N N 255 THR HG1 H N N 256 THR HG21 H N N 257 THR HG22 H N N 258 THR HG23 H N N 259 THR HXT H N N 260 TYR N N N N 261 TYR CA C N S 262 TYR C C N N 263 TYR O O N N 264 TYR CB C N N 265 TYR CG C Y N 266 TYR CD1 C Y N 267 TYR CD2 C Y N 268 TYR CE1 C Y N 269 TYR CE2 C Y N 270 TYR CZ C Y N 271 TYR OH O N N 272 TYR OXT O N N 273 TYR H H N N 274 TYR H2 H N N 275 TYR HA H N N 276 TYR HB2 H N N 277 TYR HB3 H N N 278 TYR HD1 H N N 279 TYR HD2 H N N 280 TYR HE1 H N N 281 TYR HE2 H N N 282 TYR HH H N N 283 TYR HXT H N N 284 VAL N N N N 285 VAL CA C N S 286 VAL C C N N 287 VAL O O N N 288 VAL CB C N N 289 VAL CG1 C N N 290 VAL CG2 C N N 291 VAL OXT O N N 292 VAL H H N N 293 VAL H2 H N N 294 VAL HA H N N 295 VAL HB H N N 296 VAL HG11 H N N 297 VAL HG12 H N N 298 VAL HG13 H N N 299 VAL HG21 H N N 300 VAL HG22 H N N 301 VAL HG23 H N N 302 VAL HXT H N N 303 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 GLN N CA sing N N 39 GLN N H sing N N 40 GLN N H2 sing N N 41 GLN CA C sing N N 42 GLN CA CB sing N N 43 GLN CA HA sing N N 44 GLN C O doub N N 45 GLN C OXT sing N N 46 GLN CB CG sing N N 47 GLN CB HB2 sing N N 48 GLN CB HB3 sing N N 49 GLN CG CD sing N N 50 GLN CG HG2 sing N N 51 GLN CG HG3 sing N N 52 GLN CD OE1 doub N N 53 GLN CD NE2 sing N N 54 GLN NE2 HE21 sing N N 55 GLN NE2 HE22 sing N N 56 GLN OXT HXT sing N N 57 GLU N CA sing N N 58 GLU N H sing N N 59 GLU N H2 sing N N 60 GLU CA C sing N N 61 GLU CA CB sing N N 62 GLU CA HA sing N N 63 GLU C O doub N N 64 GLU C OXT sing N N 65 GLU CB CG sing N N 66 GLU CB HB2 sing N N 67 GLU CB HB3 sing N N 68 GLU CG CD sing N N 69 GLU CG HG2 sing N N 70 GLU CG HG3 sing N N 71 GLU CD OE1 doub N N 72 GLU CD OE2 sing N N 73 GLU OE2 HE2 sing N N 74 GLU OXT HXT sing N N 75 GLY N CA sing N N 76 GLY N H sing N N 77 GLY N H2 sing N N 78 GLY CA C sing N N 79 GLY CA HA2 sing N N 80 GLY CA HA3 sing N N 81 GLY C O doub N N 82 GLY C OXT sing N N 83 GLY OXT HXT sing N N 84 HOH O H1 sing N N 85 HOH O H2 sing N N 86 ILE N CA sing N N 87 ILE N H sing N N 88 ILE N H2 sing N N 89 ILE CA C sing N N 90 ILE CA CB sing N N 91 ILE CA HA sing N N 92 ILE C O doub N N 93 ILE C OXT sing N N 94 ILE CB CG1 sing N N 95 ILE CB CG2 sing N N 96 ILE CB HB sing N N 97 ILE CG1 CD1 sing N N 98 ILE CG1 HG12 sing N N 99 ILE CG1 HG13 sing N N 100 ILE CG2 HG21 sing N N 101 ILE CG2 HG22 sing N N 102 ILE CG2 HG23 sing N N 103 ILE CD1 HD11 sing N N 104 ILE CD1 HD12 sing N N 105 ILE CD1 HD13 sing N N 106 ILE OXT HXT sing N N 107 LEU N CA sing N N 108 LEU N H sing N N 109 LEU N H2 sing N N 110 LEU CA C sing N N 111 LEU CA CB sing N N 112 LEU CA HA sing N N 113 LEU C O doub N N 114 LEU C OXT sing N N 115 LEU CB CG sing N N 116 LEU CB HB2 sing N N 117 LEU CB HB3 sing N N 118 LEU CG CD1 sing N N 119 LEU CG CD2 sing N N 120 LEU CG HG sing N N 121 LEU CD1 HD11 sing N N 122 LEU CD1 HD12 sing N N 123 LEU CD1 HD13 sing N N 124 LEU CD2 HD21 sing N N 125 LEU CD2 HD22 sing N N 126 LEU CD2 HD23 sing N N 127 LEU OXT HXT sing N N 128 LYS N CA sing N N 129 LYS N H sing N N 130 LYS N H2 sing N N 131 LYS CA C sing N N 132 LYS CA CB sing N N 133 LYS CA HA sing N N 134 LYS C O doub N N 135 LYS C OXT sing N N 136 LYS CB CG sing N N 137 LYS CB HB2 sing N N 138 LYS CB HB3 sing N N 139 LYS CG CD sing N N 140 LYS CG HG2 sing N N 141 LYS CG HG3 sing N N 142 LYS CD CE sing N N 143 LYS CD HD2 sing N N 144 LYS CD HD3 sing N N 145 LYS CE NZ sing N N 146 LYS CE HE2 sing N N 147 LYS CE HE3 sing N N 148 LYS NZ HZ1 sing N N 149 LYS NZ HZ2 sing N N 150 LYS NZ HZ3 sing N N 151 LYS OXT HXT sing N N 152 MET N CA sing N N 153 MET N H sing N N 154 MET N H2 sing N N 155 MET CA C sing N N 156 MET CA CB sing N