data_9CB2 # _entry.id 9CB2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.408 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9CB2 pdb_00009cb2 10.2210/pdb9cb2/pdb WWPDB D_1000285113 ? ? BMRB 31178 ? 10.13018/BMR31178 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-12-24 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9CB2 _pdbx_database_status.recvd_initial_deposition_date 2024-06-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR structure of the S. pombe Slr1 La motif RNA binding domain' _pdbx_database_related.db_id 31178 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email logand@yorku.ca _pdbx_contact_author.name_first Logan _pdbx_contact_author.name_last Donaldson _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-5034-2699 # _audit_author.name 'Donaldson, L.W.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'NMR structure of the S. pombe Slr1 La Motif / to be published' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # _citation_author.citation_id primary _citation_author.name 'Donaldson, L.W.' _citation_author.ordinal 1 _citation_author.identifier_ORCID 0000-0001-5034-2699 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Uncharacterized HTH La-type RNA-binding protein C1527.03' _entity.formula_weight 13314.188 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'C343S, C383A' _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDVQAFLTSQLEYYFSIENLSKDMFLRKHMDDEGYVPLAFLASFNRIKSFSTDLNLLHAAAKASDIIDVAEDLQSPMSIK VRRKETWSPWILPSESRLKFEMAKYLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MDVQAFLTSQLEYYFSIENLSKDMFLRKHMDDEGYVPLAFLASFNRIKSFSTDLNLLHAAAKASDIIDVAEDLQSPMSIK VRRKETWSPWILPSESRLKFEMAKYLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 VAL n 1 4 GLN n 1 5 ALA n 1 6 PHE n 1 7 LEU n 1 8 THR n 1 9 SER n 1 10 GLN n 1 11 LEU n 1 12 GLU n 1 13 TYR n 1 14 TYR n 1 15 PHE n 1 16 SER n 1 17 ILE n 1 18 GLU n 1 19 ASN n 1 20 LEU n 1 21 SER n 1 22 LYS n 1 23 ASP n 1 24 MET n 1 25 PHE n 1 26 LEU n 1 27 ARG n 1 28 LYS n 1 29 HIS n 1 30 MET n 1 31 ASP n 1 32 ASP n 1 33 GLU n 1 34 GLY n 1 35 TYR n 1 36 VAL n 1 37 PRO n 1 38 LEU n 1 39 ALA n 1 40 PHE n 1 41 LEU n 1 42 ALA n 1 43 SER n 1 44 PHE n 1 45 ASN n 1 46 ARG n 1 47 ILE n 1 48 LYS n 1 49 SER n 1 50 PHE n 1 51 SER n 1 52 THR n 1 53 ASP n 1 54 LEU n 1 55 ASN n 1 56 LEU n 1 57 LEU n 1 58 HIS n 1 59 ALA n 1 60 ALA n 1 61 ALA n 1 62 LYS n 1 63 ALA n 1 64 SER n 1 65 ASP n 1 66 ILE n 1 67 ILE n 1 68 ASP n 1 69 VAL n 1 70 ALA n 1 71 GLU n 1 72 ASP n 1 73 LEU n 1 74 GLN n 1 75 SER n 1 76 PRO n 1 77 MET n 1 78 SER n 1 79 ILE n 1 80 LYS n 1 81 VAL n 1 82 ARG n 1 83 ARG n 1 84 LYS n 1 85 GLU n 1 86 THR n 1 87 TRP n 1 88 SER n 1 89 PRO n 1 90 TRP n 1 91 ILE n 1 92 LEU n 1 93 PRO n 1 94 SER n 1 95 GLU n 1 96 SER n 1 97 ARG n 1 98 LEU n 1 99 LYS n 1 100 PHE n 1 101 GLU n 1 102 MET n 1 103 ALA n 1 104 LYS n 1 105 TYR n 1 106 LEU n 1 107 GLU n 1 108 HIS n 1 109 HIS n 1 110 HIS n 1 111 HIS n 1 112 HIS n 1 113 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 113 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene SPAC1527.03 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain '972 / ATCC 24843' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Schizosaccharomyces pombe 972h-' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 284812 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21:DE3 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET29 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 MET 24 24 24 MET MET A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 MET 30 30 30 MET MET A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 PHE 50 50 50 PHE PHE A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 LYS 62 62 62 LYS LYS A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 ASP 65 65 65 ASP ASP A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 MET 77 77 77 MET MET A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 TRP 87 87 87 TRP TRP A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 TRP 90 90 90 TRP TRP A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 LYS 99 99 ? ? ? A . n A 1 100 PHE 100 100 ? ? ? A . n A 1 101 GLU 101 101 ? ? ? A . n A 1 102 MET 102 102 ? ? ? A . n A 1 103 ALA 103 103 ? ? ? A . n A 1 104 LYS 104 104 ? ? ? A . n A 1 105 TYR 105 105 ? ? ? A . n A 1 106 LEU 106 106 ? ? ? A . n A 1 107 GLU 107 107 ? ? ? A . n A 1 108 HIS 108 108 ? ? ? A . n A 1 109 HIS 109 109 ? ? ? A . n A 1 110 HIS 110 110 ? ? ? A . n A 1 111 HIS 111 111 ? ? ? A . n A 1 112 HIS 112 112 ? ? ? A . n A 1 113 HIS 113 113 ? ? ? A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9CB2 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9CB2 _struct.title 'NMR structure of the S. pombe Slr1 La motif RNA binding domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9CB2 _struct_keywords.text 'translation factor, LARP family protein, RNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code YLA3_SCHPO _struct_ref.pdbx_db_accession Q9P6K0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DVQAFLTSQLEYYFSIENLCKDMFLRKHMDDEGYVPLAFLASFNRIKSFSTDLNLLHAACKASDIIDVAIDLQSPMSIKV RRKETWSPWILPSESRLKFEMAKY ; _struct_ref.pdbx_align_begin 324 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9CB2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 105 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9P6K0 _struct_ref_seq.db_align_beg 324 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 427 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 105 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9CB2 MET A 1 ? UNP Q9P6K0 ? ? 'initiating methionine' 1 1 1 9CB2 SER A 21 ? UNP Q9P6K0 CYS 343 'engineered mutation' 21 2 1 9CB2 ALA A 61 ? UNP Q9P6K0 CYS 383 'engineered mutation' 61 3 1 9CB2 GLU A 71 ? UNP Q9P6K0 ILE 393 conflict 71 4 1 9CB2 LEU A 106 ? UNP Q9P6K0 ? ? 'expression tag' 106 5 1 9CB2 GLU A 107 ? UNP Q9P6K0 ? ? 'expression tag' 107 6 1 9CB2 HIS A 108 ? UNP Q9P6K0 ? ? 'expression tag' 108 7 1 9CB2 HIS A 109 ? UNP Q9P6K0 ? ? 'expression tag' 109 8 1 9CB2 HIS A 110 ? UNP Q9P6K0 ? ? 'expression tag' 110 9 1 9CB2 HIS A 111 ? UNP Q9P6K0 ? ? 'expression tag' 111 10 1 9CB2 HIS A 112 ? UNP Q9P6K0 ? ? 'expression tag' 112 11 1 9CB2 HIS A 113 ? UNP Q9P6K0 ? ? 'expression tag' 113 12 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 2 ? PHE A 15 ? ASP A 2 PHE A 15 1 ? 14 HELX_P HELX_P2 AA2 SER A 16 ? ASP A 23 ? SER A 16 ASP A 23 1 ? 8 HELX_P HELX_P3 AA3 ASP A 23 ? HIS A 29 ? ASP A 23 HIS A 29 1 ? 7 HELX_P HELX_P4 AA4 LEU A 38 ? ALA A 42 ? LEU A 38 ALA A 42 1 ? 5 HELX_P HELX_P5 AA5 PHE A 44 ? SER A 51 ? PHE A 44 SER A 51 1 ? 8 HELX_P HELX_P6 AA6 ASP A 53 ? ALA A 63 ? ASP A 53 ALA A 63 1 ? 11 HELX_P HELX_P7 AA7 SER A 75 ? SER A 78 ? SER A 75 SER A 78 5 ? 4 HELX_P HELX_P8 AA8 PRO A 93 ? ARG A 97 ? PRO A 93 ARG A 97 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 36 ? PRO A 37 ? VAL A 36 PRO A 37 AA1 2 LYS A 80 ? ARG A 83 ? LYS A 80 ARG A 83 AA1 3 ILE A 67 ? ALA A 70 ? ILE A 67 ALA A 70 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 36 ? N VAL A 36 O VAL A 81 ? O VAL A 81 AA1 2 3 O ARG A 82 ? O ARG A 82 N ASP A 68 ? N ASP A 68 # _pdbx_entry_details.entry_id 9CB2 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 O A PHE 40 ? ? HG A SER 43 ? ? 1.59 2 5 O A PHE 40 ? ? HG A SER 43 ? ? 1.57 3 8 O A PHE 40 ? ? HG A SER 43 ? ? 1.59 4 9 O A PHE 40 ? ? HG A SER 43 ? ? 1.59 5 13 O A PRO 93 ? ? HG A SER 96 ? ? 1.60 6 15 O A PHE 40 ? ? HG A SER 43 ? ? 1.58 7 18 O A PHE 40 ? ? HG A SER 43 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 3 THR A 86 ? ? -123.02 -108.61 2 6 THR A 86 ? ? -125.04 -90.22 3 6 TRP A 90 ? ? -107.29 64.50 4 7 SER A 88 ? ? -170.61 143.18 5 8 THR A 86 ? ? -135.16 -35.64 6 11 SER A 88 ? ? -151.69 85.15 7 17 THR A 86 ? ? 60.79 73.01 8 17 SER A 88 ? ? -153.38 69.98 9 18 THR A 86 ? ? -124.37 -91.14 10 18 TRP A 90 ? ? -107.09 69.35 # _pdbx_nmr_ensemble.entry_id 9CB2 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9CB2 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;0.8 mM [U-99% 13C; U-99% 15N] Schizosaccharomyces pombe Slr1 La motif, 10 mM sodium phosphate, 60 mM sodium chloride, 0.05 % w/v sodium azide, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label sample_1 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details '0.8 mM protein / main NMR sample' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Schizosaccharomyces pombe Slr1 La motif' 0.8 ? mM '[U-99% 13C; U-99% 15N]' 1 'sodium phosphate' 10 ? mM 'natural abundance' 1 'sodium chloride' 60 ? mM 'natural abundance' 1 'sodium azide' 0.05 ? '% w/v' 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.6 _pdbx_nmr_exptl_sample_conditions.ionic_strength 60 _pdbx_nmr_exptl_sample_conditions.details 'main NMR sample conditions' _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC' 1 isotropic 3 1 1 '2D 1H-13C HSQC aliphatic' 1 isotropic 4 1 1 '2D 1H-13C HSQC aromatic' 1 isotropic 5 1 1 '3D HNCACB' 1 isotropic 16 1 1 '3D HNCA' 1 isotropic 15 1 1 '3D HNCO' 1 isotropic 14 1 1 '3D CBCA(CO)NH' 1 isotropic 13 1 1 '3D HN(CA)CO' 1 isotropic 12 1 1 '3D HCCH-TOCSY' 1 isotropic 11 1 1 '3D HCCH-TOCSY' 1 isotropic 10 1 1 '3D H(CCO)NH' 1 isotropic 9 1 1 '3D 1H-15N NOESY' 1 isotropic 8 1 1 '3D 1H-13C NOESY' 1 isotropic # _pdbx_nmr_refine.entry_id 9CB2 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement Rosetta ? Baker 2 'structure calculation' CYANA 3 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 4 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 5 'peak picking' 'CcpNmr Analysis' ? CCPN # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LYS 99 ? A LYS 99 2 1 Y 1 A PHE 100 ? A PHE 100 3 1 Y 1 A GLU 101 ? A GLU 101 4 1 Y 1 A MET 102 ? A MET 102 5 1 Y 1 A ALA 103 ? A ALA 103 6 1 Y 1 A LYS 104 ? A LYS 104 7 1 Y 1 A TYR 105 ? A TYR 105 8 1 Y 1 A LEU 106 ? A LEU 106 9 1 Y 1 A GLU 107 ? A GLU 107 10 1 Y 1 A HIS 108 ? A HIS 108 11 1 Y 1 A HIS 109 ? A HIS 109 12 1 Y 1 A HIS 110 ? A HIS 110 13 1 Y 1 A HIS 111 ? A HIS 111 14 1 Y 1 A HIS 112 ? A HIS 112 15 1 Y 1 A HIS 113 ? A HIS 113 16 2 Y 1 A LYS 99 ? A LYS 99 17 2 Y 1 A PHE 100 ? A PHE 100 18 2 Y 1 A GLU 101 ? A GLU 101 19 2 Y 1 A MET 102 ? A MET 102 20 2 Y 1 A ALA 103 ? A ALA 103 21 2 Y 1 A LYS 104 ? A LYS 104 22 2 Y 1 A TYR 105 ? A TYR 105 23 2 Y 1 A LEU 106 ? A LEU 106 24 2 Y 1 A GLU 107 ? A GLU 107 25 2 Y 1 A HIS 108 ? A HIS 108 26 2 Y 1 A HIS 109 ? A HIS 109 27 2 Y 1 A HIS 110 ? A HIS 110 28 2 Y 1 A HIS 111 ? A HIS 111 29 2 Y 1 A HIS 112 ? A HIS 112 30 2 Y 1 A HIS 113 ? A HIS 113 31 3 Y 1 A LYS 99 ? A LYS 99 32 3 Y 1 A PHE 100 ? A PHE 100 33 3 Y 1 A GLU 101 ? A GLU 101 34 3 Y 1 A MET 102 ? A MET 102 35 3 Y 1 A ALA 103 ? A ALA 103 36 3 Y 1 A LYS 104 ? A LYS 104 37 3 Y 1 A TYR 105 ? A TYR 105 38 3 Y 1 A LEU 106 ? A LEU 106 39 3 Y 1 A GLU 107 ? A GLU 107 40 3 Y 1 A HIS 108 ? A HIS 108 41 3 Y 1 A HIS 109 ? A HIS 109 42 3 Y 1 A HIS 110 ? A HIS 110 43 3 Y 1 A HIS 111 ? A HIS 111 44 3 Y 1 A HIS 112 ? A HIS 112 45 3 Y 1 A HIS 113 ? A HIS 113 46 4 Y 1 A LYS 99 ? A LYS 99 47 4 Y 1 A PHE 100 ? A PHE 100 48 4 Y 1 A GLU 101 ? A GLU 101 49 4 Y 1 A MET 102 ? A MET 102 50 4 Y 1 A ALA 103 ? A ALA 103 51 4 Y 1 A LYS 104 ? A LYS 104 52 4 Y 1 A TYR 105 ? A TYR 105 53 4 Y 1 A LEU 106 ? A LEU 106 54 4 Y 1 A GLU 107 ? A GLU 107 55 4 Y 1 A HIS 108 ? A HIS 108 56 4 Y 1 A HIS 109 ? A HIS 109 57 4 Y 1 A HIS 110 ? A HIS 110 58 4 Y 1 A HIS 111 ? A HIS 111 59 4 Y 1 A HIS 112 ? A HIS 112 60 4 Y 1 A HIS 113 ? A HIS 113 61 5 Y 1 A LYS 99 ? A LYS 99 62 5 Y 1 A PHE 100 ? A PHE 100 63 5 Y 1 A GLU 101 ? A GLU 101 64 5 Y 1 A MET 102 ? A MET 102 65 5 Y 1 A ALA 103 ? A ALA 103 66 5 Y 1 A LYS 104 ? A LYS 104 67 5 Y 1 A TYR 105 ? A TYR 105 68 5 Y 1 A LEU 106 ? A LEU 106 69 5 Y 1 A GLU 107 ? A GLU 107 70 5 Y 1 A HIS 108 ? A HIS 108 71 5 Y 1 A HIS 109 ? A HIS 109 72 5 Y 1 A HIS 110 ? A HIS 110 73 5 Y 1 A HIS 111 ? A HIS 111 74 5 Y 1 A HIS 112 ? A HIS 112 75 5 Y 1 A HIS 113 ? A HIS 113 76 6 Y 1 A LYS 99 ? A LYS 99 77 6 Y 1 A PHE 100 ? A PHE 100 78 6 Y 1 A GLU 101 ? A GLU 101 79 6 Y 1 A MET 102 ? A MET 102 80 6 Y 1 A ALA 103 ? A ALA 103 81 6 Y 1 A LYS 104 ? A LYS 104 82 6 Y 1 A TYR 105 ? A TYR 105 83 6 Y 1 A LEU 106 ? A LEU 106 84 6 Y 1 A GLU 107 ? A GLU 107 85 6 Y 1 A HIS 108 ? A HIS 108 86 6 Y 1 A HIS 109 ? A HIS 109 87 6 Y 1 A HIS 110 ? A HIS 110 88 6 Y 1 A HIS 111 ? A HIS 111 89 6 Y 1 A HIS 112 ? A HIS 112 90 6 Y 1 A HIS 113 ? A HIS 113 91 7 Y 1 A LYS 99 ? A LYS 99 92 7 Y 1 A PHE 100 ? A PHE 100 93 7 Y 1 A GLU 101 ? A GLU 101 94 7 Y 1 A MET 102 ? A MET 102 95 7 Y 1 A ALA 103 ? A ALA 103 96 7 Y 1 A LYS 104 ? A LYS 104 97 7 Y 1 A TYR 105 ? A TYR 105 98 7 Y 1 A LEU 106 ? A LEU 106 99 7 Y 1 A GLU 107 ? A GLU 107 100 7 Y 1 A HIS 108 ? A HIS 108 101 7 Y 1 A HIS 109 ? A HIS 109 102 7 Y 1 A HIS 110 ? A HIS 110 103 7 Y 1 A HIS 111 ? A HIS 111 104 7 Y 1 A HIS 112 ? A HIS 112 105 7 Y 1 A HIS 113 ? A HIS 113 106 8 Y 1 A LYS 99 ? A LYS 99 107 8 Y 1 A PHE 100 ? A PHE 100 108 8 Y 1 A GLU 101 ? A GLU 101 109 8 Y 1 A MET 102 ? A MET 102 110 8 Y 1 A ALA 103 ? A ALA 103 111 8 Y 1 A LYS 104 ? A LYS 104 112 8 Y 1 A TYR 105 ? A TYR 105 113 8 Y 1 A LEU 106 ? A LEU 106 114 8 Y 1 A GLU 107 ? A GLU 107 115 8 Y 1 A HIS 108 ? A HIS 108 116 8 Y 1 A HIS 109 ? A HIS 109 117 8 Y 1 A HIS 110 ? A HIS 110 118 8 Y 1 A HIS 111 ? A HIS 111 119 8 Y 1 A HIS 112 ? A HIS 112 120 8 Y 1 A HIS 113 ? A HIS 113 121 9 Y 1 A LYS 99 ? A LYS 99 122 9 Y 1 A PHE 100 ? A PHE 100 123 9 Y 1 A GLU 101 ? A GLU 101 124 9 Y 1 A MET 102 ? A MET 102 125 9 Y 1 A ALA 103 ? A ALA 103 126 9 Y 1 A LYS 104 ? A LYS 104 127 9 Y 1 A TYR 105 ? A TYR 105 128 9 Y 1 A LEU 106 ? A LEU 106 129 9 Y 1 A GLU 107 ? A GLU 107 130 9 Y 1 A HIS 108 ? A HIS 108 131 9 Y 1 A HIS 109 ? A HIS 109 132 9 Y 1 A HIS 110 ? A HIS 110 133 9 Y 1 A HIS 111 ? A HIS 111 134 9 Y 1 A HIS 112 ? A HIS 112 135 9 Y 1 A HIS 113 ? A HIS 113 136 10 Y 1 A LYS 99 ? A LYS 99 137 10 Y 1 A PHE 100 ? A PHE 100 138 10 Y 1 A GLU 101 ? A GLU 101 139 10 Y 1 A MET 102 ? A MET 102 140 10 Y 1 A ALA 103 ? A ALA 103 141 10 Y 1 A LYS 104 ? A LYS 104 142 10 Y 1 A TYR 105 ? A TYR 105 143 10 Y 1 A LEU 106 ? A LEU 106 144 10 Y 1 A GLU 107 ? A GLU 107 145 10 Y 1 A HIS 108 ? A HIS 108 146 10 Y 1 A HIS 109 ? A HIS 109 147 10 Y 1 A HIS 110 ? A HIS 110 148 10 Y 1 A HIS 111 ? A HIS 111 149 10 Y 1 A HIS 112 ? A HIS 112 150 10 Y 1 A HIS 113 ? A HIS 113 151 11 Y 1 A LYS 99 ? A LYS 99 152 11 Y 1 A PHE 100 ? A PHE 100 153 11 Y 1 A GLU 101 ? A GLU 101 154 11 Y 1 A MET 102 ? A MET 102 155 11 Y 1 A ALA 103 ? A ALA 103 156 11 Y 1 A LYS 104 ? A LYS 104 157 11 Y 1 A TYR 105 ? A TYR 105 158 11 Y 1 A LEU 106 ? A LEU 106 159 11 Y 1 A GLU 107 ? A GLU 107 160 11 Y 1 A HIS 108 ? A HIS 108 161 11 Y 1 A HIS 109 ? A HIS 109 162 11 Y 1 A HIS 110 ? A HIS 110 163 11 Y 1 A HIS 111 ? A HIS 111 164 11 Y 1 A HIS 112 ? A HIS 112 165 11 Y 1 A HIS 113 ? A HIS 113 166 12 Y 1 A LYS 99 ? A LYS 99 167 12 Y 1 A PHE 100 ? A PHE 100 168 12 Y 1 A GLU 101 ? A GLU 101 169 12 Y 1 A MET 102 ? A MET 102 170 12 Y 1 A ALA 103 ? A ALA 103 171 12 Y 1 A LYS 104 ? A LYS 104 172 12 Y 1 A TYR 105 ? A TYR 105 173 12 Y 1 A LEU 106 ? A LEU 106 174 12 Y 1 A GLU 107 ? A GLU 107 175 12 Y 1 A HIS 108 ? A HIS 108 176 12 Y 1 A HIS 109 ? A HIS 109 177 12 Y 1 A HIS 110 ? A HIS 110 178 12 Y 1 A HIS 111 ? A HIS 111 179 12 Y 1 A HIS 112 ? A HIS 112 180 12 Y 1 A HIS 113 ? A HIS 113 181 13 Y 1 A LYS 99 ? A LYS 99 182 13 Y 1 A PHE 100 ? A PHE 100 183 13 Y 1 A GLU 101 ? A GLU 101 184 13 Y 1 A MET 102 ? A MET 102 185 13 Y 1 A ALA 103 ? A ALA 103 186 13 Y 1 A LYS 104 ? A LYS 104 187 13 Y 1 A TYR 105 ? A TYR 105 188 13 Y 1 A LEU 106 ? A LEU 106 189 13 Y 1 A GLU 107 ? A GLU 107 190 13 Y 1 A HIS 108 ? A HIS 108 191 13 Y 1 A HIS 109 ? A HIS 109 192 13 Y 1 A HIS 110 ? A HIS 110 193 13 Y 1 A HIS 111 ? A HIS 111 194 13 Y 1 A HIS 112 ? A HIS 112 195 13 Y 1 A HIS 113 ? A HIS 113 196 14 Y 1 A LYS 99 ? A LYS 99 197 14 Y 1 A PHE 100 ? A PHE 100 198 14 Y 1 A GLU 101 ? A GLU 101 199 14 Y 1 A MET 102 ? A MET 102 200 14 Y 1 A ALA 103 ? A ALA 103 201 14 Y 1 A LYS 104 ? A LYS 104 202 14 Y 1 A TYR 105 ? A TYR 105 203 14 Y 1 A LEU 106 ? A LEU 106 204 14 Y 1 A GLU 107 ? A GLU 107 205 14 Y 1 A HIS 108 ? A HIS 108 206 14 Y 1 A HIS 109 ? A HIS 109 207 14 Y 1 A HIS 110 ? A HIS 110 208 14 Y 1 A HIS 111 ? A HIS 111 209 14 Y 1 A HIS 112 ? A HIS 112 210 14 Y 1 A HIS 113 ? A HIS 113 211 15 Y 1 A LYS 99 ? A LYS 99 212 15 Y 1 A PHE 100 ? A PHE 100 213 15 Y 1 A GLU 101 ? A GLU 101 214 15 Y 1 A MET 102 ? A MET 102 215 15 Y 1 A ALA 103 ? A ALA 103 216 15 Y 1 A LYS 104 ? A LYS 104 217 15 Y 1 A TYR 105 ? A TYR 105 218 15 Y 1 A LEU 106 ? A LEU 106 219 15 Y 1 A GLU 107 ? A GLU 107 220 15 Y 1 A HIS 108 ? A HIS 108 221 15 Y 1 A HIS 109 ? A HIS 109 222 15 Y 1 A HIS 110 ? A HIS 110 223 15 Y 1 A HIS 111 ? A HIS 111 224 15 Y 1 A HIS 112 ? A HIS 112 225 15 Y 1 A HIS 113 ? A HIS 113 226 16 Y 1 A LYS 99 ? A LYS 99 227 16 Y 1 A PHE 100 ? A PHE 100 228 16 Y 1 A GLU 101 ? A GLU 101 229 16 Y 1 A MET 102 ? A MET 102 230 16 Y 1 A ALA 103 ? A ALA 103 231 16 Y 1 A LYS 104 ? A LYS 104 232 16 Y 1 A TYR 105 ? A TYR 105 233 16 Y 1 A LEU 106 ? A LEU 106 234 16 Y 1 A GLU 107 ? A GLU 107 235 16 Y 1 A HIS 108 ? A HIS 108 236 16 Y 1 A HIS 109 ? A HIS 109 237 16 Y 1 A HIS 110 ? A HIS 110 238 16 Y 1 A HIS 111 ? A HIS 111 239 16 Y 1 A HIS 112 ? A HIS 112 240 16 Y 1 A HIS 113 ? A HIS 113 241 17 Y 1 A LYS 99 ? A LYS 99 242 17 Y 1 A PHE 100 ? A PHE 100 243 17 Y 1 A GLU 101 ? A GLU 101 244 17 Y 1 A MET 102 ? A MET 102 245 17 Y 1 A ALA 103 ? A ALA 103 246 17 Y 1 A LYS 104 ? A LYS 104 247 17 Y 1 A TYR 105 ? A TYR 105 248 17 Y 1 A LEU 106 ? A LEU 106 249 17 Y 1 A GLU 107 ? A GLU 107 250 17 Y 1 A HIS 108 ? A HIS 108 251 17 Y 1 A HIS 109 ? A HIS 109 252 17 Y 1 A HIS 110 ? A HIS 110 253 17 Y 1 A HIS 111 ? A HIS 111 254 17 Y 1 A HIS 112 ? A HIS 112 255 17 Y 1 A HIS 113 ? A HIS 113 256 18 Y 1 A LYS 99 ? A LYS 99 257 18 Y 1 A PHE 100 ? A PHE 100 258 18 Y 1 A GLU 101 ? A GLU 101 259 18 Y 1 A MET 102 ? A MET 102 260 18 Y 1 A ALA 103 ? A ALA 103 261 18 Y 1 A LYS 104 ? A LYS 104 262 18 Y 1 A TYR 105 ? A TYR 105 263 18 Y 1 A LEU 106 ? A LEU 106 264 18 Y 1 A GLU 107 ? A GLU 107 265 18 Y 1 A HIS 108 ? A HIS 108 266 18 Y 1 A HIS 109 ? A HIS 109 267 18 Y 1 A HIS 110 ? A HIS 110 268 18 Y 1 A HIS 111 ? A HIS 111 269 18 Y 1 A HIS 112 ? A HIS 112 270 18 Y 1 A HIS 113 ? A HIS 113 271 19 Y 1 A LYS 99 ? A LYS 99 272 19 Y 1 A PHE 100 ? A PHE 100 273 19 Y 1 A GLU 101 ? A GLU 101 274 19 Y 1 A MET 102 ? A MET 102 275 19 Y 1 A ALA 103 ? A ALA 103 276 19 Y 1 A LYS 104 ? A LYS 104 277 19 Y 1 A TYR 105 ? A TYR 105 278 19 Y 1 A LEU 106 ? A LEU 106 279 19 Y 1 A GLU 107 ? A GLU 107 280 19 Y 1 A HIS 108 ? A HIS 108 281 19 Y 1 A HIS 109 ? A HIS 109 282 19 Y 1 A HIS 110 ? A HIS 110 283 19 Y 1 A HIS 111 ? A HIS 111 284 19 Y 1 A HIS 112 ? A HIS 112 285 19 Y 1 A HIS 113 ? A HIS 113 286 20 Y 1 A LYS 99 ? A LYS 99 287 20 Y 1 A PHE 100 ? A PHE 100 288 20 Y 1 A GLU 101 ? A GLU 101 289 20 Y 1 A MET 102 ? A MET 102 290 20 Y 1 A ALA 103 ? A ALA 103 291 20 Y 1 A LYS 104 ? A LYS 104 292 20 Y 1 A TYR 105 ? A TYR 105 293 20 Y 1 A LEU 106 ? A LEU 106 294 20 Y 1 A GLU 107 ? A GLU 107 295 20 Y 1 A HIS 108 ? A HIS 108 296 20 Y 1 A HIS 109 ? A HIS 109 297 20 Y 1 A HIS 110 ? A HIS 110 298 20 Y 1 A HIS 111 ? A HIS 111 299 20 Y 1 A HIS 112 ? A HIS 112 300 20 Y 1 A HIS 113 ? A HIS 113 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_audit_support.funding_organization 'Natural Sciences and Engineering Research Council (NSERC, Canada)' _pdbx_audit_support.country Canada _pdbx_audit_support.grant_number 2018-05838 _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III HD' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 9CB2 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #