data_9C90 # _entry.id 9C90 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9C90 pdb_00009c90 10.2210/pdb9c90/pdb WWPDB D_1000284423 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-10-16 2 'Structure model' 1 1 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 2 'Structure model' '_citation_author.identifier_ORCID' 14 2 'Structure model' '_citation_author.name' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9C90 _pdbx_database_status.recvd_initial_deposition_date 2024-06-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email akb20@psu.edu _pdbx_contact_author.name_first Amie _pdbx_contact_author.name_last Boal _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-1234-8472 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jung, J.J.' 1 0000-0002-2093-6207 'Lin, C.-Y.' 2 0000-0001-6555-8767 'Boal, A.K.' 3 0000-0002-1234-8472 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 121 _citation.language ? _citation.page_first e2410926121 _citation.page_last e2410926121 _citation.title 'Modulating metal-centered dimerization of a lanthanide chaperone protein for separation of light lanthanides.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.2410926121 _citation.pdbx_database_id_PubMed 39467132 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Larrinaga, W.B.' 1 0009-0009-0416-5121 primary 'Jung, J.J.' 2 0000-0002-2093-6207 primary 'Lin, C.Y.' 3 0000-0001-6555-8767 primary 'Boal, A.K.' 4 ? primary 'Cotruvo Jr., J.A.' 5 0000-0003-4243-8257 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man landiscernin 6602.546 1 ? ? ? ? 2 non-polymer syn 'HOLMIUM (III) ATOM' 164.930 1 ? ? ? ? 3 water nat water 18.015 8 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code DDKAACADGIAAVKARVEKLAPEAVPQKLKRALKIAEREQGEGEFDECLEALDDAKRALPK _entity_poly.pdbx_seq_one_letter_code_can DDKAACADGIAAVKARVEKLAPEAVPQKLKRALKIAEREQGEGEFDECLEALDDAKRALPK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'HOLMIUM (III) ATOM' HO3 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 ASP n 1 3 LYS n 1 4 ALA n 1 5 ALA n 1 6 CYS n 1 7 ALA n 1 8 ASP n 1 9 GLY n 1 10 ILE n 1 11 ALA n 1 12 ALA n 1 13 VAL n 1 14 LYS n 1 15 ALA n 1 16 ARG n 1 17 VAL n 1 18 GLU n 1 19 LYS n 1 20 LEU n 1 21 ALA n 1 22 PRO n 1 23 GLU n 1 24 ALA n 1 25 VAL n 1 26 PRO n 1 27 GLN n 1 28 LYS n 1 29 LEU n 1 30 LYS n 1 31 ARG n 1 32 ALA n 1 33 LEU n 1 34 LYS n 1 35 ILE n 1 36 ALA n 1 37 GLU n 1 38 ARG n 1 39 GLU n 1 40 GLN n 1 41 GLY n 1 42 GLU n 1 43 GLY n 1 44 GLU n 1 45 PHE n 1 46 ASP n 1 47 GLU n 1 48 CYS n 1 49 LEU n 1 50 GLU n 1 51 ALA n 1 52 LEU n 1 53 ASP n 1 54 ASP n 1 55 ALA n 1 56 LYS n 1 57 ARG n 1 58 ALA n 1 59 LEU n 1 60 PRO n 1 61 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 61 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene LanD _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Methylorubrum extorquens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 408 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HO3 non-polymer . 'HOLMIUM (III) ATOM' ? 'Ho 3' 164.930 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 32 32 ASP ASP A . n A 1 2 ASP 2 33 33 ASP ASP A . n A 1 3 LYS 3 34 34 LYS LYS A . n A 1 4 ALA 4 35 35 ALA ALA A . n A 1 5 ALA 5 36 36 ALA ALA A . n A 1 6 CYS 6 37 37 CYS CYS A . n A 1 7 ALA 7 38 38 ALA ALA A . n A 1 8 ASP 8 39 39 ASP ASP A . n A 1 9 GLY 9 40 40 GLY GLY A . n A 1 10 ILE 10 41 41 ILE ILE A . n A 1 11 ALA 11 42 42 ALA ALA A . n A 1 12 ALA 12 43 43 ALA ALA A . n A 1 13 VAL 13 44 44 VAL VAL A . n A 1 14 LYS 14 45 45 LYS LYS A . n A 1 15 ALA 15 46 46 ALA ALA A . n A 1 16 ARG 16 47 47 ARG ARG A . n A 1 17 VAL 17 48 48 VAL VAL A . n A 1 18 GLU 18 49 49 GLU GLU A . n A 1 19 LYS 19 50 50 LYS LYS A . n A 1 20 LEU 20 51 51 LEU LEU A . n A 1 21 ALA 21 52 52 ALA ALA A . n A 1 22 PRO 22 53 53 PRO PRO A . n A 1 23 GLU 23 54 54 GLU GLU A . n A 1 24 ALA 24 55 55 ALA ALA A . n A 1 25 VAL 25 56 56 VAL VAL A . n A 1 26 PRO 26 57 57 PRO PRO A . n A 1 27 GLN 27 58 58 GLN GLN A . n A 1 28 LYS 28 59 59 LYS LYS A . n A 1 29 LEU 29 60 60 LEU LEU A . n A 1 30 LYS 30 61 61 LYS LYS A . n A 1 31 ARG 31 62 62 ARG ARG A . n A 1 32 ALA 32 63 63 ALA ALA A . n A 1 33 LEU 33 64 64 LEU LEU A . n A 1 34 LYS 34 65 65 LYS LYS A . n A 1 35 ILE 35 66 66 ILE ILE A . n A 1 36 ALA 36 67 67 ALA ALA A . n A 1 37 GLU 37 68 68 GLU GLU A . n A 1 38 ARG 38 69 69 ARG ARG A . n A 1 39 GLU 39 70 70 GLU GLU A . n A 1 40 GLN 40 71 71 GLN GLN A . n A 1 41 GLY 41 72 72 GLY GLY A . n A 1 42 GLU 42 73 73 GLU GLU A . n A 1 43 GLY 43 74 74 GLY GLY A . n A 1 44 GLU 44 75 75 GLU GLU A . n A 1 45 PHE 45 76 76 PHE PHE A . n A 1 46 ASP 46 77 77 ASP ASP A . n A 1 47 GLU 47 78 78 GLU GLU A . n A 1 48 CYS 48 79 79 CYS CYS A . n A 1 49 LEU 49 80 80 LEU LEU A . n A 1 50 GLU 50 81 81 GLU GLU A . n A 1 51 ALA 51 82 82 ALA ALA A . n A 1 52 LEU 52 83 83 LEU LEU A . n A 1 53 ASP 53 84 84 ASP ASP A . n A 1 54 ASP 54 85 85 ASP ASP A . n A 1 55 ALA 55 86 86 ALA ALA A . n A 1 56 LYS 56 87 87 LYS LYS A . n A 1 57 ARG 57 88 88 ARG ARG A . n A 1 58 ALA 58 89 89 ALA ALA A . n A 1 59 LEU 59 90 90 LEU LEU A . n A 1 60 PRO 60 91 91 PRO PRO A . n A 1 61 LYS 61 92 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id HO3 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id HO3 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HO3 1 101 1 HO3 HO A . C 3 HOH 1 201 6 HOH HOH A . C 3 HOH 2 202 1 HOH HOH A . C 3 HOH 3 203 3 HOH HOH A . C 3 HOH 4 204 5 HOH HOH A . C 3 HOH 5 205 8 HOH HOH A . C 3 HOH 6 206 2 HOH HOH A . C 3 HOH 7 207 4 HOH HOH A . C 3 HOH 8 208 7 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.20.1_4487: ???)' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9C90 _cell.details ? _cell.formula_units_Z ? _cell.length_a 78.164 _cell.length_a_esd ? _cell.length_b 78.164 _cell.length_b_esd ? _cell.length_c 78.164 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9C90 _symmetry.cell_setting ? _symmetry.Int_Tables_number 199 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 21 3' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9C90 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.01 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 59.19 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM MES, pH 6.5, 50% w/v PEG200' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 298 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-08-28 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97949 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL12-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97949 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL12-1 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9C90 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.38 _reflns.d_resolution_low 39.08 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 31728 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 39.3 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 21.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.38 _reflns_shell.d_res_low 1.42 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1210 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.477 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9C90 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.38 _refine.ls_d_res_low 39.08 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 31728 _refine.ls_number_reflns_R_free 3150 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.93 _refine.ls_percent_reflns_R_free 9.93 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2212 _refine.ls_R_factor_R_free 0.2234 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2210 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values MLHL _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.36 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.14 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.38 _refine_hist.d_res_low 39.08 _refine_hist.number_atoms_solvent 8 _refine_hist.number_atoms_total 461 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 452 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? ? ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.917 ? ? ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 16.432 ? 195 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.052 ? 72 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 91 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.38 1.40 . . 125 1217 100.00 . . . . 0.3140 . . . . . . . . . . . 0.3262 'X-RAY DIFFRACTION' 1.40 1.42 . . 146 1270 100.00 . . . . 0.2979 . . . . . . . . . . . 0.3454 'X-RAY DIFFRACTION' 1.42 1.45 . . 131 1231 100.00 . . . . 0.2909 . . . . . . . . . . . 0.2935 'X-RAY DIFFRACTION' 1.45 1.47 . . 146 1267 100.00 . . . . 0.2769 . . . . . . . . . . . 0.2759 'X-RAY DIFFRACTION' 1.47 1.50 . . 140 1215 100.00 . . . . 0.2564 . . . . . . . . . . . 0.2584 'X-RAY DIFFRACTION' 1.50 1.53 . . 130 1231 100.00 . . . . 0.2569 . . . . . . . . . . . 0.2340 'X-RAY DIFFRACTION' 1.53 1.56 . . 134 1239 100.00 . . . . 0.2503 . . . . . . . . . . . 0.2227 'X-RAY DIFFRACTION' 1.56 1.59 . . 134 1264 100.00 . . . . 0.2310 . . . . . . . . . . . 0.2448 'X-RAY DIFFRACTION' 1.59 1.63 . . 138 1254 100.00 . . . . 0.2171 . . . . . . . . . . . 0.2330 'X-RAY DIFFRACTION' 1.63 1.67 . . 136 1236 100.00 . . . . 0.2154 . . . . . . . . . . . 0.2317 'X-RAY DIFFRACTION' 1.67 1.71 . . 130 1222 100.00 . . . . 0.1916 . . . . . . . . . . . 0.2096 'X-RAY DIFFRACTION' 1.71 1.76 . . 144 1265 100.00 . . . . 0.2040 . . . . . . . . . . . 0.2088 'X-RAY DIFFRACTION' 1.77 1.82 . . 130 1254 100.00 . . . . 0.1922 . . . . . . . . . . . 0.2168 'X-RAY DIFFRACTION' 1.82 1.89 . . 140 1226 100.00 . . . . 0.2175 . . . . . . . . . . . 0.2136 'X-RAY DIFFRACTION' 1.89 1.96 . . 140 1230 100.00 . . . . 0.2125 . . . . . . . . . . . 0.2126 'X-RAY DIFFRACTION' 1.96 2.05 . . 143 1273 100.00 . . . . 0.1910 . . . . . . . . . . . 0.1956 'X-RAY DIFFRACTION' 2.05 2.16 . . 136 1246 100.00 . . . . 0.2082 . . . . . . . . . . . 0.1705 'X-RAY DIFFRACTION' 2.16 2.29 . . 140 1209 100.00 . . . . 0.2078 . . . . . . . . . . . 0.2498 'X-RAY DIFFRACTION' 2.30 2.47 . . 132 1242 100.00 . . . . 0.2012 . . . . . . . . . . . 0.1937 'X-RAY DIFFRACTION' 2.47 2.72 . . 134 1245 100.00 . . . . 0.2040 . . . . . . . . . . . 0.2130 'X-RAY DIFFRACTION' 2.72 3.11 . . 144 1249 100.00 . . . . 0.2163 . . . . . . . . . . . 0.2246 'X-RAY DIFFRACTION' 3.12 3.92 . . 137 1249 100.00 . . . . 0.2216 . . . . . . . . . . . 0.2150 'X-RAY DIFFRACTION' 3.93 39.08 . . 140 1244 100.00 . . . . 0.2415 . . . . . . . . . . . 0.2424 # _struct.entry_id 9C90 _struct.title 'X-ray crystal structure of Methylorubrum extorquens Ho(III)-bound LanD' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9C90 _struct_keywords.text 'lanthanide, holmium, methanol dehydrogenase, chaperone, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code C5B159_METEA _struct_ref.pdbx_db_accession C5B159 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code DDKAACADGIAAVKARVEKLAPEAVPQKLKRALKIAEREQGEGEFDECLEALDDAKRALPK _struct_ref.pdbx_align_begin 32 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9C90 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 61 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession C5B159 _struct_ref_seq.db_align_beg 32 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 92 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 32 _struct_ref_seq.pdbx_auth_seq_align_end 92 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 720 ? 1 MORE -12 ? 1 'SSA (A^2)' 7410 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 14_665 -x+1,-y+3/2,z -1.0000000000 0.0000000000 0.0000000000 78.1640000000 0.0000000000 -1.0000000000 0.0000000000 117.2460000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 1 ? GLU A 18 ? ASP A 32 GLU A 49 1 ? 18 HELX_P HELX_P2 AA2 LYS A 19 ? LEU A 20 ? LYS A 50 LEU A 51 5 ? 2 HELX_P HELX_P3 AA3 ALA A 21 ? VAL A 25 ? ALA A 52 VAL A 56 5 ? 5 HELX_P HELX_P4 AA4 PRO A 26 ? GLU A 42 ? PRO A 57 GLU A 73 1 ? 17 HELX_P HELX_P5 AA5 GLU A 44 ? ALA A 58 ? GLU A 75 ALA A 89 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 48 SG ? ? A CYS 37 A CYS 79 1_555 ? ? ? ? ? ? ? 2.065 ? ? metalc1 metalc ? ? A GLU 39 OE1 ? ? ? 1_555 B HO3 . HO ? ? A GLU 70 A HO3 101 1_555 ? ? ? ? ? ? ? 2.402 ? ? metalc2 metalc ? ? A GLU 39 OE2 ? ? ? 1_555 B HO3 . HO ? ? A GLU 70 A HO3 101 1_555 ? ? ? ? ? ? ? 2.410 ? ? metalc3 metalc ? ? A GLU 39 OE1 ? ? ? 1_555 B HO3 . HO ? ? A GLU 70 A HO3 101 14_665 ? ? ? ? ? ? ? 2.402 ? ? metalc4 metalc ? ? A GLU 39 OE2 ? ? ? 1_555 B HO3 . HO ? ? A GLU 70 A HO3 101 14_665 ? ? ? ? ? ? ? 2.410 ? ? metalc5 metalc ? ? A GLU 42 OE1 ? ? ? 1_555 B HO3 . HO ? ? A GLU 73 A HO3 101 1_555 ? ? ? ? ? ? ? 2.290 ? ? metalc6 metalc ? ? A GLU 42 OE1 ? ? ? 1_555 B HO3 . HO ? ? A GLU 73 A HO3 101 14_665 ? ? ? ? ? ? ? 2.290 ? ? metalc7 metalc ? ? A GLU 44 OE2 ? ? ? 1_555 B HO3 . HO ? ? A GLU 75 A HO3 101 1_555 ? ? ? ? ? ? ? 2.203 ? ? metalc8 metalc ? ? A GLU 44 OE2 ? ? ? 1_555 B HO3 . HO ? ? A GLU 75 A HO3 101 14_665 ? ? ? ? ? ? ? 2.203 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 39 ? A GLU 70 ? 1_555 HO ? B HO3 . ? A HO3 101 ? 1_555 OE2 ? A GLU 39 ? A GLU 70 ? 1_555 54.2 ? 2 OE1 ? A GLU 39 ? A GLU 70 ? 1_555 HO ? B HO3 . ? A HO3 101 ? 1_555 OE1 ? A GLU 39 ? A GLU 70 ? 1_555 0.0 ? 3 OE2 ? A GLU 39 ? A GLU 70 ? 1_555 HO ? B HO3 . ? A HO3 101 ? 1_555 OE1 ? A GLU 39 ? A GLU 70 ? 1_555 54.2 ? 4 OE1 ? A GLU 39 ? A GLU 70 ? 1_555 HO ? B HO3 . ? A HO3 101 ? 1_555 OE2 ? A GLU 39 ? A GLU 70 ? 1_555 54.2 ? 5 OE2 ? A GLU 39 ? A GLU 70 ? 1_555 HO ? B HO3 . ? A HO3 101 ? 1_555 OE2 ? A GLU 39 ? A GLU 70 ? 1_555 0.0 ? 6 OE1 ? A GLU 39 ? A GLU 70 ? 1_555 HO ? B HO3 . ? A HO3 101 ? 1_555 OE2 ? A GLU 39 ? A GLU 70 ? 1_555 54.2 ? 7 OE1 ? A GLU 39 ? A GLU 70 ? 1_555 HO ? B HO3 . ? A HO3 101 ? 1_555 OE1 ? A GLU 42 ? A GLU 73 ? 1_555 80.2 ? 8 OE2 ? A GLU 39 ? A GLU 70 ? 1_555 HO ? B HO3 . ? A HO3 101 ? 1_555 OE1 ? A GLU 42 ? A GLU 73 ? 1_555 78.6 ? 9 OE1 ? A GLU 39 ? A GLU 70 ? 1_555 HO ? B HO3 . ? A HO3 101 ? 1_555 OE1 ? A GLU 42 ? A GLU 73 ? 1_555 80.2 ? 10 OE2 ? A GLU 39 ? A GLU 70 ? 1_555 HO ? B HO3 . ? A HO3 101 ? 1_555 OE1 ? A GLU 42 ? A GLU 73 ? 1_555 78.6 ? 11 OE1 ? A GLU 39 ? A GLU 70 ? 1_555 HO ? B HO3 . ? A HO3 101 ? 1_555 OE1 ? A GLU 42 ? A GLU 73 ? 1_555 80.2 ? 12 OE2 ? A GLU 39 ? A GLU 70 ? 1_555 HO ? B HO3 . ? A HO3 101 ? 1_555 OE1 ? A GLU 42 ? A GLU 73 ? 1_555 78.6 ? 13 OE1 ? A GLU 39 ? A GLU 70 ? 1_555 HO ? B HO3 . ? A HO3 101 ? 1_555 OE1 ? A GLU 42 ? A GLU 73 ? 1_555 80.2 ? 14 OE2 ? A GLU 39 ? A GLU 70 ? 1_555 HO ? B HO3 . ? A HO3 101 ? 1_555 OE1 ? A GLU 42 ? A GLU 73 ? 1_555 78.6 ? 15 OE1 ? A GLU 42 ? A GLU 73 ? 1_555 HO ? B HO3 . ? A HO3 101 ? 1_555 OE1 ? A GLU 42 ? A GLU 73 ? 1_555 0.0 ? 16 OE1 ? A GLU 39 ? A GLU 70 ? 1_555 HO ? B HO3 . ? A HO3 101 ? 1_555 OE2 ? A GLU 44 ? A GLU 75 ? 1_555 73.1 ? 17 OE2 ? A GLU 39 ? A GLU 70 ? 1_555 HO ? B HO3 . ? A HO3 101 ? 1_555 OE2 ? A GLU 44 ? A GLU 75 ? 1_555 126.2 ? 18 OE1 ? A GLU 39 ? A GLU 70 ? 1_555 HO ? B HO3 . ? A HO3 101 ? 1_555 OE2 ? A GLU 44 ? A GLU 75 ? 1_555 73.1 ? 19 OE2 ? A GLU 39 ? A GLU 70 ? 1_555 HO ? B HO3 . ? A HO3 101 ? 1_555 OE2 ? A GLU 44 ? A GLU 75 ? 1_555 126.2 ? 20 OE1 ? A GLU 42 ? A GLU 73 ? 1_555 HO ? B HO3 . ? A HO3 101 ? 1_555 OE2 ? A GLU 44 ? A GLU 75 ? 1_555 83.0 ? 21 OE1 ? A GLU 42 ? A GLU 73 ? 1_555 HO ? B HO3 . ? A HO3 101 ? 1_555 OE2 ? A GLU 44 ? A GLU 75 ? 1_555 83.0 ? 22 OE1 ? A GLU 39 ? A GLU 70 ? 1_555 HO ? B HO3 . ? A HO3 101 ? 1_555 OE2 ? A GLU 44 ? A GLU 75 ? 1_555 73.1 ? 23 OE2 ? A GLU 39 ? A GLU 70 ? 1_555 HO ? B HO3 . ? A HO3 101 ? 1_555 OE2 ? A GLU 44 ? A GLU 75 ? 1_555 126.2 ? 24 OE1 ? A GLU 39 ? A GLU 70 ? 1_555 HO ? B HO3 . ? A HO3 101 ? 1_555 OE2 ? A GLU 44 ? A GLU 75 ? 1_555 73.1 ? 25 OE2 ? A GLU 39 ? A GLU 70 ? 1_555 HO ? B HO3 . ? A HO3 101 ? 1_555 OE2 ? A GLU 44 ? A GLU 75 ? 1_555 126.2 ? 26 OE1 ? A GLU 42 ? A GLU 73 ? 1_555 HO ? B HO3 . ? A HO3 101 ? 1_555 OE2 ? A GLU 44 ? A GLU 75 ? 1_555 83.0 ? 27 OE1 ? A GLU 42 ? A GLU 73 ? 1_555 HO ? B HO3 . ? A HO3 101 ? 1_555 OE2 ? A GLU 44 ? A GLU 75 ? 1_555 83.0 ? 28 OE2 ? A GLU 44 ? A GLU 75 ? 1_555 HO ? B HO3 . ? A HO3 101 ? 1_555 OE2 ? A GLU 44 ? A GLU 75 ? 1_555 0.0 ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 6 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 48 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 37 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 79 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # _pdbx_entry_details.entry_id 9C90 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 PRO _pdbx_validate_symm_contact.auth_seq_id_1 53 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 NZ _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 LYS _pdbx_validate_symm_contact.auth_seq_id_2 61 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 15_556 _pdbx_validate_symm_contact.dist 2.17 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HO3 101 ? B HO3 . 2 1 A HOH 208 ? C HOH . # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 28.8476 43.4665 49.9585 0.5286 ? 0.0410 ? -0.1779 ? 0.1908 ? 0.0445 ? 0.4574 ? 2.6992 ? 0.8994 ? -1.1442 ? 2.2129 ? -1.2377 ? 5.1655 ? 0.3174 ? 0.4756 ? -0.2749 ? -0.6468 ? -0.0014 ? 0.6356 ? 1.1114 ? 0.2143 ? -0.0854 ? 2 'X-RAY DIFFRACTION' ? refined 15.1715 49.3685 41.1395 0.4635 ? -0.1218 ? -0.3448 ? 0.3990 ? 0.0048 ? 0.4845 ? 3.8865 ? -1.1085 ? 4.6920 ? 0.3353 ? -1.3822 ? 6.0242 ? 0.9469 ? -1.0667 ? -0.9455 ? -1.1754 ? -0.3516 ? 1.4262 ? 1.4311 ? -1.5039 ? -0.9703 ? 3 'X-RAY DIFFRACTION' ? refined 31.0453 54.3187 46.3025 0.2255 ? 0.0343 ? -0.0464 ? 0.1592 ? 0.0248 ? 0.1422 ? 6.7147 ? 0.3247 ? -1.1165 ? 3.1297 ? -0.7529 ? 4.2979 ? 0.2693 ? -0.0289 ? -0.1988 ? -0.3803 ? -0.1536 ? 0.0956 ? 0.2275 ? 0.3003 ? -0.1389 ? 4 'X-RAY DIFFRACTION' ? refined 28.3965 52.2927 54.1170 0.2127 ? 0.0343 ? 0.0204 ? 0.2276 ? 0.0623 ? 0.2225 ? 8.1324 ? 3.4582 ? 2.4918 ? 5.8810 ? -0.9147 ? 7.6900 ? 0.1201 ? -0.5564 ? 0.6213 ? 0.3977 ? 0.1276 ? 0.2659 ? -0.0805 ? -0.4427 ? -0.3061 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 32 through 50 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 51 through 57 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 58 through 75 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 76 through 91 ) ; # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id LYS _pdbx_unobs_or_zero_occ_residues.auth_seq_id 92 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id LYS _pdbx_unobs_or_zero_occ_residues.label_seq_id 61 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLN N N N N 71 GLN CA C N S 72 GLN C C N N 73 GLN O O N N 74 GLN CB C N N 75 GLN CG C N N 76 GLN CD C N N 77 GLN OE1 O N N 78 GLN NE2 N N N 79 GLN OXT O N N 80 GLN H H N N 81 GLN H2 H N N 82 GLN HA H N N 83 GLN HB2 H N N 84 GLN HB3 H N N 85 GLN HG2 H N N 86 GLN HG3 H N N 87 GLN HE21 H N N 88 GLN HE22 H N N 89 GLN HXT H N N 90 GLU N N N N 91 GLU CA C N S 92 GLU C C N N 93 GLU O O N N 94 GLU CB C N N 95 GLU CG C N N 96 GLU CD C N N 97 GLU OE1 O N N 98 GLU OE2 O N N 99 GLU OXT O N N 100 GLU H H N N 101 GLU H2 H N N 102 GLU HA H N N 103 GLU HB2 H N N 104 GLU HB3 H N N 105 GLU HG2 H N N 106 GLU HG3 H N N 107 GLU HE2 H N N 108 GLU HXT H N N 109 GLY N N N N 110 GLY CA C N N 111 GLY C C N N 112 GLY O O N N 113 GLY OXT O N N 114 GLY H H N N 115 GLY H2 H N N 116 GLY HA2 H N N 117 GLY HA3 H N N 118 GLY HXT H N N 119 HO3 HO HO N N 120 HOH O O N N 121 HOH H1 H N N 122 HOH H2 H N N 123 ILE N N N N 124 ILE CA C N S 125 ILE C C N N 126 ILE O O N N 127 ILE CB C N S 128 ILE CG1 C N N 129 ILE CG2 C N N 130 ILE CD1 C N N 131 ILE OXT O N N 132 ILE H H N N 133 ILE H2 H N N 134 ILE HA H N N 135 ILE HB H N N 136 ILE HG12 H N N 137 ILE HG13 H N N 138 ILE HG21 H N N 139 ILE HG22 H N N 140 ILE HG23 H N N 141 ILE HD11 H N N 142 ILE HD12 H N N 143 ILE HD13 H N N 144 ILE HXT H N N 145 LEU N N N N 146 LEU CA C N S 147 LEU C C N N 148 LEU O O N N 149 LEU CB C N N 150 LEU CG C N N 151 LEU CD1 C N N 152 LEU CD2 C N N 153 LEU OXT O N N 154 LEU H H N N 155 LEU H2 H N N 156 LEU HA H N N 157 LEU HB2 H N N 158 LEU HB3 H N N 159 LEU HG H N N 160 LEU HD11 H N N 161 LEU HD12 H N N 162 LEU HD13 H N N 163 LEU HD21 H N N 164 LEU HD22 H N N 165 LEU HD23 H N N 166 LEU HXT H N N 167 LYS N N N N 168 LYS CA C N S 169 LYS C C N N 170 LYS O O N N 171 LYS CB C N N 172 LYS CG C N N 173 LYS CD C N N 174 LYS CE C N N 175 LYS NZ N N N 176 LYS OXT O N N 177 LYS H H N N 178 LYS H2 H N N 179 LYS HA H N N 180 LYS HB2 H N N 181 LYS HB3 H N N 182 LYS HG2 H N N 183 LYS HG3 H N N 184 LYS HD2 H N N 185 LYS HD3 H N N 186 LYS HE2 H N N 187 LYS HE3 H N N 188 LYS HZ1 H N N 189 LYS HZ2 H N N 190 LYS HZ3 H N N 191 LYS HXT H N N 192 PHE N N N N 193 PHE CA C N S 194 PHE C C N N 195 PHE O O N N 196 PHE CB C N N 197 PHE CG C Y N 198 PHE CD1 C Y N 199 PHE CD2 C Y N 200 PHE CE1 C Y N 201 PHE CE2 C Y N 202 PHE CZ C Y N 203 PHE OXT O N N 204 PHE H H N N 205 PHE H2 H N N 206 PHE HA H N N 207 PHE HB2 H N N 208 PHE HB3 H N N 209 PHE HD1 H N N 210 PHE HD2 H N N 211 PHE HE1 H N N 212 PHE HE2 H N N 213 PHE HZ H N N 214 PHE HXT H N N 215 PRO N N N N 216 PRO CA C N S 217 PRO C C N N 218 PRO O O N N 219 PRO CB C N N 220 PRO CG C N N 221 PRO CD C N N 222 PRO OXT O N N 223 PRO H H N N 224 PRO HA H N N 225 PRO HB2 H N N 226 PRO HB3 H N N 227 PRO HG2 H N N 228 PRO HG3 H N N 229 PRO HD2 H N N 230 PRO HD3 H N N 231 PRO HXT H N N 232 VAL N N N N 233 VAL CA C N S 234 VAL C C N N 235 VAL O O N N 236 VAL CB C N N 237 VAL CG1 C N N 238 VAL CG2 C N N 239 VAL OXT O N N 240 VAL H H N N 241 VAL H2 H N N 242 VAL HA H N N 243 VAL HB H N N 244 VAL HG11 H N N 245 VAL HG12 H N N 246 VAL HG13 H N N 247 VAL HG21 H N N 248 VAL HG22 H N N 249 VAL HG23 H N N 250 VAL HXT H N N 251 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLN N CA sing N N 67 GLN N H sing N N 68 GLN N H2 sing N N 69 GLN CA C sing N N 70 GLN CA CB sing N N 71 GLN CA HA sing N N 72 GLN C O doub N N 73 GLN C OXT sing N N 74 GLN CB CG sing N N 75 GLN CB HB2 sing N N 76 GLN CB HB3 sing N N 77 GLN CG CD sing N N 78 GLN CG HG2 sing N N 79 GLN CG HG3 sing N N 80 GLN CD OE1 doub N N 81 GLN CD NE2 sing N N 82 GLN NE2 HE21 sing N N 83 GLN NE2 HE22 sing N N 84 GLN OXT HXT sing N N 85 GLU N CA sing N N 86 GLU N H sing N N 87 GLU N H2 sing N N 88 GLU CA C sing N N 89 GLU CA CB sing N N 90 GLU CA HA sing N N 91 GLU C O doub N N 92 GLU C OXT sing N N 93 GLU CB CG sing N N 94 GLU CB HB2 sing N N 95 GLU CB HB3 sing N N 96 GLU CG CD sing N N 97 GLU CG HG2 sing N N 98 GLU CG HG3 sing N N 99 GLU CD OE1 doub N N 100 GLU CD OE2 sing N N 101 GLU OE2 HE2 sing N N 102 GLU OXT HXT sing N N 103 GLY N CA sing N N 104 GLY N H sing N N 105 GLY N H2 sing N N 106 GLY CA C sing N N 107 GLY CA HA2 sing N N 108 GLY CA HA3 sing N N 109 GLY C O doub N N 110 GLY C OXT sing N N 111 GLY OXT HXT sing N N 112 HOH O H1 sing N N 113 HOH O H2 sing N N 114 ILE N CA sing N N 115 ILE N H sing N N 116 ILE N H2 sing N N 117 ILE CA C sing N N 118 ILE CA CB sing N N 119 ILE CA HA sing N N 120 ILE C O doub N N 121 ILE C OXT sing N N 122 ILE CB CG1 sing N N 123 ILE CB CG2 sing N N 124 ILE CB HB sing N N 125 ILE CG1 CD1 sing N N 126 ILE CG1 HG12 sing N N 127 ILE CG1 HG13 sing N N 128 ILE CG2 HG21 sing N N 129 ILE CG2 HG22 sing N N 130 ILE CG2 HG23 sing N N 131 ILE CD1 HD11 sing N N 132 ILE CD1 HD12 sing N N 133 ILE CD1 HD13 sing N N 134 ILE OXT HXT sing N N 135 LEU N CA sing N N 136 LEU N H sing N N 137 LEU N H2 sing N N 138 LEU CA C sing N N 139 LEU CA CB sing N N 140 LEU CA HA sing N N 141 LEU C O doub N N 142 LEU C OXT sing N N 143 LEU CB CG sing N N 144 LEU CB HB2 sing N N 145 LEU CB HB3 sing N N 146 LEU CG CD1 sing N N 147 LEU CG CD2 sing N N 148 LEU CG HG sing N N 149 LEU CD1 HD11 sing N N 150 LEU CD1 HD12 sing N N 151 LEU CD1 HD13 sing N N 152 LEU CD2 HD21 sing N N 153 LEU CD2 HD22 sing N N 154 LEU CD2 HD23 sing N N 155 LEU OXT HXT sing N N 156 LYS N CA sing N N 157 LYS N H sing N N 158 LYS N H2 sing N N 159 LYS CA C sing N N 160 LYS CA CB sing N N 161 LYS CA HA sing N N 162 LYS C O doub N N 163 LYS C OXT sing N N 164 LYS CB CG sing N N 165 LYS CB HB2 sing N N 166 LYS CB HB3 sing N N 167 LYS CG CD sing N N 168 LYS CG HG2 sing N N 169 LYS CG HG3 sing N N 170 LYS CD CE sing N N 171 LYS CD HD2 sing N N 172 LYS CD HD3 sing N N 173 LYS CE NZ sing N N 174 LYS CE HE2 sing N N 175 LYS CE HE3 sing N N 176 LYS NZ HZ1 sing N N 177 LYS NZ HZ2 sing N N 178 LYS NZ HZ3 sing N N 179 LYS OXT HXT sing N N 180 PHE N CA sing N N 181 PHE N H sing N N 182 PHE N H2 sing N N 183 PHE CA C sing N N 184 PHE CA CB sing N N 185 PHE CA HA sing N N 186 PHE C O doub N N 187 PHE C OXT sing N N 188 PHE CB CG sing N N 189 PHE CB HB2 sing N N 190 PHE CB HB3 sing N N 191 PHE CG CD1 doub Y N 192 PHE CG CD2 sing Y N 193 PHE CD1 CE1 sing Y N 194 PHE CD1 HD1 sing N N 195 PHE CD2 CE2 doub Y N 196 PHE CD2 HD2 sing N N 197 PHE CE1 CZ doub Y N 198 PHE CE1 HE1 sing N N 199 PHE CE2 CZ sing Y N 200 PHE CE2 HE2 sing N N 201 PHE CZ HZ sing N N 202 PHE OXT HXT sing N N 203 PRO N CA sing N N 204 PRO N CD sing N N 205 PRO N H sing N N 206 PRO CA C sing N N 207 PRO CA CB sing N N 208 PRO CA HA sing N N 209 PRO C O doub N N 210 PRO C OXT sing N N 211 PRO CB CG sing N N 212 PRO CB HB2 sing N N 213 PRO CB HB3 sing N N 214 PRO CG CD sing N N 215 PRO CG HG2 sing N N 216 PRO CG HG3 sing N N 217 PRO CD HD2 sing N N 218 PRO CD HD3 sing N N 219 PRO OXT HXT sing N N 220 VAL N CA sing N N 221 VAL N H sing N N 222 VAL N H2 sing N N 223 VAL CA C sing N N 224 VAL CA CB sing N N 225 VAL CA HA sing N N 226 VAL C O doub N N 227 VAL C OXT sing N N 228 VAL CB CG1 sing N N 229 VAL CB CG2 sing N N 230 VAL CB HB sing N N 231 VAL CG1 HG11 sing N N 232 VAL CG1 HG12 sing N N 233 VAL CG1 HG13 sing N N 234 VAL CG2 HG21 sing N N 235 VAL CG2 HG22 sing N N 236 VAL CG2 HG23 sing N N 237 VAL OXT HXT sing N N 238 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 9C90 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.012794 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012794 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012794 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C HO N O S # loop_ # loop_ #