N 157 MET CA HA sing N N 158 MET C O doub N N 159 MET C OXT sing N N 160 MET CB CG sing N N 161 MET CB HB2 sing N N 162 MET CB HB3 sing N N 163 MET CG SD sing N N 164 MET CG HG2 sing N N 165 MET CG HG3 sing N N 166 MET SD CE sing N N 167 MET CE HE1 sing N N 168 MET CE HE2 sing N N 169 MET CE HE3 sing N N 170 MET OXT HXT sing N N 171 PG4 O1 C1 sing N N 172 PG4 O1 HO1 sing N N 173 PG4 C1 C2 sing N N 174 PG4 C1 H11 sing N N 175 PG4 C1 H12 sing N N 176 PG4 C2 O2 sing N N 177 PG4 C2 H21 sing N N 178 PG4 C2 H22 sing N N 179 PG4 O2 C3 sing N N 180 PG4 C3 C4 sing N N 181 PG4 C3 H31 sing N N 182 PG4 C3 H32 sing N N 183 PG4 C4 O3 sing N N 184 PG4 C4 H41 sing N N 185 PG4 C4 H42 sing N N 186 PG4 O3 C5 sing N N 187 PG4 C5 C6 sing N N 188 PG4 C5 H51 sing N N 189 PG4 C5 H52 sing N N 190 PG4 C6 O4 sing N N 191 PG4 C6 H61 sing N N 192 PG4 C6 H62 sing N N 193 PG4 O4 C7 sing N N 194 PG4 C7 C8 sing N N 195 PG4 C7 H71 sing N N 196 PG4 C7 H72 sing N N 197 PG4 C8 O5 sing N N 198 PG4 C8 H81 sing N N 199 PG4 C8 H82 sing N N 200 PG4 O5 HO5 sing N N 201 PRO N CA sing N N 202 PRO N CD sing N N 203 PRO N H sing N N 204 PRO CA C sing N N 205 PRO CA CB sing N N 206 PRO CA HA sing N N 207 PRO C O doub N N 208 PRO C OXT sing N N 209 PRO CB CG sing N N 210 PRO CB HB2 sing N N 211 PRO CB HB3 sing N N 212 PRO CG CD sing N N 213 PRO CG HG2 sing N N 214 PRO CG HG3 sing N N 215 PRO CD HD2 sing N N 216 PRO CD HD3 sing N N 217 PRO OXT HXT sing N N 218 SER N CA sing N N 219 SER N H sing N N 220 SER N H2 sing N N 221 SER CA C sing N N 222 SER CA CB sing N N 223 SER CA HA sing N N 224 SER C O doub N N 225 SER C OXT sing N N 226 SER CB OG sing N N 227 SER CB HB2 sing N N 228 SER CB HB3 sing N N 229 SER OG HG sing N N 230 SER OXT HXT sing N N 231 THR N CA sing N N 232 THR N H sing N N 233 THR N H2 sing N N 234 THR CA C sing N N 235 THR CA CB sing N N 236 THR CA HA sing N N 237 THR C O doub N N 238 THR C OXT sing N N 239 THR CB OG1 sing N N 240 THR CB CG2 sing N N 241 THR CB HB sing N N 242 THR OG1 HG1 sing N N 243 THR CG2 HG21 sing N N 244 THR CG2 HG22 sing N N 245 THR CG2 HG23 sing N N 246 THR OXT HXT sing N N 247 TYR N CA sing N N 248 TYR N H sing N N 249 TYR N H2 sing N N 250 TYR CA C sing N N 251 TYR CA CB sing N N 252 TYR CA HA sing N N 253 TYR C O doub N N 254 TYR C OXT sing N N 255 TYR CB CG sing N N 256 TYR CB HB2 sing N N 257 TYR CB HB3 sing N N 258 TYR CG CD1 doub Y N 259 TYR CG CD2 sing Y N 260 TYR CD1 CE1 sing Y N 261 TYR CD1 HD1 sing N N 262 TYR CD2 CE2 doub Y N 263 TYR CD2 HD2 sing N N 264 TYR CE1 CZ doub Y N 265 TYR CE1 HE1 sing N N 266 TYR CE2 CZ sing Y N 267 TYR CE2 HE2 sing N N 268 TYR CZ OH sing N N 269 TYR OH HH sing N N 270 TYR OXT HXT sing N N 271 VAL N CA sing N N 272 VAL N H sing N N 273 VAL N H2 sing N N 274 VAL CA C sing N N 275 VAL CA CB sing N N 276 VAL CA HA sing N N 277 VAL C O doub N N 278 VAL C OXT sing N N 279 VAL CB CG1 sing N N 280 VAL CB CG2 sing N N 281 VAL CB HB sing N N 282 VAL CG1 HG11 sing N N 283 VAL CG1 HG12 sing N N 284 VAL CG1 HG13 sing N N 285 VAL CG2 HG21 sing N N 286 VAL CG2 HG22 sing N N 287 VAL CG2 HG23 sing N N 288 VAL OXT HXT sing N N 289 # _pdbx_audit_support.funding_organization 'Howard Hughes Medical Institute (HHMI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 21 3' _space_group.name_Hall 'P 2ac 2ab 3' _space_group.IT_number 198 _space_group.crystal_system cubic _space_group.id 1 # _atom_sites.entry_id 9C7Z _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.012759 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012759 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012759 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #