data_9D9C # _entry.id 9D9C # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.403 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9D9C pdb_00009d9c 10.2210/pdb9d9c/pdb WWPDB D_1000287617 ? ? BMRB 31197 ? 10.13018/BMR31197 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-04-02 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9D9C _pdbx_database_status.recvd_initial_deposition_date 2024-08-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Incorporation of dehydro-aza-proline residues in avian pancreatic polypeptide: Aza-Pro substitution at positions 4 and 6' _pdbx_database_related.db_id 31197 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email horne@pitt.edu _pdbx_contact_author.name_first William _pdbx_contact_author.name_last Horne _pdbx_contact_author.name_mi Seth _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2927-1739 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wright, M.M.' 1 ? 'Rajewski, B.H.' 2 ? 'Gerrein, T.A.' 3 ? 'Smith, L.J.' 4 ? 'Horne, W.S.' 5 ? 'Del Valle, J.R.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Commun Chem' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2399-3669 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 8 _citation.language ? _citation.page_first 76 _citation.page_last 76 _citation.title 'Stabilization of a miniprotein fold by an unpuckered proline surrogate.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s42004-025-01474-6 _citation.pdbx_database_id_PubMed 40075167 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wright, M.M.' 1 ? primary 'Rajewski, B.H.' 2 ? primary 'Gerrein, T.A.' 3 ? primary 'Xu, Z.' 4 ? primary 'Smith, L.J.' 5 0000-0001-5040-9267 primary 'Seth Horne, W.' 6 0000-0003-2927-1739 primary 'Del Valle, J.R.' 7 0000-0002-8315-5264 # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description 'Pancreatic polypeptide' _entity.formula_weight 4203.570 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name PP # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'GPS(A1A3M)P(A1A3M)YPGDDAPVEDLIRFYDNLQQYLNVVTRHRY(NH2)' _entity_poly.pdbx_seq_one_letter_code_can GPSXPXYPGDDAPVEDLIRFYDNLQQYLNVVTRHRYX _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 SER n 1 4 A1A3M n 1 5 PRO n 1 6 A1A3M n 1 7 TYR n 1 8 PRO n 1 9 GLY n 1 10 ASP n 1 11 ASP n 1 12 ALA n 1 13 PRO n 1 14 VAL n 1 15 GLU n 1 16 ASP n 1 17 LEU n 1 18 ILE n 1 19 ARG n 1 20 PHE n 1 21 TYR n 1 22 ASP n 1 23 ASN n 1 24 LEU n 1 25 GLN n 1 26 GLN n 1 27 TYR n 1 28 LEU n 1 29 ASN n 1 30 VAL n 1 31 VAL n 1 32 THR n 1 33 ARG n 1 34 HIS n 1 35 ARG n 1 36 TYR n 1 37 NH2 n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 37 _pdbx_entity_src_syn.organism_scientific 'Meleagris gallopavo' _pdbx_entity_src_syn.organism_common_name turkey _pdbx_entity_src_syn.ncbi_taxonomy_id 9103 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1A3M 'L-peptide linking' n '(5S)-4,5-dihydro-1H-pyrazole-5-carboxylic acid' ? 'C4 H6 N2 O2' 114.103 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 NH2 non-polymer . 'AMINO GROUP' ? 'H2 N' 16.023 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 A1A3M 4 4 4 A1A3M DAP A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 A1A3M 6 6 6 A1A3M DAP A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 HIS 34 34 34 HIS HIS A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 NH2 37 37 37 NH2 NH2 A . n B 1 1 GLY 1 1 1 GLY GLY B . n B 1 2 PRO 2 2 2 PRO PRO B . n B 1 3 SER 3 3 3 SER SER B . n B 1 4 A1A3M 4 4 4 A1A3M DAP B . n B 1 5 PRO 5 5 5 PRO PRO B . n B 1 6 A1A3M 6 6 6 A1A3M DAP B . n B 1 7 TYR 7 7 7 TYR TYR B . n B 1 8 PRO 8 8 8 PRO PRO B . n B 1 9 GLY 9 9 9 GLY GLY B . n B 1 10 ASP 10 10 10 ASP ASP B . n B 1 11 ASP 11 11 11 ASP ASP B . n B 1 12 ALA 12 12 12 ALA ALA B . n B 1 13 PRO 13 13 13 PRO PRO B . n B 1 14 VAL 14 14 14 VAL VAL B . n B 1 15 GLU 15 15 15 GLU GLU B . n B 1 16 ASP 16 16 16 ASP ASP B . n B 1 17 LEU 17 17 17 LEU LEU B . n B 1 18 ILE 18 18 18 ILE ILE B . n B 1 19 ARG 19 19 19 ARG ARG B . n B 1 20 PHE 20 20 20 PHE PHE B . n B 1 21 TYR 21 21 21 TYR TYR B . n B 1 22 ASP 22 22 22 ASP ASP B . n B 1 23 ASN 23 23 23 ASN ASN B . n B 1 24 LEU 24 24 24 LEU LEU B . n B 1 25 GLN 25 25 25 GLN GLN B . n B 1 26 GLN 26 26 26 GLN GLN B . n B 1 27 TYR 27 27 27 TYR TYR B . n B 1 28 LEU 28 28 28 LEU LEU B . n B 1 29 ASN 29 29 29 ASN ASN B . n B 1 30 VAL 30 30 30 VAL VAL B . n B 1 31 VAL 31 31 31 VAL VAL B . n B 1 32 THR 32 32 32 THR THR B . n B 1 33 ARG 33 33 33 ARG ARG B . n B 1 34 HIS 34 34 34 HIS HIS B . n B 1 35 ARG 35 35 35 ARG ARG B . n B 1 36 TYR 36 36 36 TYR TYR B . n B 1 37 NH2 37 37 37 NH2 NH2 B . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1A3M _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1A3M _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9D9C _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9D9C _struct.title 'Incorporation of dehydro-aza-proline residues in avian pancreatic polypeptide: Aza-Pro substitution at positions 4 and 6' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9D9C _struct_keywords.text 'PANCREATIC HORMONE, MODIFIED BACKBONE, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PAHO_MELGA _struct_ref.pdbx_db_accession P68249 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GPSQPTYPGDDAPVEDLIRFYNDLQQYLNVVTRHRY _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9D9C A 1 ? 36 ? P68249 1 ? 36 ? 1 36 2 1 9D9C B 1 ? 36 ? P68249 1 ? 36 ? 1 36 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9D9C A1A3M A 4 ? UNP P68249 GLN 4 'engineered mutation' 4 1 1 9D9C A1A3M A 6 ? UNP P68249 THR 6 'engineered mutation' 6 2 1 9D9C ASP A 22 ? UNP P68249 ASN 22 conflict 22 3 1 9D9C ASN A 23 ? UNP P68249 ASP 23 conflict 23 4 1 9D9C NH2 A 37 ? UNP P68249 ? ? amidation 37 5 2 9D9C A1A3M B 4 ? UNP P68249 GLN 4 'engineered mutation' 4 6 2 9D9C A1A3M B 6 ? UNP P68249 THR 6 'engineered mutation' 6 7 2 9D9C ASP B 22 ? UNP P68249 ASN 22 conflict 22 8 2 9D9C ASN B 23 ? UNP P68249 ASP 23 conflict 23 9 2 9D9C NH2 B 37 ? UNP P68249 ? ? amidation 37 10 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_auth_evidence.id _pdbx_struct_assembly_auth_evidence.assembly_id _pdbx_struct_assembly_auth_evidence.experimental_support _pdbx_struct_assembly_auth_evidence.details 1 1 'equilibrium centrifugation' ? 2 1 'NMR Distance Restraints' ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 13 ? THR A 32 ? PRO A 13 THR A 32 1 ? 20 HELX_P HELX_P2 AA2 PRO B 13 ? THR B 32 ? PRO B 13 THR B 32 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A SER 3 C ? ? ? 1_555 A A1A3M 4 N ? ? A SER 3 A A1A3M 4 1_555 ? ? ? ? ? ? ? 1.338 ? ? covale2 covale both ? A A1A3M 4 C ? ? ? 1_555 A PRO 5 N ? ? A A1A3M 4 A PRO 5 1_555 ? ? ? ? ? ? ? 1.340 ? ? covale3 covale both ? A PRO 5 C ? ? ? 1_555 A A1A3M 6 N ? ? A PRO 5 A A1A3M 6 1_555 ? ? ? ? ? ? ? 1.344 ? ? covale4 covale both ? A A1A3M 6 C ? ? ? 1_555 A TYR 7 N ? ? A A1A3M 6 A TYR 7 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale5 covale both ? A TYR 36 C ? ? ? 1_555 A NH2 37 N ? ? A TYR 36 A NH2 37 1_555 ? ? ? ? ? ? ? 1.320 ? ? covale6 covale both ? B SER 3 C ? ? ? 1_555 B A1A3M 4 N ? ? B SER 3 B A1A3M 4 1_555 ? ? ? ? ? ? ? 1.340 ? ? covale7 covale both ? B A1A3M 4 C ? ? ? 1_555 B PRO 5 N ? ? B A1A3M 4 B PRO 5 1_555 ? ? ? ? ? ? ? 1.340 ? ? covale8 covale both ? B PRO 5 C ? ? ? 1_555 B A1A3M 6 N ? ? B PRO 5 B A1A3M 6 1_555 ? ? ? ? ? ? ? 1.343 ? ? covale9 covale both ? B A1A3M 6 C ? ? ? 1_555 B TYR 7 N ? ? B A1A3M 6 B TYR 7 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale10 covale both ? B TYR 36 C ? ? ? 1_555 B NH2 37 N ? ? B TYR 36 B NH2 37 1_555 ? ? ? ? ? ? ? 1.318 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 A1A3M A 4 ? . . . . A1A3M A 4 ? 1_555 . . . . . . . PRO 1 A1A3M None 'Non-standard residue' 2 A1A3M A 6 ? . . . . A1A3M A 6 ? 1_555 . . . . . . . PRO 1 A1A3M None 'Non-standard residue' 3 A1A3M B 4 ? . . . . A1A3M B 4 ? 1_555 . . . . . . . PRO 1 A1A3M None 'Non-standard residue' 4 A1A3M B 6 ? . . . . A1A3M B 6 ? 1_555 . . . . . . . PRO 1 A1A3M None 'Non-standard residue' 5 NH2 A 37 ? TYR A 36 ? NH2 A 37 ? 1_555 TYR A 36 ? 1_555 . . TYR 5 NH2 None 'Terminal amidation' 6 NH2 B 37 ? TYR B 36 ? NH2 B 37 ? 1_555 TYR B 36 ? 1_555 . . TYR 5 NH2 None 'Terminal amidation' # _pdbx_entry_details.entry_id 9D9C _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 2 ? ? -83.03 41.83 2 1 PRO B 2 ? ? -82.72 41.80 3 2 A1A3M A 4 ? ? -56.52 109.59 4 2 A1A3M A 6 ? ? -67.45 88.55 5 2 ASP A 10 ? ? 68.63 -70.52 6 2 A1A3M B 4 ? ? -56.75 109.64 7 2 A1A3M B 6 ? ? -67.37 88.38 8 2 ASP B 10 ? ? 68.84 -71.41 9 4 ASP A 10 ? ? 70.50 -69.67 10 4 ASP A 11 ? ? -161.76 111.14 11 4 ASP B 10 ? ? 69.99 -69.47 12 4 ASP B 11 ? ? -161.64 111.46 13 5 ASP A 11 ? ? 53.58 70.43 14 6 A1A3M A 4 ? ? -51.79 106.91 15 6 ASP A 10 ? ? 69.01 -77.56 16 6 A1A3M B 4 ? ? -51.14 106.73 17 6 ASP B 10 ? ? 68.41 -77.95 18 8 ASP A 11 ? ? 61.08 96.89 19 8 ARG A 33 ? ? -67.98 79.14 20 8 ASP B 11 ? ? 61.59 96.92 21 8 ARG B 33 ? ? -68.14 79.34 22 9 A1A3M A 4 ? ? -52.62 107.81 23 9 A1A3M B 4 ? ? -52.19 107.62 24 10 PRO A 8 ? ? -79.12 33.20 25 10 PRO B 8 ? ? -79.20 32.98 # _pdbx_nmr_ensemble.entry_id 9D9C _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9D9C _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;2 mM avian pancreatic polypeptide, dehydro-aza-proline substitution at residues 4 and 6, 50 mM [U-2H] sodium acetate, 0.05 mM DSS, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label sample_1 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'avian pancreatic polypeptide, dehydro-aza-proline substitution at residues 4 and 6' 2 ? mM 'natural abundance' 1 'sodium acetate' 50 ? mM '[U-2H]' 1 DSS 0.05 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 4.1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH* _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-1H TOCSY' 1 isotropic 2 1 1 '2D 1H-1H NOESY' 1 isotropic # _pdbx_nmr_refine.entry_id 9D9C _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 3 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing TopSpin ? 'Bruker Biospin' 2 'peak picking' Poky ? 'Manthey, Tonelli, Clos II, Rahimi, Markley and Lee' 3 'structure calculation' ARIA ? ;Linge, O'Donoghue and Nilges ; # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1A3M N N N N 1 A1A3M CA C N S 2 A1A3M C C N N 3 A1A3M O O N N 4 A1A3M CB C N N 5 A1A3M CG C N N 6 A1A3M ND N N N 7 A1A3M H H N N 8 A1A3M HA H N N 9 A1A3M HB1 H N N 10 A1A3M HB2 H N N 11 A1A3M HG H N N 12 A1A3M OXT O N N 13 A1A3M HXT H N N 14 ALA N N N N 15 ALA CA C N S 16 ALA C C N N 17 ALA O O N N 18 ALA CB C N N 19 ALA OXT O N N 20 ALA H H N N 21 ALA H2 H N N 22 ALA HA H N N 23 ALA HB1 H N N 24 ALA HB2 H N N 25 ALA HB3 H N N 26 ALA HXT H N N 27 ARG N N N N 28 ARG CA C N S 29 ARG C C N N 30 ARG O O N N 31 ARG CB C N N 32 ARG CG C N N 33 ARG CD C N N 34 ARG NE N N N 35 ARG CZ C N N 36 ARG NH1 N N N 37 ARG NH2 N N N 38 ARG OXT O N N 39 ARG H H N N 40 ARG H2 H N N 41 ARG HA H N N 42 ARG HB2 H N N 43 ARG HB3 H N N 44 ARG HG2 H N N 45 ARG HG3 H N N 46 ARG HD2 H N N 47 ARG HD3 H N N 48 ARG HE H N N 49 ARG HH11 H N N 50 ARG HH12 H N N 51 ARG HH21 H N N 52 ARG HH22 H N N 53 ARG HXT H N N 54 ASN N N N N 55 ASN CA C N S 56 ASN C C N N 57 ASN O O N N 58 ASN CB C N N 59 ASN CG C N N 60 ASN OD1 O N N 61 ASN ND2 N N N 62 ASN OXT O N N 63 ASN H H N N 64 ASN H2 H N N 65 ASN HA H N N 66 ASN HB2 H N N 67 ASN HB3 H N N 68 ASN HD21 H N N 69 ASN HD22 H N N 70 ASN HXT H N N 71 ASP N N N N 72 ASP CA C N S 73 ASP C C N N 74 ASP O O N N 75 ASP CB C N N 76 ASP CG C N N 77 ASP OD1 O N N 78 ASP OD2 O N N 79 ASP OXT O N N 80 ASP H H N N 81 ASP H2 H N N 82 ASP HA H N N 83 ASP HB2 H N N 84 ASP HB3 H N N 85 ASP HD2 H N N 86 ASP HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 NH2 N N N N 202 NH2 HN1 H N N 203 NH2 HN2 H N N 204 PHE N N N N 205 PHE CA C N S 206 PHE C C N N 207 PHE O O N N 208 PHE CB C N N 209 PHE CG C Y N 210 PHE CD1 C Y N 211 PHE CD2 C Y N 212 PHE CE1 C Y N 213 PHE CE2 C Y N 214 PHE CZ C Y N 215 PHE OXT O N N 216 PHE H H N N 217 PHE H2 H N N 218 PHE HA H N N 219 PHE HB2 H N N 220 PHE HB3 H N N 221 PHE HD1 H N N 222 PHE HD2 H N N 223 PHE HE1 H N N 224 PHE HE2 H N N 225 PHE HZ H N N 226 PHE HXT H N N 227 PRO N N N N 228 PRO CA C N S 229 PRO C C N N 230 PRO O O N N 231 PRO CB C N N 232 PRO CG C N N 233 PRO CD C N N 234 PRO OXT O N N 235 PRO H H N N 236 PRO HA H N N 237 PRO HB2 H N N 238 PRO HB3 H N N 239 PRO HG2 H N N 240 PRO HG3 H N N 241 PRO HD2 H N N 242 PRO HD3 H N N 243 PRO HXT H N N 244 SER N N N N 245 SER CA C N S 246 SER C C N N 247 SER O O N N 248 SER CB C N N 249 SER OG O N N 250 SER OXT O N N 251 SER H H N N 252 SER H2 H N N 253 SER HA H N N 254 SER HB2 H N N 255 SER HB3 H N N 256 SER HG H N N 257 SER HXT H N N 258 THR N N N N 259 THR CA C N S 260 THR C C N N 261 THR O O N N 262 THR CB C N R 263 THR OG1 O N N 264 THR CG2 C N N 265 THR OXT O N N 266 THR H H N N 267 THR H2 H N N 268 THR HA H N N 269 THR HB H N N 270 THR HG1 H N N 271 THR HG21 H N N 272 THR HG22 H N N 273 THR HG23 H N N 274 THR HXT H N N 275 TYR N N N N 276 TYR CA C N S 277 TYR C C N N 278 TYR O O N N 279 TYR CB C N N 280 TYR CG C Y N 281 TYR CD1 C Y N 282 TYR CD2 C Y N 283 TYR CE1 C Y N 284 TYR CE2 C Y N 285 TYR CZ C Y N 286 TYR OH O N N 287 TYR OXT O N N 288 TYR H H N N 289 TYR H2 H N N 290 TYR HA H N N 291 TYR HB2 H N N 292 TYR HB3 H N N 293 TYR HD1 H N N 294 TYR HD2 H N N 295 TYR HE1 H N N 296 TYR HE2 H N N 297 TYR HH H N N 298 TYR HXT H N N 299 VAL N N N N 300 VAL CA C N S 301 VAL C C N N 302 VAL O O N N 303 VAL CB C N N 304 VAL CG1 C N N 305 VAL CG2 C N N 306 VAL OXT O N N 307 VAL H H N N 308 VAL H2 H N N 309 VAL HA H N N 310 VAL HB H N N 311 VAL HG11 H N N 312 VAL HG12 H N N 313 VAL HG13 H N N 314 VAL HG21 H N N 315 VAL HG22 H N N 316 VAL HG23 H N N 317 VAL HXT H N N 318 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1A3M CB CA sing N N 1 A1A3M CB CG sing N N 2 A1A3M CA C sing N N 3 A1A3M CA N sing N N 4 A1A3M CG ND doub N N 5 A1A3M C O doub N N 6 A1A3M N ND sing N N 7 A1A3M N H sing N N 8 A1A3M CA HA sing N N 9 A1A3M CB HB1 sing N N 10 A1A3M CB HB2 sing N N 11 A1A3M CG HG sing N N 12 A1A3M C OXT sing N N 13 A1A3M OXT HXT sing N N 14 ALA N CA sing N N 15 ALA N H sing N N 16 ALA N H2 sing N N 17 ALA CA C sing N N 18 ALA CA CB sing N N 19 ALA CA HA sing N N 20 ALA C O doub N N 21 ALA C OXT sing N N 22 ALA CB HB1 sing N N 23 ALA CB HB2 sing N N 24 ALA CB HB3 sing N N 25 ALA OXT HXT sing N N 26 ARG N CA sing N N 27 ARG N H sing N N 28 ARG N H2 sing N N 29 ARG CA C sing N N 30 ARG CA CB sing N N 31 ARG CA HA sing N N 32 ARG C O doub N N 33 ARG C OXT sing N N 34 ARG CB CG sing N N 35 ARG CB HB2 sing N N 36 ARG CB HB3 sing N N 37 ARG CG CD sing N N 38 ARG CG HG2 sing N N 39 ARG CG HG3 sing N N 40 ARG CD NE sing N N 41 ARG CD HD2 sing N N 42 ARG CD HD3 sing N N 43 ARG NE CZ sing N N 44 ARG NE HE sing N N 45 ARG CZ NH1 sing N N 46 ARG CZ NH2 doub N N 47 ARG NH1 HH11 sing N N 48 ARG NH1 HH12 sing N N 49 ARG NH2 HH21 sing N N 50 ARG NH2 HH22 sing N N 51 ARG OXT HXT sing N N 52 ASN N CA sing N N 53 ASN N H sing N N 54 ASN N H2 sing N N 55 ASN CA C sing N N 56 ASN CA CB sing N N 57 ASN CA HA sing N N 58 ASN C O doub N N 59 ASN C OXT sing N N 60 ASN CB CG sing N N 61 ASN CB HB2 sing N N 62 ASN CB HB3 sing N N 63 ASN CG OD1 doub N N 64 ASN CG ND2 sing N N 65 ASN ND2 HD21 sing N N 66 ASN ND2 HD22 sing N N 67 ASN OXT HXT sing N N 68 ASP N CA sing N N 69 ASP N H sing N N 70 ASP N H2 sing N N 71 ASP CA C sing N N 72 ASP CA CB sing N N 73 ASP CA HA sing N N 74 ASP C O doub N N 75 ASP C OXT sing N N 76 ASP CB CG sing N N 77 ASP CB HB2 sing N N 78 ASP CB HB3 sing N N 79 ASP CG OD1 doub N N 80 ASP CG OD2 sing N N 81 ASP OD2 HD2 sing N N 82 ASP OXT HXT sing N N 83 GLN N CA sing N N 84 GLN N H sing N N 85 GLN N H2 sing N N 86 GLN CA C sing N N 87 GLN CA CB sing N N 88 GLN CA HA sing N N 89 GLN C O doub N N 90 GLN C OXT sing N N 91 GLN CB CG sing N N 92 GLN CB HB2 sing N N 93 GLN CB HB3 sing N N 94 GLN CG CD sing N N 95 GLN CG HG2 sing N N 96 GLN CG HG3 sing N N 97 GLN CD OE1 doub N N 98 GLN CD NE2 sing N N 99 GLN NE2 HE21 sing N N 100 GLN NE2 HE22 sing N N 101 GLN OXT HXT sing N N 102 GLU N CA sing N N 103 GLU N H sing N N 104 GLU N H2 sing N N 105 GLU CA C sing N N 106 GLU CA CB sing N N 107 GLU CA HA sing N N 108 GLU C O doub N N 109 GLU C OXT sing N N 110 GLU CB CG sing N N 111 GLU CB HB2 sing N N 112 GLU CB HB3 sing N N 113 GLU CG CD sing N N 114 GLU CG HG2 sing N N 115 GLU CG HG3 sing N N 116 GLU CD OE1 doub N N 117 GLU CD OE2 sing N N 118 GLU OE2 HE2 sing N N 119 GLU OXT HXT sing N N 120 GLY N CA sing N N 121 GLY N H sing N N 122 GLY N H2 sing N N 123 GLY CA C sing N N 124 GLY CA HA2 sing N N 125 GLY CA HA3 sing N N 126 GLY C O doub N N 127 GLY C OXT sing N N 128 GLY OXT HXT sing N N 129 HIS N CA sing N N 130 HIS N H sing N N 131 HIS N H2 sing N N 132 HIS CA C sing N N 133 HIS CA CB sing N N 134 HIS CA HA sing N N 135 HIS C O doub N N 136 HIS C OXT sing N N 137 HIS CB CG sing N N 138 HIS CB HB2 sing N N 139 HIS CB HB3 sing N N 140 HIS CG ND1 sing Y N 141 HIS CG CD2 doub Y N 142 HIS ND1 CE1 doub Y N 143 HIS ND1 HD1 sing N N 144 HIS CD2 NE2 sing Y N 145 HIS CD2 HD2 sing N N 146 HIS CE1 NE2 sing Y N 147 HIS CE1 HE1 sing N N 148 HIS NE2 HE2 sing N N 149 HIS OXT HXT sing N N 150 ILE N CA sing N N 151 ILE N H sing N N 152 ILE N H2 sing N N 153 ILE CA C sing N N 154 ILE CA CB sing N N 155 ILE CA HA sing N N 156 ILE C O doub N N 157 ILE C OXT sing N N 158 ILE CB CG1 sing N N 159 ILE CB CG2 sing N N 160 ILE CB HB sing N N 161 ILE CG1 CD1 sing N N 162 ILE CG1 HG12 sing N N 163 ILE CG1 HG13 sing N N 164 ILE CG2 HG21 sing N N 165 ILE CG2 HG22 sing N N 166 ILE CG2 HG23 sing N N 167 ILE CD1 HD11 sing N N 168 ILE CD1 HD12 sing N N 169 ILE CD1 HD13 sing N N 170 ILE OXT HXT sing N N 171 LEU N CA sing N N 172 LEU N H sing N N 173 LEU N H2 sing N N 174 LEU CA C sing N N 175 LEU CA CB sing N N 176 LEU CA HA sing N N 177 LEU C O doub N N 178 LEU C OXT sing N N 179 LEU CB CG sing N N 180 LEU CB HB2 sing N N 181 LEU CB HB3 sing N N 182 LEU CG CD1 sing N N 183 LEU CG CD2 sing N N 184 LEU CG HG sing N N 185 LEU CD1 HD11 sing N N 186 LEU CD1 HD12 sing N N 187 LEU CD1 HD13 sing N N 188 LEU CD2 HD21 sing N N 189 LEU CD2 HD22 sing N N 190 LEU CD2 HD23 sing N N 191 LEU OXT HXT sing N N 192 NH2 N HN1 sing N N 193 NH2 N HN2 sing N N 194 PHE N CA sing N N 195 PHE N H sing N N 196 PHE N H2 sing N N 197 PHE CA C sing N N 198 PHE CA CB sing N N 199 PHE CA HA sing N N 200 PHE C O doub N N 201 PHE C OXT sing N N 202 PHE CB CG sing N N 203 PHE CB HB2 sing N N 204 PHE CB HB3 sing N N 205 PHE CG CD1 doub Y N 206 PHE CG CD2 sing Y N 207 PHE CD1 CE1 sing Y N 208 PHE CD1 HD1 sing N N 209 PHE CD2 CE2 doub Y N 210 PHE CD2 HD2 sing N N 211 PHE CE1 CZ doub Y N 212 PHE CE1 HE1 sing N N 213 PHE CE2 CZ sing Y N 214 PHE CE2 HE2 sing N N 215 PHE CZ HZ sing N N 216 PHE OXT HXT sing N N 217 PRO N CA sing N N 218 PRO N CD sing N N 219 PRO N H sing N N 220 PRO CA C sing N N 221 PRO CA CB sing N N 222 PRO CA HA sing N N 223 PRO C O doub N N 224 PRO C OXT sing N N 225 PRO CB CG sing N N 226 PRO CB HB2 sing N N 227 PRO CB HB3 sing N N 228 PRO CG CD sing N N 229 PRO CG HG2 sing N N 230 PRO CG HG3 sing N N 231 PRO CD HD2 sing N N 232 PRO CD HD3 sing N N 233 PRO OXT HXT sing N N 234 SER N CA sing N N 235 SER N H sing N N 236 SER N H2 sing N N 237 SER CA C sing N N 238 SER CA CB sing N N 239 SER CA HA sing N N 240 SER C O doub N N 241 SER C OXT sing N N 242 SER CB OG sing N N 243 SER CB HB2 sing N N 244 SER CB HB3 sing N N 245 SER OG HG sing N N 246 SER OXT HXT sing N N 247 THR N CA sing N N 248 THR N H sing N N 249 THR N H2 sing N N 250 THR CA C sing N N 251 THR CA CB sing N N 252 THR CA HA sing N N 253 THR C O doub N N 254 THR C OXT sing N N 255 THR CB OG1 sing N N 256 THR CB CG2 sing N N 257 THR CB HB sing N N 258 THR OG1 HG1 sing N N 259 THR CG2 HG21 sing N N 260 THR CG2 HG22 sing N N 261 THR CG2 HG23 sing N N 262 THR OXT HXT sing N N 263 TYR N CA sing N N 264 TYR N H sing N N 265 TYR N H2 sing N N 266 TYR CA C sing N N 267 TYR CA CB sing N N 268 TYR CA HA sing N N 269 TYR C O doub N N 270 TYR C OXT sing N N 271 TYR CB CG sing N N 272 TYR CB HB2 sing N N 273 TYR CB HB3 sing N N 274 TYR CG CD1 doub Y N 275 TYR CG CD2 sing Y N 276 TYR CD1 CE1 sing Y N 277 TYR CD1 HD1 sing N N 278 TYR CD2 CE2 doub Y N 279 TYR CD2 HD2 sing N N 280 TYR CE1 CZ doub Y N 281 TYR CE1 HE1 sing N N 282 TYR CE2 CZ sing Y N 283 TYR CE2 HE2 sing N N 284 TYR CZ OH sing N N 285 TYR OH HH sing N N 286 TYR OXT HXT sing N N 287 VAL N CA sing N N 288 VAL N H sing N N 289 VAL N H2 sing N N 290 VAL CA C sing N N 291 VAL CA CB sing N N 292 VAL CA HA sing N N 293 VAL C O doub N N 294 VAL C OXT sing N N 295 VAL CB CG1 sing N N 296 VAL CB CG2 sing N N 297 VAL CB HB sing N N 298 VAL CG1 HG11 sing N N 299 VAL CG1 HG12 sing N N 300 VAL CG1 HG13 sing N N 301 VAL CG2 HG21 sing N N 302 VAL CG2 HG22 sing N N 303 VAL CG2 HG23 sing N N 304 VAL OXT HXT sing N N 305 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Science Foundation (NSF, United States)' 'United States' CHE2109008 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' R35GM149220 2 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE II' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 9D9C _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O # loop_ #