data_9CCX # _entry.id 9CCX # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.402 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9CCX pdb_00009ccx 10.2210/pdb9ccx/pdb WWPDB D_1000285066 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-02-12 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9CCX _pdbx_database_status.recvd_initial_deposition_date 2024-06-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 2 _pdbx_contact_author.email peizhou@biochem.duke.edu _pdbx_contact_author.name_first Pei _pdbx_contact_author.name_last Zhou _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7823-3416 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Cochrane, C.S.' 1 ? 'Zhou, P.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Jacs Au' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2691-3704 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 4 _citation.language ? _citation.page_first 4383 _citation.page_last 4393 _citation.title 'Design and Evaluation of Pyridinyl Sulfonyl Piperazine LpxH Inhibitors with Potent Antibiotic Activity Against Enterobacterales.' _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacsau.4c00731 _citation.pdbx_database_id_PubMed 39610720 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ennis, A.F.' 1 ? primary 'Cochrane, C.S.' 2 ? primary 'Dome, P.A.' 3 ? primary 'Jeong, P.' 4 ? primary 'Yu, J.' 5 0000-0001-8487-5565 primary 'Lee, H.' 6 ? primary 'Williams, C.S.' 7 ? primary 'Ha, Y.' 8 0000-0001-5684-8420 primary 'Yang, W.' 9 0000-0001-5576-2828 primary 'Zhou, P.' 10 0000-0002-7823-3416 primary 'Hong, J.' 11 0000-0002-5253-0949 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'UDP-2,3-diacylglucosamine hydrolase' 29627.680 1 3.6.1.54 ? ? ? 2 non-polymer syn '1-(5-{4-[4-(trifluoromethyl)pyridin-2-yl]piperazine-1-sulfonyl}-2,3-dihydro-1H-indol-1-yl)ethan-1-one' 454.466 1 ? ? ? ? 3 non-polymer syn 'TETRAETHYLENE GLYCOL' 194.226 1 ? ? ? ? 4 non-polymer syn 'MANGANESE (II) ION' 54.938 2 ? ? ? ? 5 water nat water 18.015 41 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'UDP-2,3-diacylglucosamine diphosphatase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MATLFIADLHLQTEEPAITAGFLRFLQGEARQADALYILGDLFEAWIGDDDPNPLHQQIASAIKAVVDAGVPCYFIHGNR DFLVGQRFARQSGMILLAEEERLDLYGREVLIMHGDTLCTDDQGYLAFRAKVHTPWIQRLFLALPLFIRHRIAARMRADS KAANSSKSMEIMDVNPQAVVDAMERHHVQWLIHGHTHRPAVHELQANGQPAWRVVLGAWHSEGSMVKVTPDDVELIHFPF LEENLYFQSHHHHHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MATLFIADLHLQTEEPAITAGFLRFLQGEARQADALYILGDLFEAWIGDDDPNPLHQQIASAIKAVVDAGVPCYFIHGNR DFLVGQRFARQSGMILLAEEERLDLYGREVLIMHGDTLCTDDQGYLAFRAKVHTPWIQRLFLALPLFIRHRIAARMRADS KAANSSKSMEIMDVNPQAVVDAMERHHVQWLIHGHTHRPAVHELQANGQPAWRVVLGAWHSEGSMVKVTPDDVELIHFPF LEENLYFQSHHHHHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '1-(5-{4-[4-(trifluoromethyl)pyridin-2-yl]piperazine-1-sulfonyl}-2,3-dihydro-1H-indol-1-yl)ethan-1-one' A1AVZ 3 'TETRAETHYLENE GLYCOL' PG4 4 'MANGANESE (II) ION' MN 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 THR n 1 4 LEU n 1 5 PHE n 1 6 ILE n 1 7 ALA n 1 8 ASP n 1 9 LEU n 1 10 HIS n 1 11 LEU n 1 12 GLN n 1 13 THR n 1 14 GLU n 1 15 GLU n 1 16 PRO n 1 17 ALA n 1 18 ILE n 1 19 THR n 1 20 ALA n 1 21 GLY n 1 22 PHE n 1 23 LEU n 1 24 ARG n 1 25 PHE n 1 26 LEU n 1 27 GLN n 1 28 GLY n 1 29 GLU n 1 30 ALA n 1 31 ARG n 1 32 GLN n 1 33 ALA n 1 34 ASP n 1 35 ALA n 1 36 LEU n 1 37 TYR n 1 38 ILE n 1 39 LEU n 1 40 GLY n 1 41 ASP n 1 42 LEU n 1 43 PHE n 1 44 GLU n 1 45 ALA n 1 46 TRP n 1 47 ILE n 1 48 GLY n 1 49 ASP n 1 50 ASP n 1 51 ASP n 1 52 PRO n 1 53 ASN n 1 54 PRO n 1 55 LEU n 1 56 HIS n 1 57 GLN n 1 58 GLN n 1 59 ILE n 1 60 ALA n 1 61 SER n 1 62 ALA n 1 63 ILE n 1 64 LYS n 1 65 ALA n 1 66 VAL n 1 67 VAL n 1 68 ASP n 1 69 ALA n 1 70 GLY n 1 71 VAL n 1 72 PRO n 1 73 CYS n 1 74 TYR n 1 75 PHE n 1 76 ILE n 1 77 HIS n 1 78 GLY n 1 79 ASN n 1 80 ARG n 1 81 ASP n 1 82 PHE n 1 83 LEU n 1 84 VAL n 1 85 GLY n 1 86 GLN n 1 87 ARG n 1 88 PHE n 1 89 ALA n 1 90 ARG n 1 91 GLN n 1 92 SER n 1 93 GLY n 1 94 MET n 1 95 ILE n 1 96 LEU n 1 97 LEU n 1 98 ALA n 1 99 GLU n 1 100 GLU n 1 101 GLU n 1 102 ARG n 1 103 LEU n 1 104 ASP n 1 105 LEU n 1 106 TYR n 1 107 GLY n 1 108 ARG n 1 109 GLU n 1 110 VAL n 1 111 LEU n 1 112 ILE n 1 113 MET n 1 114 HIS n 1 115 GLY n 1 116 ASP n 1 117 THR n 1 118 LEU n 1 119 CYS n 1 120 THR n 1 121 ASP n 1 122 ASP n 1 123 GLN n 1 124 GLY n 1 125 TYR n 1 126 LEU n 1 127 ALA n 1 128 PHE n 1 129 ARG n 1 130 ALA n 1 131 LYS n 1 132 VAL n 1 133 HIS n 1 134 THR n 1 135 PRO n 1 136 TRP n 1 137 ILE n 1 138 GLN n 1 139 ARG n 1 140 LEU n 1 141 PHE n 1 142 LEU n 1 143 ALA n 1 144 LEU n 1 145 PRO n 1 146 LEU n 1 147 PHE n 1 148 ILE n 1 149 ARG n 1 150 HIS n 1 151 ARG n 1 152 ILE n 1 153 ALA n 1 154 ALA n 1 155 ARG n 1 156 MET n 1 157 ARG n 1 158 ALA n 1 159 ASP n 1 160 SER n 1 161 LYS n 1 162 ALA n 1 163 ALA n 1 164 ASN n 1 165 SER n 1 166 SER n 1 167 LYS n 1 168 SER n 1 169 MET n 1 170 GLU n 1 171 ILE n 1 172 MET n 1 173 ASP n 1 174 VAL n 1 175 ASN n 1 176 PRO n 1 177 GLN n 1 178 ALA n 1 179 VAL n 1 180 VAL n 1 181 ASP n 1 182 ALA n 1 183 MET n 1 184 GLU n 1 185 ARG n 1 186 HIS n 1 187 HIS n 1 188 VAL n 1 189 GLN n 1 190 TRP n 1 191 LEU n 1 192 ILE n 1 193 HIS n 1 194 GLY n 1 195 HIS n 1 196 THR n 1 197 HIS n 1 198 ARG n 1 199 PRO n 1 200 ALA n 1 201 VAL n 1 202 HIS n 1 203 GLU n 1 204 LEU n 1 205 GLN n 1 206 ALA n 1 207 ASN n 1 208 GLY n 1 209 GLN n 1 210 PRO n 1 211 ALA n 1 212 TRP n 1 213 ARG n 1 214 VAL n 1 215 VAL n 1 216 LEU n 1 217 GLY n 1 218 ALA n 1 219 TRP n 1 220 HIS n 1 221 SER n 1 222 GLU n 1 223 GLY n 1 224 SER n 1 225 MET n 1 226 VAL n 1 227 LYS n 1 228 VAL n 1 229 THR n 1 230 PRO n 1 231 ASP n 1 232 ASP n 1 233 VAL n 1 234 GLU n 1 235 LEU n 1 236 ILE n 1 237 HIS n 1 238 PHE n 1 239 PRO n 1 240 PHE n 1 241 LEU n 1 242 GLU n 1 243 GLU n 1 244 ASN n 1 245 LEU n 1 246 TYR n 1 247 PHE n 1 248 GLN n 1 249 SER n 1 250 HIS n 1 251 HIS n 1 252 HIS n 1 253 HIS n 1 254 HIS n 1 255 HIS n 1 256 HIS n 1 257 HIS n 1 258 HIS n 1 259 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 259 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'lpxH_1, lpxH, C3483_19950, NCTC9128_00880, SAMEA104305404_03891' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Klebsiella pneumoniae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 573 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1AVZ non-polymer . '1-(5-{4-[4-(trifluoromethyl)pyridin-2-yl]piperazine-1-sulfonyl}-2,3-dihydro-1H-indol-1-yl)ethan-1-one' ? 'C20 H21 F3 N4 O3 S' 454.466 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 PG4 non-polymer . 'TETRAETHYLENE GLYCOL' ? 'C8 H18 O5' 194.226 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 ASP 8 8 8 ASP ASP A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 TRP 46 46 46 TRP TRP A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 CYS 73 73 73 CYS CYS A . n A 1 74 TYR 74 74 74 TYR TYR A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 ARG 80 80 80 ARG ARG A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 ARG 90 90 90 ARG ARG A . n A 1 91 GLN 91 91 91 GLN GLN A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 MET 94 94 94 MET MET A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 TYR 106 106 106 TYR TYR A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 ARG 108 108 108 ARG ARG A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 MET 113 113 113 MET MET A . n A 1 114 HIS 114 114 114 HIS HIS A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 THR 117 117 117 THR THR A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 CYS 119 119 119 CYS CYS A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 GLN 123 123 123 GLN GLN A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 TYR 125 125 125 TYR TYR A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 ARG 129 129 129 ARG ARG A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 LYS 131 131 131 LYS LYS A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 HIS 133 133 133 HIS HIS A . n A 1 134 THR 134 134 134 THR THR A . n A 1 135 PRO 135 135 135 PRO PRO A . n A 1 136 TRP 136 136 136 TRP TRP A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 GLN 138 138 138 GLN GLN A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 PHE 141 141 141 PHE PHE A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 PRO 145 145 145 PRO PRO A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 PHE 147 147 147 PHE PHE A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 ARG 149 149 149 ARG ARG A . n A 1 150 HIS 150 150 150 HIS HIS A . n A 1 151 ARG 151 151 151 ARG ARG A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 ARG 155 155 155 ARG ARG A . n A 1 156 MET 156 156 156 MET MET A . n A 1 157 ARG 157 157 157 ARG ARG A . n A 1 158 ALA 158 158 158 ALA ALA A . n A 1 159 ASP 159 159 159 ASP ASP A . n A 1 160 SER 160 160 160 SER SER A . n A 1 161 LYS 161 161 161 LYS LYS A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 ASN 164 164 164 ASN ASN A . n A 1 165 SER 165 165 ? ? ? A . n A 1 166 SER 166 166 ? ? ? A . n A 1 167 LYS 167 167 ? ? ? A . n A 1 168 SER 168 168 ? ? ? A . n A 1 169 MET 169 169 ? ? ? A . n A 1 170 GLU 170 170 ? ? ? A . n A 1 171 ILE 171 171 ? ? ? A . n A 1 172 MET 172 172 172 MET MET A . n A 1 173 ASP 173 173 173 ASP ASP A . n A 1 174 VAL 174 174 174 VAL VAL A . n A 1 175 ASN 175 175 175 ASN ASN A . n A 1 176 PRO 176 176 176 PRO PRO A . n A 1 177 GLN 177 177 177 GLN GLN A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 VAL 179 179 179 VAL VAL A . n A 1 180 VAL 180 180 180 VAL VAL A . n A 1 181 ASP 181 181 181 ASP ASP A . n A 1 182 ALA 182 182 182 ALA ALA A . n A 1 183 MET 183 183 183 MET MET A . n A 1 184 GLU 184 184 184 GLU GLU A . n A 1 185 ARG 185 185 185 ARG ARG A . n A 1 186 HIS 186 186 186 HIS HIS A . n A 1 187 HIS 187 187 187 HIS HIS A . n A 1 188 VAL 188 188 188 VAL VAL A . n A 1 189 GLN 189 189 189 GLN GLN A . n A 1 190 TRP 190 190 190 TRP TRP A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 ILE 192 192 192 ILE ILE A . n A 1 193 HIS 193 193 193 HIS HIS A . n A 1 194 GLY 194 194 194 GLY GLY A . n A 1 195 HIS 195 195 195 HIS HIS A . n A 1 196 THR 196 196 196 THR THR A . n A 1 197 HIS 197 197 197 HIS HIS A . n A 1 198 ARG 198 198 198 ARG ARG A . n A 1 199 PRO 199 199 199 PRO PRO A . n A 1 200 ALA 200 200 200 ALA ALA A . n A 1 201 VAL 201 201 201 VAL VAL A . n A 1 202 HIS 202 202 202 HIS HIS A . n A 1 203 GLU 203 203 203 GLU GLU A . n A 1 204 LEU 204 204 204 LEU LEU A . n A 1 205 GLN 205 205 205 GLN GLN A . n A 1 206 ALA 206 206 206 ALA ALA A . n A 1 207 ASN 207 207 207 ASN ASN A . n A 1 208 GLY 208 208 208 GLY GLY A . n A 1 209 GLN 209 209 209 GLN GLN A . n A 1 210 PRO 210 210 210 PRO PRO A . n A 1 211 ALA 211 211 211 ALA ALA A . n A 1 212 TRP 212 212 212 TRP TRP A . n A 1 213 ARG 213 213 213 ARG ARG A . n A 1 214 VAL 214 214 214 VAL VAL A . n A 1 215 VAL 215 215 215 VAL VAL A . n A 1 216 LEU 216 216 216 LEU LEU A . n A 1 217 GLY 217 217 217 GLY GLY A . n A 1 218 ALA 218 218 218 ALA ALA A . n A 1 219 TRP 219 219 219 TRP TRP A . n A 1 220 HIS 220 220 220 HIS HIS A . n A 1 221 SER 221 221 221 SER SER A . n A 1 222 GLU 222 222 222 GLU GLU A . n A 1 223 GLY 223 223 223 GLY GLY A . n A 1 224 SER 224 224 224 SER SER A . n A 1 225 MET 225 225 225 MET MET A . n A 1 226 VAL 226 226 226 VAL VAL A . n A 1 227 LYS 227 227 227 LYS LYS A . n A 1 228 VAL 228 228 228 VAL VAL A . n A 1 229 THR 229 229 229 THR THR A . n A 1 230 PRO 230 230 230 PRO PRO A . n A 1 231 ASP 231 231 231 ASP ASP A . n A 1 232 ASP 232 232 232 ASP ASP A . n A 1 233 VAL 233 233 233 VAL VAL A . n A 1 234 GLU 234 234 234 GLU GLU A . n A 1 235 LEU 235 235 235 LEU LEU A . n A 1 236 ILE 236 236 236 ILE ILE A . n A 1 237 HIS 237 237 237 HIS HIS A . n A 1 238 PHE 238 238 238 PHE PHE A . n A 1 239 PRO 239 239 239 PRO PRO A . n A 1 240 PHE 240 240 240 PHE PHE A . n A 1 241 LEU 241 241 241 LEU LEU A . n A 1 242 GLU 242 242 242 GLU GLU A . n A 1 243 GLU 243 243 243 GLU GLU A . n A 1 244 ASN 244 244 244 ASN ASN A . n A 1 245 LEU 245 245 245 LEU LEU A . n A 1 246 TYR 246 246 246 TYR TYR A . n A 1 247 PHE 247 247 247 PHE PHE A . n A 1 248 GLN 248 248 248 GLN GLN A . n A 1 249 SER 249 249 249 SER SER A . n A 1 250 HIS 250 250 250 HIS HIS A . n A 1 251 HIS 251 251 251 HIS HIS A . n A 1 252 HIS 252 252 252 HIS HIS A . n A 1 253 HIS 253 253 ? ? ? A . n A 1 254 HIS 254 254 ? ? ? A . n A 1 255 HIS 255 255 ? ? ? A . n A 1 256 HIS 256 256 ? ? ? A . n A 1 257 HIS 257 257 ? ? ? A . n A 1 258 HIS 258 258 ? ? ? A . n A 1 259 HIS 259 259 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1AVZ _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1AVZ _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 A1AVZ 1 301 301 A1AVZ LIG A . C 3 PG4 1 302 302 PG4 PG4 A . D 4 MN 1 303 1 MN MN A . E 4 MN 1 304 2 MN MN A . F 5 HOH 1 401 15 HOH HOH A . F 5 HOH 2 402 39 HOH HOH A . F 5 HOH 3 403 33 HOH HOH A . F 5 HOH 4 404 10 HOH HOH A . F 5 HOH 5 405 11 HOH HOH A . F 5 HOH 6 406 12 HOH HOH A . F 5 HOH 7 407 1 HOH HOH A . F 5 HOH 8 408 2 HOH HOH A . F 5 HOH 9 409 21 HOH HOH A . F 5 HOH 10 410 13 HOH HOH A . F 5 HOH 11 411 9 HOH HOH A . F 5 HOH 12 412 17 HOH HOH A . F 5 HOH 13 413 14 HOH HOH A . F 5 HOH 14 414 27 HOH HOH A . F 5 HOH 15 415 19 HOH HOH A . F 5 HOH 16 416 5 HOH HOH A . F 5 HOH 17 417 24 HOH HOH A . F 5 HOH 18 418 22 HOH HOH A . F 5 HOH 19 419 18 HOH HOH A . F 5 HOH 20 420 28 HOH HOH A . F 5 HOH 21 421 8 HOH HOH A . F 5 HOH 22 422 26 HOH HOH A . F 5 HOH 23 423 31 HOH HOH A . F 5 HOH 24 424 23 HOH HOH A . F 5 HOH 25 425 30 HOH HOH A . F 5 HOH 26 426 4 HOH HOH A . F 5 HOH 27 427 34 HOH HOH A . F 5 HOH 28 428 7 HOH HOH A . F 5 HOH 29 429 25 HOH HOH A . F 5 HOH 30 430 6 HOH HOH A . F 5 HOH 31 431 29 HOH HOH A . F 5 HOH 32 432 38 HOH HOH A . F 5 HOH 33 433 37 HOH HOH A . F 5 HOH 34 434 3 HOH HOH A . F 5 HOH 35 435 20 HOH HOH A . F 5 HOH 36 436 16 HOH HOH A . F 5 HOH 37 437 43 HOH HOH A . F 5 HOH 38 438 35 HOH HOH A . F 5 HOH 39 439 41 HOH HOH A . F 5 HOH 40 440 40 HOH HOH A . F 5 HOH 41 441 36 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 24 ? NE ? A ARG 24 NE 2 1 Y 1 A ARG 24 ? CZ ? A ARG 24 CZ 3 1 Y 1 A ARG 24 ? NH1 ? A ARG 24 NH1 4 1 Y 1 A ARG 24 ? NH2 ? A ARG 24 NH2 5 1 Y 1 A GLN 27 ? CG ? A GLN 27 CG 6 1 Y 1 A GLN 27 ? CD ? A GLN 27 CD 7 1 Y 1 A GLN 27 ? OE1 ? A GLN 27 OE1 8 1 Y 1 A GLN 27 ? NE2 ? A GLN 27 NE2 9 1 Y 1 A GLU 29 ? CG ? A GLU 29 CG 10 1 Y 1 A GLU 29 ? CD ? A GLU 29 CD 11 1 Y 1 A GLU 29 ? OE1 ? A GLU 29 OE1 12 1 Y 1 A GLU 29 ? OE2 ? A GLU 29 OE2 13 1 Y 1 A SER 61 ? OG ? A SER 61 OG 14 1 Y 1 A ARG 90 ? CG ? A ARG 90 CG 15 1 Y 1 A ARG 90 ? CD ? A ARG 90 CD 16 1 Y 1 A ARG 90 ? NE ? A ARG 90 NE 17 1 Y 1 A ARG 90 ? CZ ? A ARG 90 CZ 18 1 Y 1 A ARG 90 ? NH1 ? A ARG 90 NH1 19 1 Y 1 A ARG 90 ? NH2 ? A ARG 90 NH2 20 1 Y 1 A GLN 91 ? CD ? A GLN 91 CD 21 1 Y 1 A GLN 91 ? OE1 ? A GLN 91 OE1 22 1 Y 1 A GLN 91 ? NE2 ? A GLN 91 NE2 23 1 Y 1 A GLU 109 ? CG ? A GLU 109 CG 24 1 Y 1 A GLU 109 ? CD ? A GLU 109 CD 25 1 Y 1 A GLU 109 ? OE1 ? A GLU 109 OE1 26 1 Y 1 A GLU 109 ? OE2 ? A GLU 109 OE2 27 1 Y 1 A LYS 161 ? CG ? A LYS 161 CG 28 1 Y 1 A LYS 161 ? CD ? A LYS 161 CD 29 1 Y 1 A LYS 161 ? CE ? A LYS 161 CE 30 1 Y 1 A LYS 161 ? NZ ? A LYS 161 NZ 31 1 Y 1 A ASN 164 ? CG ? A ASN 164 CG 32 1 Y 1 A ASN 164 ? OD1 ? A ASN 164 OD1 33 1 Y 1 A ASN 164 ? ND2 ? A ASN 164 ND2 34 1 Y 1 A GLN 177 ? CG ? A GLN 177 CG 35 1 Y 1 A GLN 177 ? CD ? A GLN 177 CD 36 1 Y 1 A GLN 177 ? OE1 ? A GLN 177 OE1 37 1 Y 1 A GLN 177 ? NE2 ? A GLN 177 NE2 38 1 Y 1 A GLU 184 ? CG ? A GLU 184 CG 39 1 Y 1 A GLU 184 ? CD ? A GLU 184 CD 40 1 Y 1 A GLU 184 ? OE1 ? A GLU 184 OE1 41 1 Y 1 A GLU 184 ? OE2 ? A GLU 184 OE2 42 1 Y 1 A GLN 205 ? CG ? A GLN 205 CG 43 1 Y 1 A GLN 205 ? CD ? A GLN 205 CD 44 1 Y 1 A GLN 205 ? OE1 ? A GLN 205 OE1 45 1 Y 1 A GLN 205 ? NE2 ? A GLN 205 NE2 46 1 Y 1 A GLN 209 ? CG ? A GLN 209 CG 47 1 Y 1 A GLN 209 ? CD ? A GLN 209 CD 48 1 Y 1 A GLN 209 ? OE1 ? A GLN 209 OE1 49 1 Y 1 A GLN 209 ? NE2 ? A GLN 209 NE2 50 1 Y 1 A GLU 242 ? CG ? A GLU 242 CG 51 1 Y 1 A GLU 242 ? CD ? A GLU 242 CD 52 1 Y 1 A GLU 242 ? OE1 ? A GLU 242 OE1 53 1 Y 1 A GLU 242 ? OE2 ? A GLU 242 OE2 54 1 Y 1 A LEU 245 ? CD1 ? A LEU 245 CD1 55 1 Y 1 A LEU 245 ? CD2 ? A LEU 245 CD2 56 1 Y 1 A GLN 248 ? CG ? A GLN 248 CG 57 1 Y 1 A GLN 248 ? CD ? A GLN 248 CD 58 1 Y 1 A GLN 248 ? OE1 ? A GLN 248 OE1 59 1 Y 1 A GLN 248 ? NE2 ? A GLN 248 NE2 60 1 Y 1 A SER 249 ? OG ? A SER 249 OG # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 9CCX _cell.details ? _cell.formula_units_Z ? _cell.length_a 106.630 _cell.length_a_esd ? _cell.length_b 106.630 _cell.length_b_esd ? _cell.length_c 54.270 _cell.length_c_esd ? _cell.volume 534378.863 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9CCX _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ;P 32 2" ; _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9CCX _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.01 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 59.08 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;1 mg/mL of LpxH, 0.14 mM LPH-86, 10 mM MES (pH 6.0), 100 mM NaCl, 0.5 mM DTT, 2.5% glycerol, 0.8% DMSO, 0.05 M sodium acetate pH 5.0, and 18 % v/v PEG 400 ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-02-14 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979180 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-E' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979180 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-E _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 42.44 _reflns.entry_id 9CCX _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.3 _reflns.d_resolution_low 46.79 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15953 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.15 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.0 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.56 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.30 _reflns_shell.d_res_low 2.38 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1564 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.913 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 52.84 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9CCX _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.30 _refine.ls_d_res_low 46.79 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15931 _refine.ls_number_reflns_R_free 796 _refine.ls_number_reflns_R_work 15135 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.16 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1958 _refine.ls_R_factor_R_free 0.2289 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1941 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.8939 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2258 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 46.79 _refine_hist.number_atoms_solvent 41 _refine_hist.number_atoms_total 1987 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1900 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 46 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0054 ? 2012 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.7086 ? 2744 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0521 ? 294 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0064 ? 353 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 16.2742 ? 311 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.30 2.44 . . 130 2487 99.62 . . . . 0.2701 . . . . . . . . . . . 0.3237 'X-RAY DIFFRACTION' 2.44 2.63 . . 130 2489 99.36 . . . . 0.2584 . . . . . . . . . . . 0.3518 'X-RAY DIFFRACTION' 2.63 2.90 . . 133 2510 99.36 . . . . 0.2011 . . . . . . . . . . . 0.2288 'X-RAY DIFFRACTION' 2.90 3.32 . . 134 2539 99.66 . . . . 0.1929 . . . . . . . . . . . 0.2270 'X-RAY DIFFRACTION' 3.32 4.18 . . 133 2534 99.40 . . . . 0.1728 . . . . . . . . . . . 0.2163 'X-RAY DIFFRACTION' 4.18 46.79 . . 136 2576 97.62 . . . . 0.1840 . . . . . . . . . . . 0.1984 # _struct.entry_id 9CCX _struct.title 'Crystal Structure of the Klebsiella pneumoniae LpxH/JH-LPH-86 complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9CCX _struct_keywords.text 'LpxH, Inhibitor, Complex, Antibiotic, Lipid A' _struct_keywords.pdbx_keywords ANTIBIOTIC # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A1S0WIC1_KLEPN _struct_ref.pdbx_db_accession A0A1S0WIC1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MATLFIADLHLQTEEPAITAGFLRFLQGEARQADALYILGDLFEAWIGDDDPNPLHQQIASAIKAVVDAGVPCYFIHGNR DFLVGQRFARQSGMILLAEEERLDLYGREVLIMHGDTLCTDDQGYLAFRAKVHTPWIQRLFLALPLFIRHRIAARMRADS KAANSSKSMEIMDVNPQAVVDAMERHHVQWLIHGHTHRPAVHELQANGQPAWRVVLGAWHSEGSMVKVTPDDVELIHFPF ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9CCX _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 240 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A1S0WIC1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 240 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 240 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9CCX LEU A 241 ? UNP A0A1S0WIC1 ? ? 'expression tag' 241 1 1 9CCX GLU A 242 ? UNP A0A1S0WIC1 ? ? 'expression tag' 242 2 1 9CCX GLU A 243 ? UNP A0A1S0WIC1 ? ? 'expression tag' 243 3 1 9CCX ASN A 244 ? UNP A0A1S0WIC1 ? ? 'expression tag' 244 4 1 9CCX LEU A 245 ? UNP A0A1S0WIC1 ? ? 'expression tag' 245 5 1 9CCX TYR A 246 ? UNP A0A1S0WIC1 ? ? 'expression tag' 246 6 1 9CCX PHE A 247 ? UNP A0A1S0WIC1 ? ? 'expression tag' 247 7 1 9CCX GLN A 248 ? UNP A0A1S0WIC1 ? ? 'expression tag' 248 8 1 9CCX SER A 249 ? UNP A0A1S0WIC1 ? ? 'expression tag' 249 9 1 9CCX HIS A 250 ? UNP A0A1S0WIC1 ? ? 'expression tag' 250 10 1 9CCX HIS A 251 ? UNP A0A1S0WIC1 ? ? 'expression tag' 251 11 1 9CCX HIS A 252 ? UNP A0A1S0WIC1 ? ? 'expression tag' 252 12 1 9CCX HIS A 253 ? UNP A0A1S0WIC1 ? ? 'expression tag' 253 13 1 9CCX HIS A 254 ? UNP A0A1S0WIC1 ? ? 'expression tag' 254 14 1 9CCX HIS A 255 ? UNP A0A1S0WIC1 ? ? 'expression tag' 255 15 1 9CCX HIS A 256 ? UNP A0A1S0WIC1 ? ? 'expression tag' 256 16 1 9CCX HIS A 257 ? UNP A0A1S0WIC1 ? ? 'expression tag' 257 17 1 9CCX HIS A 258 ? UNP A0A1S0WIC1 ? ? 'expression tag' 258 18 1 9CCX HIS A 259 ? UNP A0A1S0WIC1 ? ? 'expression tag' 259 19 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 15 ? GLY A 28 ? GLU A 15 GLY A 28 1 ? 14 HELX_P HELX_P2 AA2 GLU A 29 ? ALA A 33 ? GLU A 29 ALA A 33 5 ? 5 HELX_P HELX_P3 AA3 ASN A 53 ? ALA A 69 ? ASN A 53 ALA A 69 1 ? 17 HELX_P HELX_P4 AA4 GLY A 85 ? GLY A 93 ? GLY A 85 GLY A 93 1 ? 9 HELX_P HELX_P5 AA5 GLY A 115 ? CYS A 119 ? GLY A 115 CYS A 119 5 ? 5 HELX_P HELX_P6 AA6 ASP A 122 ? HIS A 133 ? ASP A 122 HIS A 133 1 ? 12 HELX_P HELX_P7 AA7 THR A 134 ? ALA A 143 ? THR A 134 ALA A 143 1 ? 10 HELX_P HELX_P8 AA8 PRO A 145 ? ALA A 163 ? PRO A 145 ALA A 163 1 ? 19 HELX_P HELX_P9 AA9 ASN A 175 ? HIS A 186 ? ASN A 175 HIS A 186 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 8 OD1 ? ? ? 1_555 D MN . MN ? ? A ASP 8 A MN 303 1_555 ? ? ? ? ? ? ? 2.083 ? ? metalc2 metalc ? ? A HIS 10 NE2 ? ? ? 1_555 D MN . MN ? ? A HIS 10 A MN 303 1_555 ? ? ? ? ? ? ? 2.298 ? ? metalc3 metalc ? ? A ASP 41 OD2 ? ? ? 1_555 D MN . MN ? ? A ASP 41 A MN 303 1_555 ? ? ? ? ? ? ? 2.223 ? ? metalc4 metalc ? ? A ASP 41 OD2 ? ? ? 1_555 E MN . MN ? ? A ASP 41 A MN 304 1_555 ? ? ? ? ? ? ? 2.312 ? ? metalc5 metalc ? ? A ASN 79 OD1 ? ? ? 1_555 E MN . MN ? ? A ASN 79 A MN 304 1_555 ? ? ? ? ? ? ? 2.004 ? ? metalc6 metalc ? ? A HIS 114 NE2 ? ? ? 1_555 E MN . MN ? ? A HIS 114 A MN 304 1_555 ? ? ? ? ? ? ? 2.311 ? ? metalc7 metalc ? ? A HIS 195 ND1 ? ? ? 1_555 E MN . MN ? ? A HIS 195 A MN 304 1_555 ? ? ? ? ? ? ? 2.409 ? ? metalc8 metalc ? ? A HIS 197 NE2 ? ? ? 1_555 D MN . MN ? ? A HIS 197 A MN 303 1_555 ? ? ? ? ? ? ? 2.306 ? ? metalc9 metalc ? ? D MN . MN ? ? ? 1_555 F HOH . O ? ? A MN 303 A HOH 423 1_555 ? ? ? ? ? ? ? 2.177 ? ? metalc10 metalc ? ? E MN . MN ? ? ? 1_555 F HOH . O ? ? A MN 304 A HOH 423 1_555 ? ? ? ? ? ? ? 2.159 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 8 ? A ASP 8 ? 1_555 MN ? D MN . ? A MN 303 ? 1_555 NE2 ? A HIS 10 ? A HIS 10 ? 1_555 116.4 ? 2 OD1 ? A ASP 8 ? A ASP 8 ? 1_555 MN ? D MN . ? A MN 303 ? 1_555 OD2 ? A ASP 41 ? A ASP 41 ? 1_555 82.4 ? 3 NE2 ? A HIS 10 ? A HIS 10 ? 1_555 MN ? D MN . ? A MN 303 ? 1_555 OD2 ? A ASP 41 ? A ASP 41 ? 1_555 92.2 ? 4 OD1 ? A ASP 8 ? A ASP 8 ? 1_555 MN ? D MN . ? A MN 303 ? 1_555 NE2 ? A HIS 197 ? A HIS 197 ? 1_555 97.2 ? 5 NE2 ? A HIS 10 ? A HIS 10 ? 1_555 MN ? D MN . ? A MN 303 ? 1_555 NE2 ? A HIS 197 ? A HIS 197 ? 1_555 95.8 ? 6 OD2 ? A ASP 41 ? A ASP 41 ? 1_555 MN ? D MN . ? A MN 303 ? 1_555 NE2 ? A HIS 197 ? A HIS 197 ? 1_555 171.2 ? 7 OD1 ? A ASP 8 ? A ASP 8 ? 1_555 MN ? D MN . ? A MN 303 ? 1_555 O ? F HOH . ? A HOH 423 ? 1_555 101.8 ? 8 NE2 ? A HIS 10 ? A HIS 10 ? 1_555 MN ? D MN . ? A MN 303 ? 1_555 O ? F HOH . ? A HOH 423 ? 1_555 140.1 ? 9 OD2 ? A ASP 41 ? A ASP 41 ? 1_555 MN ? D MN . ? A MN 303 ? 1_555 O ? F HOH . ? A HOH 423 ? 1_555 81.5 ? 10 NE2 ? A HIS 197 ? A HIS 197 ? 1_555 MN ? D MN . ? A MN 303 ? 1_555 O ? F HOH . ? A HOH 423 ? 1_555 90.1 ? 11 OD2 ? A ASP 41 ? A ASP 41 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 OD1 ? A ASN 79 ? A ASN 79 ? 1_555 96.9 ? 12 OD2 ? A ASP 41 ? A ASP 41 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 NE2 ? A HIS 114 ? A HIS 114 ? 1_555 99.6 ? 13 OD1 ? A ASN 79 ? A ASN 79 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 NE2 ? A HIS 114 ? A HIS 114 ? 1_555 96.8 ? 14 OD2 ? A ASP 41 ? A ASP 41 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 ND1 ? A HIS 195 ? A HIS 195 ? 1_555 162.9 ? 15 OD1 ? A ASN 79 ? A ASN 79 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 ND1 ? A HIS 195 ? A HIS 195 ? 1_555 93.2 ? 16 NE2 ? A HIS 114 ? A HIS 114 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 ND1 ? A HIS 195 ? A HIS 195 ? 1_555 92.8 ? 17 OD2 ? A ASP 41 ? A ASP 41 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 O ? F HOH . ? A HOH 423 ? 1_555 79.8 ? 18 OD1 ? A ASN 79 ? A ASN 79 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 O ? F HOH . ? A HOH 423 ? 1_555 120.1 ? 19 NE2 ? A HIS 114 ? A HIS 114 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 O ? F HOH . ? A HOH 423 ? 1_555 143.0 ? 20 ND1 ? A HIS 195 ? A HIS 195 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 O ? F HOH . ? A HOH 423 ? 1_555 83.2 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel AA2 3 4 ? parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 95 ? LEU A 96 ? ILE A 95 LEU A 96 AA1 2 CYS A 73 ? PHE A 75 ? CYS A 73 PHE A 75 AA1 3 ALA A 35 ? ILE A 38 ? ALA A 35 ILE A 38 AA1 4 THR A 3 ? ILE A 6 ? THR A 3 ILE A 6 AA1 5 GLY A 223 ? VAL A 228 ? GLY A 223 VAL A 228 AA1 6 VAL A 233 ? PHE A 238 ? VAL A 233 PHE A 238 AA2 1 GLU A 100 ? LEU A 105 ? GLU A 100 LEU A 105 AA2 2 ARG A 108 ? MET A 113 ? ARG A 108 MET A 113 AA2 3 TRP A 190 ? HIS A 193 ? TRP A 190 HIS A 193 AA2 4 GLN A 209 ? VAL A 215 ? GLN A 209 VAL A 215 AA2 5 ALA A 200 ? ALA A 206 ? ALA A 200 ALA A 206 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 95 ? O ILE A 95 N PHE A 75 ? N PHE A 75 AA1 2 3 O TYR A 74 ? O TYR A 74 N ILE A 38 ? N ILE A 38 AA1 3 4 O TYR A 37 ? O TYR A 37 N LEU A 4 ? N LEU A 4 AA1 4 5 N THR A 3 ? N THR A 3 O VAL A 228 ? O VAL A 228 AA1 5 6 N MET A 225 ? N MET A 225 O ILE A 236 ? O ILE A 236 AA2 1 2 N LEU A 103 ? N LEU A 103 O VAL A 110 ? O VAL A 110 AA2 2 3 N LEU A 111 ? N LEU A 111 O TRP A 190 ? O TRP A 190 AA2 3 4 N LEU A 191 ? N LEU A 191 O VAL A 214 ? O VAL A 214 AA2 4 5 O ALA A 211 ? O ALA A 211 N LEU A 204 ? N LEU A 204 # _pdbx_entry_details.entry_id 9CCX _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 39 ? ? -92.35 46.65 2 1 CYS A 119 ? ? -97.53 58.00 3 1 HIS A 195 ? ? 67.30 -47.38 4 1 HIS A 220 ? ? -100.04 -71.35 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z+2/3 3 -x+y,-x,z+1/3 4 x-y,-y,-z+1/3 5 -x,-x+y,-z+2/3 6 y,x,-z # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -36.86439912 -31.1560613845 -0.781545003113 0.380236959721 ? 0.0160383041684 ? -0.00248776119651 ? 0.364290154478 ? -0.0299812741335 ? 0.324686522786 ? 2.03717426394 ? -0.806766671804 ? 1.45794397046 ? 2.59523716583 ? -2.30059532385 ? 4.31662121186 ? 0.0707898463145 ? 0.122321344809 ? -0.0809750649228 ? -0.222884238534 ? -0.138197375378 ? -0.0923671663376 ? 0.212749328364 ? 0.20312511355 ? 0.132969504934 ? 2 'X-RAY DIFFRACTION' ? refined -37.9038005512 -24.6300507698 8.06329678043 0.330963299946 ? 0.0141514967493 ? 0.00914821215585 ? 0.362869238584 ? -0.0302709481361 ? 0.316687541559 ? 1.90271275254 ? -0.220250680347 ? -0.391408347467 ? 2.27034086634 ? -0.312058056806 ? 1.41680905933 ? -0.01519428919 ? -0.195155479917 ? 0.122948956268 ? 0.0954076047829 ? 0.0126876888547 ? -0.252217467218 ? -0.0190075239278 ? 0.0314048217818 ? -0.0060266621539 ? 3 'X-RAY DIFFRACTION' ? refined -38.7175291895 -6.18254472309 5.99514959622 0.43202829797 ? 0.0115425764149 ? -0.0269063510274 ? 0.337519650109 ? -0.0954973291322 ? 0.494662067834 ? 2.59232848372 ? -1.11519794995 ? -0.0430417250769 ? 2.57479071122 ? 0.633471129538 ? 1.86608089401 ? -0.114525344903 ? -0.0676261966363 ? 0.00111606397708 ? -0.065437165753 ? 0.100981215343 ? -0.156094812649 ? -0.184781159292 ? 0.0227177387091 ? 0.0188799050891 ? 4 'X-RAY DIFFRACTION' ? refined -18.4624873403 -18.7866717288 12.5528858315 0.415794611668 ? 0.0242275182324 ? -0.0378968286867 ? 0.582504077173 ? -0.0710572956727 ? 0.641518697247 ? 4.06333564992 ? -3.46459264256 ? 1.58664744402 ? 8.13660526975 ? -1.25113543994 ? 0.621155107022 ? 0.0492810546044 ? -0.212513003555 ? 0.808666329406 ? 0.460525616144 ? -0.38882123179 ? -1.12536285992 ? -0.266890993135 ? 0.0869455048061 ? 0.328251243132 ? 5 'X-RAY DIFFRACTION' ? refined -21.3834565416 -29.0656081857 7.49858573761 0.306398618678 ? 0.00653712493153 ? -0.03931195614 ? 0.317046828573 ? -0.0241261530478 ? 0.379348354998 ? 2.84004480486 ? -0.0502520250135 ? -0.751652780802 ? 2.6850386433 ? 1.23439680275 ? 2.34192127306 ? 0.0248005201618 ? -0.0559467311911 ? 0.197589683482 ? 0.128677539394 ? 0.121355804246 ? -0.328805694369 ? 0.00890552231097 ? 0.102336312659 ? -0.153455214448 ? 6 'X-RAY DIFFRACTION' ? refined -26.7108647778 -40.0090825946 -12.033973967 0.496202811765 ? 0.0312868317732 ? -0.00648838371998 ? 0.518745323502 ? 0.0449687863802 ? 0.574357120194 ? 1.24885053737 ? -0.154249395535 ? 0.454792394491 ? 1.4714721951 ? 1.18313255167 ? 3.51067286821 ? 0.131217906183 ? 0.410092914441 ? 0.192246516195 ? -0.472248142979 ? -0.208369880311 ? 0.165944020702 ? 0.238452894285 ? 0.0680624379777 ? 0.0467896441543 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 1 A 2 ? A 37 A 38 ? ? ;chain 'A' and (resid 2 through 38 ) ; 2 'X-RAY DIFFRACTION' 2 A 38 A 39 ? A 121 A 122 ? ? ;chain 'A' and (resid 39 through 122 ) ; 3 'X-RAY DIFFRACTION' 3 A 122 A 123 ? A 161 A 162 ? ? ;chain 'A' and (resid 123 through 162 ) ; 4 'X-RAY DIFFRACTION' 4 A 162 A 163 ? A 177 A 185 ? ? ;chain 'A' and (resid 163 through 185 ) ; 5 'X-RAY DIFFRACTION' 5 A 178 A 186 ? A 220 A 228 ? ? ;chain 'A' and (resid 186 through 228 ) ; 6 'X-RAY DIFFRACTION' 6 A 221 A 229 ? A 244 A 252 ? ? ;chain 'A' and (resid 229 through 252 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 165 ? A SER 165 3 1 Y 1 A SER 166 ? A SER 166 4 1 Y 1 A LYS 167 ? A LYS 167 5 1 Y 1 A SER 168 ? A SER 168 6 1 Y 1 A MET 169 ? A MET 169 7 1 Y 1 A GLU 170 ? A GLU 170 8 1 Y 1 A ILE 171 ? A ILE 171 9 1 Y 1 A HIS 253 ? A HIS 253 10 1 Y 1 A HIS 254 ? A HIS 254 11 1 Y 1 A HIS 255 ? A HIS 255 12 1 Y 1 A HIS 256 ? A HIS 256 13 1 Y 1 A HIS 257 ? A HIS 257 14 1 Y 1 A HIS 258 ? A HIS 258 15 1 Y 1 A HIS 259 ? A HIS 259 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1AVZ C13 C Y N 1 A1AVZ C15 C Y N 2 A1AVZ C17 C Y N 3 A1AVZ C20 C N N 4 A1AVZ C22 C N N 5 A1AVZ C24 C N N 6 A1AVZ C26 C Y N 7 A1AVZ C28 C N N 8 A1AVZ C01 C Y N 9 A1AVZ C03 C Y N 10 A1AVZ C05 C N N 11 A1AVZ C06 C N N 12 A1AVZ C08 C N N 13 A1AVZ C09 C N N 14 A1AVZ C14 C Y N 15 A1AVZ C16 C Y N 16 A1AVZ C18 C Y N 17 A1AVZ C19 C N N 18 A1AVZ C25 C Y N 19 A1AVZ C27 C Y N 20 A1AVZ F29 F N N 21 A1AVZ F30 F N N 22 A1AVZ F31 F N N 23 A1AVZ N02 N Y N 24 A1AVZ N04 N N N 25 A1AVZ N07 N N N 26 A1AVZ N21 N N N 27 A1AVZ O11 O N N 28 A1AVZ O12 O N N 29 A1AVZ O23 O N N 30 A1AVZ S10 S N N 31 A1AVZ H151 H N N 32 A1AVZ H201 H N N 33 A1AVZ H202 H N N 34 A1AVZ H241 H N N 35 A1AVZ H242 H N N 36 A1AVZ H243 H N N 37 A1AVZ H011 H N N 38 A1AVZ H051 H N N 39 A1AVZ H052 H N N 40 A1AVZ H061 H N N 41 A1AVZ H062 H N N 42 A1AVZ H082 H N N 43 A1AVZ H081 H N N 44 A1AVZ H091 H N N 45 A1AVZ H092 H N N 46 A1AVZ H141 H N N 47 A1AVZ H181 H N N 48 A1AVZ H192 H N N 49 A1AVZ H191 H N N 50 A1AVZ H251 H N N 51 A1AVZ H271 H N N 52 ALA N N N N 53 ALA CA C N S 54 ALA C C N N 55 ALA O O N N 56 ALA CB C N N 57 ALA OXT O N N 58 ALA H H N N 59 ALA H2 H N N 60 ALA HA H N N 61 ALA HB1 H N N 62 ALA HB2 H N N 63 ALA HB3 H N N 64 ALA HXT H N N 65 ARG N N N N 66 ARG CA C N S 67 ARG C C N N 68 ARG O O N N 69 ARG CB C N N 70 ARG CG C N N 71 ARG CD C N N 72 ARG NE N N N 73 ARG CZ C N N 74 ARG NH1 N N N 75 ARG NH2 N N N 76 ARG OXT O N N 77 ARG H H N N 78 ARG H2 H N N 79 ARG HA H N N 80 ARG HB2 H N N 81 ARG HB3 H N N 82 ARG HG2 H N N 83 ARG HG3 H N N 84 ARG HD2 H N N 85 ARG HD3 H N N 86 ARG HE H N N 87 ARG HH11 H N N 88 ARG HH12 H N N 89 ARG HH21 H N N 90 ARG HH22 H N N 91 ARG HXT H N N 92 ASN N N N N 93 ASN CA C N S 94 ASN C C N N 95 ASN O O N N 96 ASN CB C N N 97 ASN CG C N N 98 ASN OD1 O N N 99 ASN ND2 N N N 100 ASN OXT O N N 101 ASN H H N N 102 ASN H2 H N N 103 ASN HA H N N 104 ASN HB2 H N N 105 ASN HB3 H N N 106 ASN HD21 H N N 107 ASN HD22 H N N 108 ASN HXT H N N 109 ASP N N N N 110 ASP CA C N S 111 ASP C C N N 112 ASP O O N N 113 ASP CB C N N 114 ASP CG C N N 115 ASP OD1 O N N 116 ASP OD2 O N N 117 ASP OXT O N N 118 ASP H H N N 119 ASP H2 H N N 120 ASP HA H N N 121 ASP HB2 H N N 122 ASP HB3 H N N 123 ASP HD2 H N N 124 ASP HXT H N N 125 CYS N N N N 126 CYS CA C N R 127 CYS C C N N 128 CYS O O N N 129 CYS CB C N N 130 CYS SG S N N 131 CYS OXT O N N 132 CYS H H N N 133 CYS H2 H N N 134 CYS HA H N N 135 CYS HB2 H N N 136 CYS HB3 H N N 137 CYS HG H N N 138 CYS HXT H N N 139 GLN N N N N 140 GLN CA C N S 141 GLN C C N N 142 GLN O O N N 143 GLN CB C N N 144 GLN CG C N N 145 GLN CD C N N 146 GLN OE1 O N N 147 GLN NE2 N N N 148 GLN OXT O N N 149 GLN H H N N 150 GLN H2 H N N 151 GLN HA H N N 152 GLN HB2 H N N 153 GLN HB3 H N N 154 GLN HG2 H N N 155 GLN HG3 H N N 156 GLN HE21 H N N 157 GLN HE22 H N N 158 GLN HXT H N N 159 GLU N N N N 160 GLU CA C N S 161 GLU C C N N 162 GLU O O N N 163 GLU CB C N N 164 GLU CG C N N 165 GLU CD C N N 166 GLU OE1 O N N 167 GLU OE2 O N N 168 GLU OXT O N N 169 GLU H H N N 170 GLU H2 H N N 171 GLU HA H N N 172 GLU HB2 H N N 173 GLU HB3 H N N 174 GLU HG2 H N N 175 GLU HG3 H N N 176 GLU HE2 H N N 177 GLU HXT H N N 178 GLY N N N N 179 GLY CA C N N 180 GLY C C N N 181 GLY O O N N 182 GLY OXT O N N 183 GLY H H N N 184 GLY H2 H N N 185 GLY HA2 H N N 186 GLY HA3 H N N 187 GLY HXT H N N 188 HIS N N N N 189 HIS CA C N S 190 HIS C C N N 191 HIS O O N N 192 HIS CB C N N 193 HIS CG C Y N 194 HIS ND1 N Y N 195 HIS CD2 C Y N 196 HIS CE1 C Y N 197 HIS NE2 N Y N 198 HIS OXT O N N 199 HIS H H N N 200 HIS H2 H N N 201 HIS HA H N N 202 HIS HB2 H N N 203 HIS HB3 H N N 204 HIS HD1 H N N 205 HIS HD2 H N N 206 HIS HE1 H N N 207 HIS HE2 H N N 208 HIS HXT H N N 209 HOH O O N N 210 HOH H1 H N N 211 HOH H2 H N N 212 ILE N N N N 213 ILE CA C N S 214 ILE C C N N 215 ILE O O N N 216 ILE CB C N S 217 ILE CG1 C N N 218 ILE CG2 C N N 219 ILE CD1 C N N 220 ILE OXT O N N 221 ILE H H N N 222 ILE H2 H N N 223 ILE HA H N N 224 ILE HB H N N 225 ILE HG12 H N N 226 ILE HG13 H N N 227 ILE HG21 H N N 228 ILE HG22 H N N 229 ILE HG23 H N N 230 ILE HD11 H N N 231 ILE HD12 H N N 232 ILE HD13 H N N 233 ILE HXT H N N 234 LEU N N N N 235 LEU CA C N S 236 LEU C C N N 237 LEU O O N N 238 LEU CB C N N 239 LEU CG C N N 240 LEU CD1 C N N 241 LEU CD2 C N N 242 LEU OXT O N N 243 LEU H H N N 244 LEU H2 H N N 245 LEU HA H N N 246 LEU HB2 H N N 247 LEU HB3 H N N 248 LEU HG H N N 249 LEU HD11 H N N 250 LEU HD12 H N N 251 LEU HD13 H N N 252 LEU HD21 H N N 253 LEU HD22 H N N 254 LEU HD23 H N N 255 LEU HXT H N N 256 LYS N N N N 257 LYS CA C N S 258 LYS C C N N 259 LYS O O N N 260 LYS CB C N N 261 LYS CG C N N 262 LYS CD C N N 263 LYS CE C N N 264 LYS NZ N N N 265 LYS OXT O N N 266 LYS H H N N 267 LYS H2 H N N 268 LYS HA H N N 269 LYS HB2 H N N 270 LYS HB3 H N N 271 LYS HG2 H N N 272 LYS HG3 H N N 273 LYS HD2 H N N 274 LYS HD3 H N N 275 LYS HE2 H N N 276 LYS HE3 H N N 277 LYS HZ1 H N N 278 LYS HZ2 H N N 279 LYS HZ3 H N N 280 LYS HXT H N N 281 MET N N N N 282 MET CA C N S 283 MET C C N N 284 MET O O N N 285 MET CB C N N 286 MET CG C N N 287 MET SD S N N 288 MET CE C N N 289 MET OXT O N N 290 MET H H N N 291 MET H2 H N N 292 MET HA H N N 293 MET HB2 H N N 294 MET HB3 H N N 295 MET HG2 H N N 296 MET HG3 H N N 297 MET HE1 H N N 298 MET HE2 H N N 299 MET HE3 H N N 300 MET HXT H N N 301 MN MN MN N N 302 PG4 O1 O N N 303 PG4 C1 C N N 304 PG4 C2 C N N 305 PG4 O2 O N N 306 PG4 C3 C N N 307 PG4 C4 C N N 308 PG4 O3 O N N 309 PG4 C5 C N N 310 PG4 C6 C N N 311 PG4 O4 O N N 312 PG4 C7 C N N 313 PG4 C8 C N N 314 PG4 O5 O N N 315 PG4 HO1 H N N 316 PG4 H11 H N N 317 PG4 H12 H N N 318 PG4 H21 H N N 319 PG4 H22 H N N 320 PG4 H31 H N N 321 PG4 H32 H N N 322 PG4 H41 H N N 323 PG4 H42 H N N 324 PG4 H51 H N N 325 PG4 H52 H N N 326 PG4 H61 H N N 327 PG4 H62 H N N 328 PG4 H71 H N N 329 PG4 H72 H N N 330 PG4 H81 H N N 331 PG4 H82 H N N 332 PG4 HO5 H N N 333 PHE N N N N 334 PHE CA C N S 335 PHE C C N N 336 PHE O O N N 337 PHE CB C N N 338 PHE CG C Y N 339 PHE CD1 C Y N 340 PHE CD2 C Y N 341 PHE CE1 C Y N 342 PHE CE2 C Y N 343 PHE CZ C Y N 344 PHE OXT O N N 345 PHE H H N N 346 PHE H2 H N N 347 PHE HA H N N 348 PHE HB2 H N N 349 PHE HB3 H N N 350 PHE HD1 H N N 351 PHE HD2 H N N 352 PHE HE1 H N N 353 PHE HE2 H N N 354 PHE HZ H N N 355 PHE HXT H N N 356 PRO N N N N 357 PRO CA C N S 358 PRO C C N N 359 PRO O O N N 360 PRO CB C N N 361 PRO CG C N N 362 PRO CD C N N 363 PRO OXT O N N 364 PRO H H N N 365 PRO HA H N N 366 PRO HB2 H N N 367 PRO HB3 H N N 368 PRO HG2 H N N 369 PRO HG3 H N N 370 PRO HD2 H N N 371 PRO HD3 H N N 372 PRO HXT H N N 373 SER N N N N 374 SER CA C N S 375 SER C C N N 376 SER O O N N 377 SER CB C N N 378 SER OG O N N 379 SER OXT O N N 380 SER H H N N 381 SER H2 H N N 382 SER HA H N N 383 SER HB2 H N N 384 SER HB3 H N N 385 SER HG H N N 386 SER HXT H N N 387 THR N N N N 388 THR CA C N S 389 THR C C N N 390 THR O O N N 391 THR CB C N R 392 THR OG1 O N N 393 THR CG2 C N N 394 THR OXT O N N 395 THR H H N N 396 THR H2 H N N 397 THR HA H N N 398 THR HB H N N 399 THR HG1 H N N 400 THR HG21 H N N 401 THR HG22 H N N 402 THR HG23 H N N 403 THR HXT H N N 404 TRP N N N N 405 TRP CA C N S 406 TRP C C N N 407 TRP O O N N 408 TRP CB C N N 409 TRP CG C Y N 410 TRP CD1 C Y N 411 TRP CD2 C Y N 412 TRP NE1 N Y N 413 TRP CE2 C Y N 414 TRP CE3 C Y N 415 TRP CZ2 C Y N 416 TRP CZ3 C Y N 417 TRP CH2 C Y N 418 TRP OXT O N N 419 TRP H H N N 420 TRP H2 H N N 421 TRP HA H N N 422 TRP HB2 H N N 423 TRP HB3 H N N 424 TRP HD1 H N N 425 TRP HE1 H N N 426 TRP HE3 H N N 427 TRP HZ2 H N N 428 TRP HZ3 H N N 429 TRP HH2 H N N 430 TRP HXT H N N 431 TYR N N N N 432 TYR CA C N S 433 TYR C C N N 434 TYR O O N N 435 TYR CB C N N 436 TYR CG C Y N 437 TYR CD1 C Y N 438 TYR CD2 C Y N 439 TYR CE1 C Y N 440 TYR CE2 C Y N 441 TYR CZ C Y N 442 TYR OH O N N 443 TYR OXT O N N 444 TYR H H N N 445 TYR H2 H N N 446 TYR HA H N N 447 TYR HB2 H N N 448 TYR HB3 H N N 449 TYR HD1 H N N 450 TYR HD2 H N N 451 TYR HE1 H N N 452 TYR HE2 H N N 453 TYR HH H N N 454 TYR HXT H N N 455 VAL N N N N 456 VAL CA C N S 457 VAL C C N N 458 VAL O O N N 459 VAL CB C N N 460 VAL CG1 C N N 461 VAL CG2 C N N 462 VAL OXT O N N 463 VAL H H N N 464 VAL H2 H N N 465 VAL HA H N N 466 VAL HB H N N 467 VAL HG11 H N N 468 VAL HG12 H N N 469 VAL HG13 H N N 470 VAL HG21 H N N 471 VAL HG22 H N N 472 VAL HG23 H N N 473 VAL HXT H N N 474 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1AVZ N02 C01 doub Y N 1 A1AVZ C03 N02 sing Y N 2 A1AVZ C05 N04 sing N N 3 A1AVZ C06 C05 sing N N 4 A1AVZ N07 C06 sing N N 5 A1AVZ C09 C08 sing N N 6 A1AVZ C08 N07 sing N N 7 A1AVZ S10 N07 sing N N 8 A1AVZ O11 S10 doub N N 9 A1AVZ O12 S10 doub N N 10 A1AVZ C13 S10 sing N N 11 A1AVZ C14 C13 doub Y N 12 A1AVZ C15 C14 sing Y N 13 A1AVZ C16 C15 doub Y N 14 A1AVZ C17 C16 sing Y N 15 A1AVZ C18 C17 doub Y N 16 A1AVZ C19 C17 sing N N 17 A1AVZ C20 C19 sing N N 18 A1AVZ N21 C20 sing N N 19 A1AVZ C22 N21 sing N N 20 A1AVZ O23 C22 doub N N 21 A1AVZ C24 C22 sing N N 22 A1AVZ N04 C03 sing N N 23 A1AVZ C25 C03 doub Y N 24 A1AVZ C26 C25 sing Y N 25 A1AVZ C27 C26 doub Y N 26 A1AVZ C28 C26 sing N N 27 A1AVZ F29 C28 sing N N 28 A1AVZ F30 C28 sing N N 29 A1AVZ F31 C28 sing N N 30 A1AVZ C01 C27 sing Y N 31 A1AVZ N04 C09 sing N N 32 A1AVZ C13 C18 sing Y N 33 A1AVZ C16 N21 sing N N 34 A1AVZ C15 H151 sing N N 35 A1AVZ C20 H201 sing N N 36 A1AVZ C20 H202 sing N N 37 A1AVZ C24 H241 sing N N 38 A1AVZ C24 H242 sing N N 39 A1AVZ C24 H243 sing N N 40 A1AVZ C01 H011 sing N N 41 A1AVZ C05 H051 sing N N 42 A1AVZ C05 H052 sing N N 43 A1AVZ C06 H061 sing N N 44 A1AVZ C06 H062 sing N N 45 A1AVZ C08 H082 sing N N 46 A1AVZ C08 H081 sing N N 47 A1AVZ C09 H091 sing N N 48 A1AVZ C09 H092 sing N N 49 A1AVZ C14 H141 sing N N 50 A1AVZ C18 H181 sing N N 51 A1AVZ C19 H192 sing N N 52 A1AVZ C19 H191 sing N N 53 A1AVZ C25 H251 sing N N 54 A1AVZ C27 H271 sing N N 55 ALA N CA sing N N 56 ALA N H sing N N 57 ALA N H2 sing N N 58 ALA CA C sing N N 59 ALA CA CB sing N N 60 ALA CA HA sing N N 61 ALA C O doub N N 62 ALA C OXT sing N N 63 ALA CB HB1 sing N N 64 ALA CB HB2 sing N N 65 ALA CB HB3 sing N N 66 ALA OXT HXT sing N N 67 ARG N CA sing N N 68 ARG N H sing N N 69 ARG N H2 sing N N 70 ARG CA C sing N N 71 ARG CA CB sing N N 72 ARG CA HA sing N N 73 ARG C O doub N N 74 ARG C OXT sing N N 75 ARG CB CG sing N N 76 ARG CB HB2 sing N N 77 ARG CB HB3 sing N N 78 ARG CG CD sing N N 79 ARG CG HG2 sing N N 80 ARG CG HG3 sing N N 81 ARG CD NE sing N N 82 ARG CD HD2 sing N N 83 ARG CD HD3 sing N N 84 ARG NE CZ sing N N 85 ARG NE HE sing N N 86 ARG CZ NH1 sing N N 87 ARG CZ NH2 doub N N 88 ARG NH1 HH11 sing N N 89 ARG NH1 HH12 sing N N 90 ARG NH2 HH21 sing N N 91 ARG NH2 HH22 sing N N 92 ARG OXT HXT sing N N 93 ASN N CA sing N N 94 ASN N H sing N N 95 ASN N H2 sing N N 96 ASN CA C sing N N 97 ASN CA CB sing N N 98 ASN CA HA sing N N 99 ASN C O doub N N 100 ASN C OXT sing N N 101 ASN CB CG sing N N 102 ASN CB HB2 sing N N 103 ASN CB HB3 sing N N 104 ASN CG OD1 doub N N 105 ASN CG ND2 sing N N 106 ASN ND2 HD21 sing N N 107 ASN ND2 HD22 sing N N 108 ASN OXT HXT sing N N 109 ASP N CA sing N N 110 ASP N H sing N N 111 ASP N H2 sing N N 112 ASP CA C sing N N 113 ASP CA CB sing N N 114 ASP CA HA sing N N 115 ASP C O doub N N 116 ASP C OXT sing N N 117 ASP CB CG sing N N 118 ASP CB HB2 sing N N 119 ASP CB HB3 sing N N 120 ASP CG OD1 doub N N 121 ASP CG OD2 sing N N 122 ASP OD2 HD2 sing N N 123 ASP OXT HXT sing N N 124 CYS N CA sing N N 125 CYS N H sing N N 126 CYS N H2 sing N N 127 CYS CA C sing N N 128 CYS CA CB sing N N 129 CYS CA HA sing N N 130 CYS C O doub N N 131 CYS C OXT sing N N 132 CYS CB SG sing N N 133 CYS CB HB2 sing N N 134 CYS CB HB3 sing N N 135 CYS SG HG sing N N 136 CYS OXT HXT sing N N 137 GLN N CA sing N N 138 GLN N H sing N N 139 GLN N H2 sing N N 140 GLN CA C sing N N 141 GLN CA CB sing N N 142 GLN CA HA sing N N 143 GLN C O doub N N 144 GLN C OXT sing N N 145 GLN CB CG sing N N 146 GLN CB HB2 sing N N 147 GLN CB HB3 sing N N 148 GLN CG CD sing N N 149 GLN CG HG2 sing N N 150 GLN CG HG3 sing N N 151 GLN CD OE1 doub N N 152 GLN CD NE2 sing N N 153 GLN NE2 HE21 sing N N 154 GLN NE2 HE22 sing N N 155 GLN OXT HXT sing N N 156 GLU N CA sing N N 157 GLU N H sing N N 158 GLU N H2 sing N N 159 GLU CA C sing N N 160 GLU CA CB sing N N 161 GLU CA HA sing N N 162 GLU C O doub N N 163 GLU C OXT sing N N 164 GLU CB CG sing N N 165 GLU CB HB2 sing N N 166 GLU CB HB3 sing N N 167 GLU CG CD sing N N 168 GLU CG HG2 sing N N 169 GLU CG HG3 sing N N 170 GLU CD OE1 doub N N 171 GLU CD OE2 sing N N 172 GLU OE2 HE2 sing N N 173 GLU OXT HXT sing N N 174 GLY N CA sing N N 175 GLY N H sing N N 176 GLY N H2 sing N N 177 GLY CA C sing N N 178 GLY CA HA2 sing N N 179 GLY CA HA3 sing N N 180 GLY C O doub N N 181 GLY C OXT sing N N 182 GLY OXT HXT sing N N 183 HIS N CA sing N N 184 HIS N H sing N N 185 HIS N H2 sing N N 186 HIS CA C sing N N 187 HIS CA CB sing N N 188 HIS CA HA sing N N 189 HIS C O doub N N 190 HIS C OXT sing N N 191 HIS CB CG sing N N 192 HIS CB HB2 sing N N 193 HIS CB HB3 sing N N 194 HIS CG ND1 sing Y N 195 HIS CG CD2 doub Y N 196 HIS ND1 CE1 doub Y N 197 HIS ND1 HD1 sing N N 198 HIS CD2 NE2 sing Y N 199 HIS CD2 HD2 sing N N 200 HIS CE1 NE2 sing Y N 201 HIS CE1 HE1 sing N N 202 HIS NE2 HE2 sing N N 203 HIS OXT HXT sing N N 204 HOH O H1 sing N N 205 HOH O H2 sing N N 206 ILE N CA sing N N 207 ILE N H sing N N 208 ILE N H2 sing N N 209 ILE CA C sing N N 210 ILE CA CB sing N N 211 ILE CA HA sing N N 212 ILE C O doub N N 213 ILE C OXT sing N N 214 ILE CB CG1 sing N N 215 ILE CB CG2 sing N N 216 ILE CB HB sing N N 217 ILE CG1 CD1 sing N N 218 ILE CG1 HG12 sing N N 219 ILE CG1 HG13 sing N N 220 ILE CG2 HG21 sing N N 221 ILE CG2 HG22 sing N N 222 ILE CG2 HG23 sing N N 223 ILE CD1 HD11 sing N N 224 ILE CD1 HD12 sing N N 225 ILE CD1 HD13 sing N N 226 ILE OXT HXT sing N N 227 LEU N CA sing N N 228 LEU N H sing N N 229 LEU N H2 sing N N 230 LEU CA C sing N N 231 LEU CA CB sing N N 232 LEU CA HA sing N N 233 LEU C O doub N N 234 LEU C OXT sing N N 235 LEU CB CG sing N N 236 LEU CB HB2 sing N N 237 LEU CB HB3 sing N N 238 LEU CG CD1 sing N N 239 LEU CG CD2 sing N N 240 LEU CG HG sing N N 241 LEU CD1 HD11 sing N N 242 LEU CD1 HD12 sing N N 243 LEU CD1 HD13 sing N N 244 LEU CD2 HD21 sing N N 245 LEU CD2 HD22 sing N N 246 LEU CD2 HD23 sing N N 247 LEU OXT HXT sing N N 248 LYS N CA sing N N 249 LYS N H sing N N 250 LYS N H2 sing N N 251 LYS CA C sing N N 252 LYS CA CB sing N N 253 LYS CA HA sing N N 254 LYS C O doub N N 255 LYS C OXT sing N N 256 LYS CB CG sing N N 257 LYS CB HB2 sing N N 258 LYS CB HB3 sing N N 259 LYS CG CD sing N N 260 LYS CG HG2 sing N N 261 LYS CG HG3 sing N N 262 LYS CD CE sing N N 263 LYS CD HD2 sing N N 264 LYS CD HD3 sing N N 265 LYS CE NZ sing N N 266 LYS CE HE2 sing N N 267 LYS CE HE3 sing N N 268 LYS NZ HZ1 sing N N 269 LYS NZ HZ2 sing N N 270 LYS NZ HZ3 sing N N 271 LYS OXT HXT sing N N 272 MET N CA sing N N 273 MET N H sing N N 274 MET N H2 sing N N 275 MET CA C sing N N 276 MET CA CB sing N N 277 MET CA HA sing N N 278 MET C O doub N N 279 MET C OXT sing N N 280 MET CB CG sing N N 281 MET CB HB2 sing N N 282 MET CB HB3 sing N N 283 MET CG SD sing N N 284 MET CG HG2 sing N N 285 MET CG HG3 sing N N 286 MET SD CE sing N N 287 MET CE HE1 sing N N 288 MET CE HE2 sing N N 289 MET CE HE3 sing N N 290 MET OXT HXT sing N N 291 PG4 O1 C1 sing N N 292 PG4 O1 HO1 sing N N 293 PG4 C1 C2 sing N N 294 PG4 C1 H11 sing N N 295 PG4 C1 H12 sing N N 296 PG4 C2 O2 sing N N 297 PG4 C2 H21 sing N N 298 PG4 C2 H22 sing N N 299 PG4 O2 C3 sing N N 300 PG4 C3 C4 sing N N 301 PG4 C3 H31 sing N N 302 PG4 C3 H32 sing N N 303 PG4 C4 O3 sing N N 304 PG4 C4 H41 sing N N 305 PG4 C4 H42 sing N N 306 PG4 O3 C5 sing N N 307 PG4 C5 C6 sing N N 308 PG4 C5 H51 sing N N 309 PG4 C5 H52 sing N N 310 PG4 C6 O4 sing N N 311 PG4 C6 H61 sing N N 312 PG4 C6 H62 sing N N 313 PG4 O4 C7 sing N N 314 PG4 C7 C8 sing N N 315 PG4 C7 H71 sing N N 316 PG4 C7 H72 sing N N 317 PG4 C8 O5 sing N N 318 PG4 C8 H81 sing N N 319 PG4 C8 H82 sing N N 320 PG4 O5 HO5 sing N N 321 PHE N CA sing N N 322 PHE N H sing N N 323 PHE N H2 sing N N 324 PHE CA C sing N N 325 PHE CA CB sing N N 326 PHE CA HA sing N N 327 PHE C O doub N N 328 PHE C OXT sing N N 329 PHE CB CG sing N N 330 PHE CB HB2 sing N N 331 PHE CB HB3 sing N N 332 PHE CG CD1 doub Y N 333 PHE CG CD2 sing Y N 334 PHE CD1 CE1 sing Y N 335 PHE CD1 HD1 sing N N 336 PHE CD2 CE2 doub Y N 337 PHE CD2 HD2 sing N N 338 PHE CE1 CZ doub Y N 339 PHE CE1 HE1 sing N N 340 PHE CE2 CZ sing Y N 341 PHE CE2 HE2 sing N N 342 PHE CZ HZ sing N N 343 PHE OXT HXT sing N N 344 PRO N CA sing N N 345 PRO N CD sing N N 346 PRO N H sing N N 347 PRO CA C sing N N 348 PRO CA CB sing N N 349 PRO CA HA sing N N 350 PRO C O doub N N 351 PRO C OXT sing N N 352 PRO CB CG sing N N 353 PRO CB HB2 sing N N 354 PRO CB HB3 sing N N 355 PRO CG CD sing N N 356 PRO CG HG2 sing N N 357 PRO CG HG3 sing N N 358 PRO CD HD2 sing N N 359 PRO CD HD3 sing N N 360 PRO OXT HXT sing N N 361 SER N CA sing N N 362 SER N H sing N N 363 SER N H2 sing N N 364 SER CA C sing N N 365 SER CA CB sing N N 366 SER CA HA sing N N 367 SER C O doub N N 368 SER C OXT sing N N 369 SER CB OG sing N N 370 SER CB HB2 sing N N 371 SER CB HB3 sing N N 372 SER OG HG sing N N 373 SER OXT HXT sing N N 374 THR N CA sing N N 375 THR N H sing N N 376 THR N H2 sing N N 377 THR CA C sing N N 378 THR CA CB sing N N 379 THR CA HA sing N N 380 THR C O doub N N 381 THR C OXT sing N N 382 THR CB OG1 sing N N 383 THR CB CG2 sing N N 384 THR CB HB sing N N 385 THR OG1 HG1 sing N N 386 THR CG2 HG21 sing N N 387 THR CG2 HG22 sing N N 388 THR CG2 HG23 sing N N 389 THR OXT HXT sing N N 390 TRP N CA sing N N 391 TRP N H sing N N 392 TRP N H2 sing N N 393 TRP CA C sing N N 394 TRP CA CB sing N N 395 TRP CA HA sing N N 396 TRP C O doub N N 397 TRP C OXT sing N N 398 TRP CB CG sing N N 399 TRP CB HB2 sing N N 400 TRP CB HB3 sing N N 401 TRP CG CD1 doub Y N 402 TRP CG CD2 sing Y N 403 TRP CD1 NE1 sing Y N 404 TRP CD1 HD1 sing N N 405 TRP CD2 CE2 doub Y N 406 TRP CD2 CE3 sing Y N 407 TRP NE1 CE2 sing Y N 408 TRP NE1 HE1 sing N N 409 TRP CE2 CZ2 sing Y N 410 TRP CE3 CZ3 doub Y N 411 TRP CE3 HE3 sing N N 412 TRP CZ2 CH2 doub Y N 413 TRP CZ2 HZ2 sing N N 414 TRP CZ3 CH2 sing Y N 415 TRP CZ3 HZ3 sing N N 416 TRP CH2 HH2 sing N N 417 TRP OXT HXT sing N N 418 TYR N CA sing N N 419 TYR N H sing N N 420 TYR N H2 sing N N 421 TYR CA C sing N N 422 TYR CA CB sing N N 423 TYR CA HA sing N N 424 TYR C O doub N N 425 TYR C OXT sing N N 426 TYR CB CG sing N N 427 TYR CB HB2 sing N N 428 TYR CB HB3 sing N N 429 TYR CG CD1 doub Y N 430 TYR CG CD2 sing Y N 431 TYR CD1 CE1 sing Y N 432 TYR CD1 HD1 sing N N 433 TYR CD2 CE2 doub Y N 434 TYR CD2 HD2 sing N N 435 TYR CE1 CZ doub Y N 436 TYR CE1 HE1 sing N N 437 TYR CE2 CZ sing Y N 438 TYR CE2 HE2 sing N N 439 TYR CZ OH sing N N 440 TYR OH HH sing N N 441 TYR OXT HXT sing N N 442 VAL N CA sing N N 443 VAL N H sing N N 444 VAL N H2 sing N N 445 VAL CA C sing N N 446 VAL CA CB sing N N 447 VAL CA HA sing N N 448 VAL C O doub N N 449 VAL C OXT sing N N 450 VAL CB CG1 sing N N 451 VAL CB CG2 sing N N 452 VAL CB HB sing N N 453 VAL CG1 HG11 sing N N 454 VAL CG1 HG12 sing N N 455 VAL CG1 HG13 sing N N 456 VAL CG2 HG21 sing N N 457 VAL CG2 HG22 sing N N 458 VAL CG2 HG23 sing N N 459 VAL OXT HXT sing N N 460 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6PJ3 _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 32 2 1' _space_group.name_Hall ;P 32 2" ; _space_group.IT_number 154 _space_group.crystal_system trigonal _space_group.id 1 # _atom_sites.entry_id 9CCX _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.009378 _atom_sites.fract_transf_matrix[1][2] 0.005415 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010829 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018426 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? F ? ? 8.95735 ? ? ? 7.27484 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MN ? ? 20.23591 4.67902 ? ? 2.76514 44.01191 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #