data_9DA4 # _entry.id 9DA4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.402 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9DA4 pdb_00009da4 10.2210/pdb9da4/pdb WWPDB D_1000287633 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-02-05 ? 2 'Structure model' 1 1 2025-02-26 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9DA4 _pdbx_database_status.recvd_initial_deposition_date 2024-08-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'CRYSTAL STRUCTURE OF HUMAN DNPH1 (RCL) WITH 6-NAPHTHYL-PURINE-RIBOSIDE-MONOPHOSPHATE' 4P5E unspecified PDB 'Crystal structure of human DNPH1 bound to hmdUMP' 8QHQ unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email agnidipta.ghosh@einsteinmed.edu _pdbx_contact_author.name_first Agnidipta _pdbx_contact_author.name_last Ghosh _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7753-0240 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wagner, A.G.' 1 0000-0003-4786-7747 'Schramm, V.L.' 2 0000-0002-8056-1929 'Almo, S.C.' 3 0000-0003-2591-5234 'Ghosh, A.' 4 0000-0002-7753-0240 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 68 _citation.language ? _citation.page_first 3653 _citation.page_last 3672 _citation.title 'Transition State Analogs of Human DNPH1 Reveal Two Electrophile Migration Mechanisms.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.4c02778 _citation.pdbx_database_id_PubMed 39818772 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wagner, A.G.' 1 ? primary 'Lang, T.B.D.' 2 ? primary 'Ledingham, E.T.' 3 ? primary 'Ghosh, A.' 4 ? primary 'Brooks, D.' 5 ? primary 'Eskandari, R.' 6 ? primary 'Suthagar, K.' 7 ? primary 'Almo, S.C.' 8 ? primary 'Lamiable-Oulaidi, F.' 9 ? primary 'Tyler, P.C.' 10 ? primary 'Schramm, V.L.' 11 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '5-hydroxymethyl-dUMP N-hydrolase' 16224.247 1 3.2.2.- ? ? ? 2 non-polymer syn '{(3R,4R)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-hydroxypyrrolidin-3-yl}methyl dihydrogen phosphate' 343.276 1 ? ? ? ? 3 water nat water 18.015 78 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;2'-deoxynucleoside 5'-phosphate N-hydrolase 1,c-Myc-responsive protein RCL ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SMRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVLTEHVAAAELGARGEEAAGGDRLIHEQDLEWLQQADVVVAEVTQP SLGVGYELGRAVAFNKRILCLFRPQSGRVLSAMIRGAADGSRFQVWDYEEGEVEALLDRYFEADP ; _entity_poly.pdbx_seq_one_letter_code_can ;SMRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVLTEHVAAAELGARGEEAAGGDRLIHEQDLEWLQQADVVVAEVTQP SLGVGYELGRAVAFNKRILCLFRPQSGRVLSAMIRGAADGSRFQVWDYEEGEVEALLDRYFEADP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '{(3R,4R)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-hydroxypyrrolidin-3-yl}methyl dihydrogen phosphate' A1BBE 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 MET n 1 3 ARG n 1 4 PRO n 1 5 ALA n 1 6 LEU n 1 7 TYR n 1 8 PHE n 1 9 CYS n 1 10 GLY n 1 11 SER n 1 12 ILE n 1 13 ARG n 1 14 GLY n 1 15 GLY n 1 16 ARG n 1 17 GLU n 1 18 ASP n 1 19 ARG n 1 20 THR n 1 21 LEU n 1 22 TYR n 1 23 GLU n 1 24 ARG n 1 25 ILE n 1 26 VAL n 1 27 SER n 1 28 ARG n 1 29 LEU n 1 30 ARG n 1 31 ARG n 1 32 PHE n 1 33 GLY n 1 34 THR n 1 35 VAL n 1 36 LEU n 1 37 THR n 1 38 GLU n 1 39 HIS n 1 40 VAL n 1 41 ALA n 1 42 ALA n 1 43 ALA n 1 44 GLU n 1 45 LEU n 1 46 GLY n 1 47 ALA n 1 48 ARG n 1 49 GLY n 1 50 GLU n 1 51 GLU n 1 52 ALA n 1 53 ALA n 1 54 GLY n 1 55 GLY n 1 56 ASP n 1 57 ARG n 1 58 LEU n 1 59 ILE n 1 60 HIS n 1 61 GLU n 1 62 GLN n 1 63 ASP n 1 64 LEU n 1 65 GLU n 1 66 TRP n 1 67 LEU n 1 68 GLN n 1 69 GLN n 1 70 ALA n 1 71 ASP n 1 72 VAL n 1 73 VAL n 1 74 VAL n 1 75 ALA n 1 76 GLU n 1 77 VAL n 1 78 THR n 1 79 GLN n 1 80 PRO n 1 81 SER n 1 82 LEU n 1 83 GLY n 1 84 VAL n 1 85 GLY n 1 86 TYR n 1 87 GLU n 1 88 LEU n 1 89 GLY n 1 90 ARG n 1 91 ALA n 1 92 VAL n 1 93 ALA n 1 94 PHE n 1 95 ASN n 1 96 LYS n 1 97 ARG n 1 98 ILE n 1 99 LEU n 1 100 CYS n 1 101 LEU n 1 102 PHE n 1 103 ARG n 1 104 PRO n 1 105 GLN n 1 106 SER n 1 107 GLY n 1 108 ARG n 1 109 VAL n 1 110 LEU n 1 111 SER n 1 112 ALA n 1 113 MET n 1 114 ILE n 1 115 ARG n 1 116 GLY n 1 117 ALA n 1 118 ALA n 1 119 ASP n 1 120 GLY n 1 121 SER n 1 122 ARG n 1 123 PHE n 1 124 GLN n 1 125 VAL n 1 126 TRP n 1 127 ASP n 1 128 TYR n 1 129 GLU n 1 130 GLU n 1 131 GLY n 1 132 GLU n 1 133 VAL n 1 134 GLU n 1 135 ALA n 1 136 LEU n 1 137 LEU n 1 138 ASP n 1 139 ARG n 1 140 TYR n 1 141 PHE n 1 142 GLU n 1 143 ALA n 1 144 ASP n 1 145 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 145 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'DNPH1, C6orf108, RCL' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant pRIL _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details LIC _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET-28a(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1BBE non-polymer . '{(3R,4R)-1-[(4-amino-5H-pyrrolo[3,2-d]pyrimidin-7-yl)methyl]-4-hydroxypyrrolidin-3-yl}methyl dihydrogen phosphate' ? 'C12 H18 N5 O5 P' 343.276 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 18 18 SER SER A . n A 1 2 MET 2 19 19 MET MET A . n A 1 3 ARG 3 20 20 ARG ARG A . n A 1 4 PRO 4 21 21 PRO PRO A . n A 1 5 ALA 5 22 22 ALA ALA A . n A 1 6 LEU 6 23 23 LEU LEU A . n A 1 7 TYR 7 24 24 TYR TYR A . n A 1 8 PHE 8 25 25 PHE PHE A . n A 1 9 CYS 9 26 26 CYS CYS A . n A 1 10 GLY 10 27 27 GLY GLY A . n A 1 11 SER 11 28 28 SER SER A . n A 1 12 ILE 12 29 29 ILE ILE A . n A 1 13 ARG 13 30 30 ARG ARG A . n A 1 14 GLY 14 31 31 GLY GLY A . n A 1 15 GLY 15 32 32 GLY GLY A . n A 1 16 ARG 16 33 33 ARG ARG A . n A 1 17 GLU 17 34 34 GLU GLU A . n A 1 18 ASP 18 35 35 ASP ASP A . n A 1 19 ARG 19 36 36 ARG ARG A . n A 1 20 THR 20 37 37 THR THR A . n A 1 21 LEU 21 38 38 LEU LEU A . n A 1 22 TYR 22 39 39 TYR TYR A . n A 1 23 GLU 23 40 40 GLU GLU A . n A 1 24 ARG 24 41 41 ARG ARG A . n A 1 25 ILE 25 42 42 ILE ILE A . n A 1 26 VAL 26 43 43 VAL VAL A . n A 1 27 SER 27 44 44 SER SER A . n A 1 28 ARG 28 45 45 ARG ARG A . n A 1 29 LEU 29 46 46 LEU LEU A . n A 1 30 ARG 30 47 47 ARG ARG A . n A 1 31 ARG 31 48 48 ARG ARG A . n A 1 32 PHE 32 49 49 PHE PHE A . n A 1 33 GLY 33 50 50 GLY GLY A . n A 1 34 THR 34 51 51 THR THR A . n A 1 35 VAL 35 52 52 VAL VAL A . n A 1 36 LEU 36 53 53 LEU LEU A . n A 1 37 THR 37 54 54 THR THR A . n A 1 38 GLU 38 55 55 GLU GLU A . n A 1 39 HIS 39 56 56 HIS HIS A . n A 1 40 VAL 40 57 57 VAL VAL A . n A 1 41 ALA 41 58 58 ALA ALA A . n A 1 42 ALA 42 59 59 ALA ALA A . n A 1 43 ALA 43 60 60 ALA ALA A . n A 1 44 GLU 44 61 61 GLU GLU A . n A 1 45 LEU 45 62 62 LEU LEU A . n A 1 46 GLY 46 63 63 GLY GLY A . n A 1 47 ALA 47 64 64 ALA ALA A . n A 1 48 ARG 48 65 65 ARG ARG A . n A 1 49 GLY 49 66 66 GLY GLY A . n A 1 50 GLU 50 67 67 GLU GLU A . n A 1 51 GLU 51 68 68 GLU GLU A . n A 1 52 ALA 52 69 69 ALA ALA A . n A 1 53 ALA 53 70 70 ALA ALA A . n A 1 54 GLY 54 71 71 GLY GLY A . n A 1 55 GLY 55 72 72 GLY GLY A . n A 1 56 ASP 56 73 73 ASP ASP A . n A 1 57 ARG 57 74 74 ARG ARG A . n A 1 58 LEU 58 75 75 LEU LEU A . n A 1 59 ILE 59 76 76 ILE ILE A . n A 1 60 HIS 60 77 77 HIS HIS A . n A 1 61 GLU 61 78 78 GLU GLU A . n A 1 62 GLN 62 79 79 GLN GLN A . n A 1 63 ASP 63 80 80 ASP ASP A . n A 1 64 LEU 64 81 81 LEU LEU A . n A 1 65 GLU 65 82 82 GLU GLU A . n A 1 66 TRP 66 83 83 TRP TRP A . n A 1 67 LEU 67 84 84 LEU LEU A . n A 1 68 GLN 68 85 85 GLN GLN A . n A 1 69 GLN 69 86 86 GLN GLN A . n A 1 70 ALA 70 87 87 ALA ALA A . n A 1 71 ASP 71 88 88 ASP ASP A . n A 1 72 VAL 72 89 89 VAL VAL A . n A 1 73 VAL 73 90 90 VAL VAL A . n A 1 74 VAL 74 91 91 VAL VAL A . n A 1 75 ALA 75 92 92 ALA ALA A . n A 1 76 GLU 76 93 93 GLU GLU A . n A 1 77 VAL 77 94 94 VAL VAL A . n A 1 78 THR 78 95 95 THR THR A . n A 1 79 GLN 79 96 96 GLN GLN A . n A 1 80 PRO 80 97 97 PRO PRO A . n A 1 81 SER 81 98 98 SER SER A . n A 1 82 LEU 82 99 99 LEU LEU A . n A 1 83 GLY 83 100 100 GLY GLY A . n A 1 84 VAL 84 101 101 VAL VAL A . n A 1 85 GLY 85 102 102 GLY GLY A . n A 1 86 TYR 86 103 103 TYR TYR A . n A 1 87 GLU 87 104 104 GLU GLU A . n A 1 88 LEU 88 105 105 LEU LEU A . n A 1 89 GLY 89 106 106 GLY GLY A . n A 1 90 ARG 90 107 107 ARG ARG A . n A 1 91 ALA 91 108 108 ALA ALA A . n A 1 92 VAL 92 109 109 VAL VAL A . n A 1 93 ALA 93 110 110 ALA ALA A . n A 1 94 PHE 94 111 111 PHE PHE A . n A 1 95 ASN 95 112 112 ASN ASN A . n A 1 96 LYS 96 113 113 LYS LYS A . n A 1 97 ARG 97 114 114 ARG ARG A . n A 1 98 ILE 98 115 115 ILE ILE A . n A 1 99 LEU 99 116 116 LEU LEU A . n A 1 100 CYS 100 117 117 CYS CYS A . n A 1 101 LEU 101 118 118 LEU LEU A . n A 1 102 PHE 102 119 119 PHE PHE A . n A 1 103 ARG 103 120 120 ARG ARG A . n A 1 104 PRO 104 121 121 PRO PRO A . n A 1 105 GLN 105 122 122 GLN GLN A . n A 1 106 SER 106 123 123 SER SER A . n A 1 107 GLY 107 124 124 GLY GLY A . n A 1 108 ARG 108 125 125 ARG ARG A . n A 1 109 VAL 109 126 126 VAL VAL A . n A 1 110 LEU 110 127 127 LEU LEU A . n A 1 111 SER 111 128 128 SER SER A . n A 1 112 ALA 112 129 129 ALA ALA A . n A 1 113 MET 113 130 130 MET MET A . n A 1 114 ILE 114 131 131 ILE ILE A . n A 1 115 ARG 115 132 132 ARG ARG A . n A 1 116 GLY 116 133 133 GLY GLY A . n A 1 117 ALA 117 134 134 ALA ALA A . n A 1 118 ALA 118 135 135 ALA ALA A . n A 1 119 ASP 119 136 136 ASP ASP A . n A 1 120 GLY 120 137 137 GLY GLY A . n A 1 121 SER 121 138 138 SER SER A . n A 1 122 ARG 122 139 139 ARG ARG A . n A 1 123 PHE 123 140 140 PHE PHE A . n A 1 124 GLN 124 141 141 GLN GLN A . n A 1 125 VAL 125 142 142 VAL VAL A . n A 1 126 TRP 126 143 143 TRP TRP A . n A 1 127 ASP 127 144 144 ASP ASP A . n A 1 128 TYR 128 145 145 TYR TYR A . n A 1 129 GLU 129 146 146 GLU GLU A . n A 1 130 GLU 130 147 147 GLU GLU A . n A 1 131 GLY 131 148 148 GLY GLY A . n A 1 132 GLU 132 149 149 GLU GLU A . n A 1 133 VAL 133 150 150 VAL VAL A . n A 1 134 GLU 134 151 151 GLU GLU A . n A 1 135 ALA 135 152 152 ALA ALA A . n A 1 136 LEU 136 153 153 LEU LEU A . n A 1 137 LEU 137 154 154 LEU LEU A . n A 1 138 ASP 138 155 155 ASP ASP A . n A 1 139 ARG 139 156 156 ARG ARG A . n A 1 140 TYR 140 157 157 TYR TYR A . n A 1 141 PHE 141 158 158 PHE PHE A . n A 1 142 GLU 142 159 159 GLU GLU A . n A 1 143 ALA 143 160 ? ? ? A . n A 1 144 ASP 144 161 ? ? ? A . n A 1 145 PRO 145 162 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1BBE _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1BBE _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 A1BBE 1 201 201 A1BBE DIP A . C 3 HOH 1 301 50 HOH HOH A . C 3 HOH 2 302 33 HOH HOH A . C 3 HOH 3 303 13 HOH HOH A . C 3 HOH 4 304 24 HOH HOH A . C 3 HOH 5 305 26 HOH HOH A . C 3 HOH 6 306 25 HOH HOH A . C 3 HOH 7 307 23 HOH HOH A . C 3 HOH 8 308 77 HOH HOH A . C 3 HOH 9 309 64 HOH HOH A . C 3 HOH 10 310 48 HOH HOH A . C 3 HOH 11 311 11 HOH HOH A . C 3 HOH 12 312 34 HOH HOH A . C 3 HOH 13 313 15 HOH HOH A . C 3 HOH 14 314 76 HOH HOH A . C 3 HOH 15 315 66 HOH HOH A . C 3 HOH 16 316 44 HOH HOH A . C 3 HOH 17 317 19 HOH HOH A . C 3 HOH 18 318 45 HOH HOH A . C 3 HOH 19 319 56 HOH HOH A . C 3 HOH 20 320 4 HOH HOH A . C 3 HOH 21 321 51 HOH HOH A . C 3 HOH 22 322 65 HOH HOH A . C 3 HOH 23 323 2 HOH HOH A . C 3 HOH 24 324 37 HOH HOH A . C 3 HOH 25 325 71 HOH HOH A . C 3 HOH 26 326 75 HOH HOH A . C 3 HOH 27 327 3 HOH HOH A . C 3 HOH 28 328 62 HOH HOH A . C 3 HOH 29 329 55 HOH HOH A . C 3 HOH 30 330 12 HOH HOH A . C 3 HOH 31 331 43 HOH HOH A . C 3 HOH 32 332 20 HOH HOH A . C 3 HOH 33 333 63 HOH HOH A . C 3 HOH 34 334 18 HOH HOH A . C 3 HOH 35 335 52 HOH HOH A . C 3 HOH 36 336 42 HOH HOH A . C 3 HOH 37 337 41 HOH HOH A . C 3 HOH 38 338 5 HOH HOH A . C 3 HOH 39 339 1 HOH HOH A . C 3 HOH 40 340 46 HOH HOH A . C 3 HOH 41 341 9 HOH HOH A . C 3 HOH 42 342 10 HOH HOH A . C 3 HOH 43 343 22 HOH HOH A . C 3 HOH 44 344 72 HOH HOH A . C 3 HOH 45 345 30 HOH HOH A . C 3 HOH 46 346 6 HOH HOH A . C 3 HOH 47 347 54 HOH HOH A . C 3 HOH 48 348 31 HOH HOH A . C 3 HOH 49 349 61 HOH HOH A . C 3 HOH 50 350 59 HOH HOH A . C 3 HOH 51 351 49 HOH HOH A . C 3 HOH 52 352 14 HOH HOH A . C 3 HOH 53 353 8 HOH HOH A . C 3 HOH 54 354 47 HOH HOH A . C 3 HOH 55 355 21 HOH HOH A . C 3 HOH 56 356 74 HOH HOH A . C 3 HOH 57 357 68 HOH HOH A . C 3 HOH 58 358 36 HOH HOH A . C 3 HOH 59 359 57 HOH HOH A . C 3 HOH 60 360 16 HOH HOH A . C 3 HOH 61 361 38 HOH HOH A . C 3 HOH 62 362 27 HOH HOH A . C 3 HOH 63 363 69 HOH HOH A . C 3 HOH 64 364 7 HOH HOH A . C 3 HOH 65 365 35 HOH HOH A . C 3 HOH 66 366 40 HOH HOH A . C 3 HOH 67 367 28 HOH HOH A . C 3 HOH 68 368 17 HOH HOH A . C 3 HOH 69 369 39 HOH HOH A . C 3 HOH 70 370 78 HOH HOH A . C 3 HOH 71 371 29 HOH HOH A . C 3 HOH 72 372 53 HOH HOH A . C 3 HOH 73 373 58 HOH HOH A . C 3 HOH 74 374 67 HOH HOH A . C 3 HOH 75 375 70 HOH HOH A . C 3 HOH 76 376 32 HOH HOH A . C 3 HOH 77 377 73 HOH HOH A . C 3 HOH 78 378 60 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 9DA4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 83.304 _cell.length_a_esd ? _cell.length_b 83.304 _cell.length_b_esd ? _cell.length_c 80.587 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9DA4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9DA4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.49 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.55 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '25% (w/v) PEG 3350, 0.2 M Ammonium acetate and 0.1 M Bis-Tris' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 292 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-12-13 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.92 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS-II BEAMLINE 17-ID-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.92 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID-1 _diffrn_source.pdbx_synchrotron_site NSLS-II # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9DA4 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.73 _reflns.d_resolution_low 27.27 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17730 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 21.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 19.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.00 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.104 _reflns.pdbx_Rpim_I_all 0.022 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 388195 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.101 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.73 _reflns_shell.d_res_low 1.77 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all 19254 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 951 _reflns_shell.percent_possible_obs 99.7 _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 20.2 _reflns_shell.pdbx_chi_squared 0.98 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 3.9 _reflns_shell.pdbx_Rrim_I_all 0.849 _reflns_shell.pdbx_Rpim_I_all 0.186 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.938 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.828 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9DA4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.73 _refine.ls_d_res_low 27.27 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17684 _refine.ls_number_reflns_R_free 853 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.94 _refine.ls_percent_reflns_R_free 4.82 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1863 _refine.ls_R_factor_R_free 0.2296 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1840 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.63 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.13 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.73 _refine_hist.d_res_low 27.27 _refine_hist.number_atoms_solvent 78 _refine_hist.number_atoms_total 1222 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1121 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 23 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? ? ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.956 ? ? ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 5.834 ? 167 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.058 ? 167 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.011 ? 206 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.73 1.84 . . 130 2740 100.00 . . . . 0.1909 . . . . . . . . . . . 0.2485 'X-RAY DIFFRACTION' 1.84 1.98 . . 149 2745 100.00 . . . . 0.2028 . . . . . . . . . . . 0.2494 'X-RAY DIFFRACTION' 1.98 2.18 . . 115 2784 100.00 . . . . 0.1965 . . . . . . . . . . . 0.2602 'X-RAY DIFFRACTION' 2.18 2.50 . . 128 2779 100.00 . . . . 0.1890 . . . . . . . . . . . 0.2318 'X-RAY DIFFRACTION' 2.50 3.15 . . 167 2802 100.00 . . . . 0.2031 . . . . . . . . . . . 0.2499 'X-RAY DIFFRACTION' 3.15 27.27 . . 164 2981 100.00 . . . . 0.1688 . . . . . . . . . . . 0.2102 # _struct.entry_id 9DA4 _struct.title 'Crystal structure of human DNPH1 bound to inhibitor 2b' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9DA4 _struct_keywords.text 'Inhibitor, Complex, HYDROLASE, HYDROLASE-INHIBITOR complex' _struct_keywords.pdbx_keywords HYDROLASE/INHIBITOR # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DNPH1_HUMAN _struct_ref.pdbx_db_accession O43598 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;RPALYFCGSIRGGREDRTLYERIVSRLRRFGTVLTEHVAAAELGARGEEAAGGDRLIHEQDLEWLQQADVVVAEVTQPSL GVGYELGRAVAFNKRILCLFRPQSGRVLSAMIRGAADGSRFQVWDYEEGEVEALLDRYFEADP ; _struct_ref.pdbx_align_begin 20 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9DA4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 145 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O43598 _struct_ref_seq.db_align_beg 20 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 162 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 20 _struct_ref_seq.pdbx_auth_seq_align_end 162 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9DA4 SER A 1 ? UNP O43598 ? ? 'expression tag' 18 1 1 9DA4 MET A 2 ? UNP O43598 ? ? 'expression tag' 19 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3180 ? 1 MORE -32 ? 1 'SSA (A^2)' 12570 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details 'Superdex S200' # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 12_565 x,x-y+1,-z+1/6 0.5000000000 0.8660254038 0.0000000000 -41.6520000000 0.8660254038 -0.5000000000 0.0000000000 72.1433802369 0.0000000000 0.0000000000 -1.0000000000 13.4311666667 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 18 ? ARG A 30 ? ASP A 35 ARG A 47 1 ? 13 HELX_P HELX_P2 AA2 THR A 37 ? ALA A 41 ? THR A 54 ALA A 58 5 ? 5 HELX_P HELX_P3 AA3 GLY A 46 ? ALA A 53 ? GLY A 63 ALA A 70 1 ? 8 HELX_P HELX_P4 AA4 GLY A 55 ? ALA A 70 ? GLY A 72 ALA A 87 1 ? 16 HELX_P HELX_P5 AA5 SER A 81 ? PHE A 94 ? SER A 98 PHE A 111 1 ? 14 HELX_P HELX_P6 AA6 ARG A 103 ? GLY A 107 ? ARG A 120 GLY A 124 5 ? 5 HELX_P HELX_P7 AA7 SER A 111 ? GLY A 116 ? SER A 128 GLY A 133 1 ? 6 HELX_P HELX_P8 AA8 GLU A 129 ? GLY A 131 ? GLU A 146 GLY A 148 5 ? 3 HELX_P HELX_P9 AA9 GLU A 132 ? PHE A 141 ? GLU A 149 PHE A 158 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 34 ? VAL A 35 ? THR A 51 VAL A 52 AA1 2 ALA A 5 ? CYS A 9 ? ALA A 22 CYS A 26 AA1 3 VAL A 72 ? GLU A 76 ? VAL A 89 GLU A 93 AA1 4 ARG A 97 ? PHE A 102 ? ARG A 114 PHE A 119 AA1 5 PHE A 123 ? ASP A 127 ? PHE A 140 ASP A 144 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O THR A 34 ? O THR A 51 N LEU A 6 ? N LEU A 23 AA1 2 3 N TYR A 7 ? N TYR A 24 O VAL A 74 ? O VAL A 91 AA1 3 4 N ALA A 75 ? N ALA A 92 O LEU A 99 ? O LEU A 116 AA1 4 5 N CYS A 100 ? N CYS A 117 O GLN A 124 ? O GLN A 141 # _pdbx_entry_details.entry_id 9DA4 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 29 ? ? -122.81 -73.81 2 1 SER A 128 ? ? -31.03 129.58 3 1 SER A 138 ? ? -135.71 -80.92 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 339 ? C HOH . 2 1 A HOH 375 ? C HOH . 3 1 A HOH 376 ? C HOH . # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -19.1700 34.2146 -8.5775 0.2765 ? -0.0704 ? 0.0177 ? 0.3310 ? -0.0152 ? 0.2434 ? 1.6466 ? -0.9807 ? 0.2932 ? 2.0275 ? 0.0989 ? 2.2565 ? 0.0409 ? 0.1097 ? 0.0446 ? -0.0830 ? 0.0494 ? -0.1665 ? -0.0856 ? -0.0209 ? -0.0549 ? 2 'X-RAY DIFFRACTION' ? refined -14.6664 28.2078 8.2295 0.2077 ? -0.0294 ? -0.0241 ? 0.2431 ? 0.0021 ? 0.2428 ? 2.2306 ? 0.0893 ? 0.1387 ? 3.3068 ? 0.5174 ? 4.0735 ? 0.0055 ? -0.1236 ? -0.2250 ? 0.1990 ? 0.0994 ? -0.3073 ? 0.4576 ? 0.1986 ? -0.1030 ? 3 'X-RAY DIFFRACTION' ? refined -5.6788 17.5909 3.8050 0.5350 ? 0.1521 ? -0.0434 ? 0.5018 ? -0.0172 ? 0.5106 ? 7.6866 ? 0.4097 ? -0.3988 ? 6.6224 ? 1.5127 ? 9.0646 ? 0.2583 ? 0.1431 ? -0.5919 ? 0.6048 ? 0.1365 ? -1.1402 ? 1.3367 ? 1.4764 ? -0.3349 ? 4 'X-RAY DIFFRACTION' ? refined -13.6579 29.0399 -3.6051 0.2297 ? -0.0792 ? 0.0587 ? 0.2903 ? -0.0623 ? 0.2991 ? 2.0784 ? 1.7632 ? 1.0155 ? 2.1111 ? -0.1874 ? 2.0598 ? -0.2448 ? 0.3704 ? -0.2351 ? -0.4186 ? 0.4441 ? -0.6535 ? 0.0176 ? 0.3346 ? -0.2005 ? 5 'X-RAY DIFFRACTION' ? refined -5.6204 24.9971 -4.5524 0.2672 ? 0.0152 ? 0.0694 ? 0.4336 ? -0.1042 ? 0.3974 ? 4.1164 ? 2.3010 ? 0.2052 ? 7.4243 ? 2.3151 ? 4.0562 ? 0.1129 ? 0.4216 ? -0.1779 ? -0.6274 ? 0.3469 ? -1.2076 ? 0.0367 ? 0.7175 ? -0.3533 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 49 through 86 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 87 through 146 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 147 through 159 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 18 through 35 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 36 through 48 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 160 ? A ALA 143 2 1 Y 1 A ASP 161 ? A ASP 144 3 1 Y 1 A PRO 162 ? A PRO 145 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1BBE C2 C Y N 1 A1BBE C4 C Y N 2 A1BBE C5 C Y N 3 A1BBE C01 C N R 4 A1BBE C02 C N R 5 A1BBE C03 C N N 6 A1BBE C04 C N N 7 A1BBE C05 C N N 8 A1BBE C12 C N N 9 A1BBE C6 C Y N 10 A1BBE C8 C Y N 11 A1BBE C9 C Y N 12 A1BBE N01 N N N 13 A1BBE N1 N Y N 14 A1BBE N3 N Y N 15 A1BBE N6 N N N 16 A1BBE N7 N Y N 17 A1BBE O01 O N N 18 A1BBE O02 O N N 19 A1BBE O03 O N N 20 A1BBE O04 O N N 21 A1BBE O05 O N N 22 A1BBE P01 P N N 23 A1BBE H1 H N N 24 A1BBE H2 H N N 25 A1BBE H3 H N N 26 A1BBE H4 H N N 27 A1BBE H5 H N N 28 A1BBE H6 H N N 29 A1BBE H7 H N N 30 A1BBE H8 H N N 31 A1BBE H9 H N N 32 A1BBE H10 H N N 33 A1BBE H11 H N N 34 A1BBE H12 H N N 35 A1BBE H14 H N N 36 A1BBE H15 H N N 37 A1BBE H16 H N N 38 A1BBE H17 H N N 39 A1BBE H18 H N N 40 A1BBE H19 H N N 41 ALA N N N N 42 ALA CA C N S 43 ALA C C N N 44 ALA O O N N 45 ALA CB C N N 46 ALA OXT O N N 47 ALA H H N N 48 ALA H2 H N N 49 ALA HA H N N 50 ALA HB1 H N N 51 ALA HB2 H N N 52 ALA HB3 H N N 53 ALA HXT H N N 54 ARG N N N N 55 ARG CA C N S 56 ARG C C N N 57 ARG O O N N 58 ARG CB C N N 59 ARG CG C N N 60 ARG CD C N N 61 ARG NE N N N 62 ARG CZ C N N 63 ARG NH1 N N N 64 ARG NH2 N N N 65 ARG OXT O N N 66 ARG H H N N 67 ARG H2 H N N 68 ARG HA H N N 69 ARG HB2 H N N 70 ARG HB3 H N N 71 ARG HG2 H N N 72 ARG HG3 H N N 73 ARG HD2 H N N 74 ARG HD3 H N N 75 ARG HE H N N 76 ARG HH11 H N N 77 ARG HH12 H N N 78 ARG HH21 H N N 79 ARG HH22 H N N 80 ARG HXT H N N 81 ASN N N N N 82 ASN CA C N S 83 ASN C C N N 84 ASN O O N N 85 ASN CB C N N 86 ASN CG C N N 87 ASN OD1 O N N 88 ASN ND2 N N N 89 ASN OXT O N N 90 ASN H H N N 91 ASN H2 H N N 92 ASN HA H N N 93 ASN HB2 H N N 94 ASN HB3 H N N 95 ASN HD21 H N N 96 ASN HD22 H N N 97 ASN HXT H N N 98 ASP N N N N 99 ASP CA C N S 100 ASP C C N N 101 ASP O O N N 102 ASP CB C N N 103 ASP CG C N N 104 ASP OD1 O N N 105 ASP OD2 O N N 106 ASP OXT O N N 107 ASP H H N N 108 ASP H2 H N N 109 ASP HA H N N 110 ASP HB2 H N N 111 ASP HB3 H N N 112 ASP HD2 H N N 113 ASP HXT H N N 114 CYS N N N N 115 CYS CA C N R 116 CYS C C N N 117 CYS O O N N 118 CYS CB C N N 119 CYS SG S N N 120 CYS OXT O N N 121 CYS H H N N 122 CYS H2 H N N 123 CYS HA H N N 124 CYS HB2 H N N 125 CYS HB3 H N N 126 CYS HG H N N 127 CYS HXT H N N 128 GLN N N N N 129 GLN CA C N S 130 GLN C C N N 131 GLN O O N N 132 GLN CB C N N 133 GLN CG C N N 134 GLN CD C N N 135 GLN OE1 O N N 136 GLN NE2 N N N 137 GLN OXT O N N 138 GLN H H N N 139 GLN H2 H N N 140 GLN HA H N N 141 GLN HB2 H N N 142 GLN HB3 H N N 143 GLN HG2 H N N 144 GLN HG3 H N N 145 GLN HE21 H N N 146 GLN HE22 H N N 147 GLN HXT H N N 148 GLU N N N N 149 GLU CA C N S 150 GLU C C N N 151 GLU O O N N 152 GLU CB C N N 153 GLU CG C N N 154 GLU CD C N N 155 GLU OE1 O N N 156 GLU OE2 O N N 157 GLU OXT O N N 158 GLU H H N N 159 GLU H2 H N N 160 GLU HA H N N 161 GLU HB2 H N N 162 GLU HB3 H N N 163 GLU HG2 H N N 164 GLU HG3 H N N 165 GLU HE2 H N N 166 GLU HXT H N N 167 GLY N N N N 168 GLY CA C N N 169 GLY C C N N 170 GLY O O N N 171 GLY OXT O N N 172 GLY H H N N 173 GLY H2 H N N 174 GLY HA2 H N N 175 GLY HA3 H N N 176 GLY HXT H N N 177 HIS N N N N 178 HIS CA C N S 179 HIS C C N N 180 HIS O O N N 181 HIS CB C N N 182 HIS CG C Y N 183 HIS ND1 N Y N 184 HIS CD2 C Y N 185 HIS CE1 C Y N 186 HIS NE2 N Y N 187 HIS OXT O N N 188 HIS H H N N 189 HIS H2 H N N 190 HIS HA H N N 191 HIS HB2 H N N 192 HIS HB3 H N N 193 HIS HD1 H N N 194 HIS HD2 H N N 195 HIS HE1 H N N 196 HIS HE2 H N N 197 HIS HXT H N N 198 HOH O O N N 199 HOH H1 H N N 200 HOH H2 H N N 201 ILE N N N N 202 ILE CA C N S 203 ILE C C N N 204 ILE O O N N 205 ILE CB C N S 206 ILE CG1 C N N 207 ILE CG2 C N N 208 ILE CD1 C N N 209 ILE OXT O N N 210 ILE H H N N 211 ILE H2 H N N 212 ILE HA H N N 213 ILE HB H N N 214 ILE HG12 H N N 215 ILE HG13 H N N 216 ILE HG21 H N N 217 ILE HG22 H N N 218 ILE HG23 H N N 219 ILE HD11 H N N 220 ILE HD12 H N N 221 ILE HD13 H N N 222 ILE HXT H N N 223 LEU N N N N 224 LEU CA C N S 225 LEU C C N N 226 LEU O O N N 227 LEU CB C N N 228 LEU CG C N N 229 LEU CD1 C N N 230 LEU CD2 C N N 231 LEU OXT O N N 232 LEU H H N N 233 LEU H2 H N N 234 LEU HA H N N 235 LEU HB2 H N N 236 LEU HB3 H N N 237 LEU HG H N N 238 LEU HD11 H N N 239 LEU HD12 H N N 240 LEU HD13 H N N 241 LEU HD21 H N N 242 LEU HD22 H N N 243 LEU HD23 H N N 244 LEU HXT H N N 245 LYS N N N N 246 LYS CA C N S 247 LYS C C N N 248 LYS O O N N 249 LYS CB C N N 250 LYS CG C N N 251 LYS CD C N N 252 LYS CE C N N 253 LYS NZ N N N 254 LYS OXT O N N 255 LYS H H N N 256 LYS H2 H N N 257 LYS HA H N N 258 LYS HB2 H N N 259 LYS HB3 H N N 260 LYS HG2 H N N 261 LYS HG3 H N N 262 LYS HD2 H N N 263 LYS HD3 H N N 264 LYS HE2 H N N 265 LYS HE3 H N N 266 LYS HZ1 H N N 267 LYS HZ2 H N N 268 LYS HZ3 H N N 269 LYS HXT H N N 270 MET N N N N 271 MET CA C N S 272 MET C C N N 273 MET O O N N 274 MET CB C N N 275 MET CG C N N 276 MET SD S N N 277 MET CE C N N 278 MET OXT O N N 279 MET H H N N 280 MET H2 H N N 281 MET HA H N N 282 MET HB2 H N N 283 MET HB3 H N N 284 MET HG2 H N N 285 MET HG3 H N N 286 MET HE1 H N N 287 MET HE2 H N N 288 MET HE3 H N N 289 MET HXT H N N 290 PHE N N N N 291 PHE CA C N S 292 PHE C C N N 293 PHE O O N N 294 PHE CB C N N 295 PHE CG C Y N 296 PHE CD1 C Y N 297 PHE CD2 C Y N 298 PHE CE1 C Y N 299 PHE CE2 C Y N 300 PHE CZ C Y N 301 PHE OXT O N N 302 PHE H H N N 303 PHE H2 H N N 304 PHE HA H N N 305 PHE HB2 H N N 306 PHE HB3 H N N 307 PHE HD1 H N N 308 PHE HD2 H N N 309 PHE HE1 H N N 310 PHE HE2 H N N 311 PHE HZ H N N 312 PHE HXT H N N 313 PRO N N N N 314 PRO CA C N S 315 PRO C C N N 316 PRO O O N N 317 PRO CB C N N 318 PRO CG C N N 319 PRO CD C N N 320 PRO OXT O N N 321 PRO H H N N 322 PRO HA H N N 323 PRO HB2 H N N 324 PRO HB3 H N N 325 PRO HG2 H N N 326 PRO HG3 H N N 327 PRO HD2 H N N 328 PRO HD3 H N N 329 PRO HXT H N N 330 SER N N N N 331 SER CA C N S 332 SER C C N N 333 SER O O N N 334 SER CB C N N 335 SER OG O N N 336 SER OXT O N N 337 SER H H N N 338 SER H2 H N N 339 SER HA H N N 340 SER HB2 H N N 341 SER HB3 H N N 342 SER HG H N N 343 SER HXT H N N 344 THR N N N N 345 THR CA C N S 346 THR C C N N 347 THR O O N N 348 THR CB C N R 349 THR OG1 O N N 350 THR CG2 C N N 351 THR OXT O N N 352 THR H H N N 353 THR H2 H N N 354 THR HA H N N 355 THR HB H N N 356 THR HG1 H N N 357 THR HG21 H N N 358 THR HG22 H N N 359 THR HG23 H N N 360 THR HXT H N N 361 TRP N N N N 362 TRP CA C N S 363 TRP C C N N 364 TRP O O N N 365 TRP CB C N N 366 TRP CG C Y N 367 TRP CD1 C Y N 368 TRP CD2 C Y N 369 TRP NE1 N Y N 370 TRP CE2 C Y N 371 TRP CE3 C Y N 372 TRP CZ2 C Y N 373 TRP CZ3 C Y N 374 TRP CH2 C Y N 375 TRP OXT O N N 376 TRP H H N N 377 TRP H2 H N N 378 TRP HA H N N 379 TRP HB2 H N N 380 TRP HB3 H N N 381 TRP HD1 H N N 382 TRP HE1 H N N 383 TRP HE3 H N N 384 TRP HZ2 H N N 385 TRP HZ3 H N N 386 TRP HH2 H N N 387 TRP HXT H N N 388 TYR N N N N 389 TYR CA C N S 390 TYR C C N N 391 TYR O O N N 392 TYR CB C N N 393 TYR CG C Y N 394 TYR CD1 C Y N 395 TYR CD2 C Y N 396 TYR CE1 C Y N 397 TYR CE2 C Y N 398 TYR CZ C Y N 399 TYR OH O N N 400 TYR OXT O N N 401 TYR H H N N 402 TYR H2 H N N 403 TYR HA H N N 404 TYR HB2 H N N 405 TYR HB3 H N N 406 TYR HD1 H N N 407 TYR HD2 H N N 408 TYR HE1 H N N 409 TYR HE2 H N N 410 TYR HH H N N 411 TYR HXT H N N 412 VAL N N N N 413 VAL CA C N S 414 VAL C C N N 415 VAL O O N N 416 VAL CB C N N 417 VAL CG1 C N N 418 VAL CG2 C N N 419 VAL OXT O N N 420 VAL H H N N 421 VAL H2 H N N 422 VAL HA H N N 423 VAL HB H N N 424 VAL HG11 H N N 425 VAL HG12 H N N 426 VAL HG13 H N N 427 VAL HG21 H N N 428 VAL HG22 H N N 429 VAL HG23 H N N 430 VAL HXT H N N 431 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1BBE N6 C6 sing N N 1 A1BBE C6 N1 doub Y N 2 A1BBE C6 C5 sing Y N 3 A1BBE N7 C5 sing Y N 4 A1BBE N7 C8 sing Y N 5 A1BBE N1 C2 sing Y N 6 A1BBE C5 C4 doub Y N 7 A1BBE C8 C9 doub Y N 8 A1BBE C2 N3 doub Y N 9 A1BBE C4 C9 sing Y N 10 A1BBE C4 N3 sing Y N 11 A1BBE C9 C05 sing N N 12 A1BBE C05 N01 sing N N 13 A1BBE C12 N01 sing N N 14 A1BBE C12 C01 sing N N 15 A1BBE N01 C04 sing N N 16 A1BBE C04 C02 sing N N 17 A1BBE C01 C02 sing N N 18 A1BBE C01 O01 sing N N 19 A1BBE O05 P01 doub N N 20 A1BBE C02 C03 sing N N 21 A1BBE C03 O02 sing N N 22 A1BBE O02 P01 sing N N 23 A1BBE P01 O03 sing N N 24 A1BBE P01 O04 sing N N 25 A1BBE C2 H1 sing N N 26 A1BBE C01 H2 sing N N 27 A1BBE C02 H3 sing N N 28 A1BBE C03 H4 sing N N 29 A1BBE C03 H5 sing N N 30 A1BBE C04 H6 sing N N 31 A1BBE C04 H7 sing N N 32 A1BBE C05 H8 sing N N 33 A1BBE C05 H9 sing N N 34 A1BBE C12 H10 sing N N 35 A1BBE C12 H11 sing N N 36 A1BBE C8 H12 sing N N 37 A1BBE N6 H14 sing N N 38 A1BBE N6 H15 sing N N 39 A1BBE N7 H16 sing N N 40 A1BBE O01 H17 sing N N 41 A1BBE O03 H18 sing N N 42 A1BBE O04 H19 sing N N 43 ALA N CA sing N N 44 ALA N H sing N N 45 ALA N H2 sing N N 46 ALA CA C sing N N 47 ALA CA CB sing N N 48 ALA CA HA sing N N 49 ALA C O doub N N 50 ALA C OXT sing N N 51 ALA CB HB1 sing N N 52 ALA CB HB2 sing N N 53 ALA CB HB3 sing N N 54 ALA OXT HXT sing N N 55 ARG N CA sing N N 56 ARG N H sing N N 57 ARG N H2 sing N N 58 ARG CA C sing N N 59 ARG CA CB sing N N 60 ARG CA HA sing N N 61 ARG C O doub N N 62 ARG C OXT sing N N 63 ARG CB CG sing N N 64 ARG CB HB2 sing N N 65 ARG CB HB3 sing N N 66 ARG CG CD sing N N 67 ARG CG HG2 sing N N 68 ARG CG HG3 sing N N 69 ARG CD NE sing N N 70 ARG CD HD2 sing N N 71 ARG CD HD3 sing N N 72 ARG NE CZ sing N N 73 ARG NE HE sing N N 74 ARG CZ NH1 sing N N 75 ARG CZ NH2 doub N N 76 ARG NH1 HH11 sing N N 77 ARG NH1 HH12 sing N N 78 ARG NH2 HH21 sing N N 79 ARG NH2 HH22 sing N N 80 ARG OXT HXT sing N N 81 ASN N CA sing N N 82 ASN N H sing N N 83 ASN N H2 sing N N 84 ASN CA C sing N N 85 ASN CA CB sing N N 86 ASN CA HA sing N N 87 ASN C O doub N N 88 ASN C OXT sing N N 89 ASN CB CG sing N N 90 ASN CB HB2 sing N N 91 ASN CB HB3 sing N N 92 ASN CG OD1 doub N N 93 ASN CG ND2 sing N N 94 ASN ND2 HD21 sing N N 95 ASN ND2 HD22 sing N N 96 ASN OXT HXT sing N N 97 ASP N CA sing N N 98 ASP N H sing N N 99 ASP N H2 sing N N 100 ASP CA C sing N N 101 ASP CA CB sing N N 102 ASP CA HA sing N N 103 ASP C O doub N N 104 ASP C OXT sing N N 105 ASP CB CG sing N N 106 ASP CB HB2 sing N N 107 ASP CB HB3 sing N N 108 ASP CG OD1 doub N N 109 ASP CG OD2 sing N N 110 ASP OD2 HD2 sing N N 111 ASP OXT HXT sing N N 112 CYS N CA sing N N 113 CYS N H sing N N 114 CYS N H2 sing N N 115 CYS CA C sing N N 116 CYS CA CB sing N N 117 CYS CA HA sing N N 118 CYS C O doub N N 119 CYS C OXT sing N N 120 CYS CB SG sing N N 121 CYS CB HB2 sing N N 122 CYS CB HB3 sing N N 123 CYS SG HG sing N N 124 CYS OXT HXT sing N N 125 GLN N CA sing N N 126 GLN N H sing N N 127 GLN N H2 sing N N 128 GLN CA C sing N N 129 GLN CA CB sing N N 130 GLN CA HA sing N N 131 GLN C O doub N N 132 GLN C OXT sing N N 133 GLN CB CG sing N N 134 GLN CB HB2 sing N N 135 GLN CB HB3 sing N N 136 GLN CG CD sing N N 137 GLN CG HG2 sing N N 138 GLN CG HG3 sing N N 139 GLN CD OE1 doub N N 140 GLN CD NE2 sing N N 141 GLN NE2 HE21 sing N N 142 GLN NE2 HE22 sing N N 143 GLN OXT HXT sing N N 144 GLU N CA sing N N 145 GLU N H sing N N 146 GLU N H2 sing N N 147 GLU CA C sing N N 148 GLU CA CB sing N N 149 GLU CA HA sing N N 150 GLU C O doub N N 151 GLU C OXT sing N N 152 GLU CB CG sing N N 153 GLU CB HB2 sing N N 154 GLU CB HB3 sing N N 155 GLU CG CD sing N N 156 GLU CG HG2 sing N N 157 GLU CG HG3 sing N N 158 GLU CD OE1 doub N N 159 GLU CD OE2 sing N N 160 GLU OE2 HE2 sing N N 161 GLU OXT HXT sing N N 162 GLY N CA sing N N 163 GLY N H sing N N 164 GLY N H2 sing N N 165 GLY CA C sing N N 166 GLY CA HA2 sing N N 167 GLY CA HA3 sing N N 168 GLY C O doub N N 169 GLY C OXT sing N N 170 GLY OXT HXT sing N N 171 HIS N CA sing N N 172 HIS N H sing N N 173 HIS N H2 sing N N 174 HIS CA C sing N N 175 HIS CA CB sing N N 176 HIS CA HA sing N N 177 HIS C O doub N N 178 HIS C OXT sing N N 179 HIS CB CG sing N N 180 HIS CB HB2 sing N N 181 HIS CB HB3 sing N N 182 HIS CG ND1 sing Y N 183 HIS CG CD2 doub Y N 184 HIS ND1 CE1 doub Y N 185 HIS ND1 HD1 sing N N 186 HIS CD2 NE2 sing Y N 187 HIS CD2 HD2 sing N N 188 HIS CE1 NE2 sing Y N 189 HIS CE1 HE1 sing N N 190 HIS NE2 HE2 sing N N 191 HIS OXT HXT sing N N 192 HOH O H1 sing N N 193 HOH O H2 sing N N 194 ILE N CA sing N N 195 ILE N H sing N N 196 ILE N H2 sing N N 197 ILE CA C sing N N 198 ILE CA CB sing N N 199 ILE CA HA sing N N 200 ILE C O doub N N 201 ILE C OXT sing N N 202 ILE CB CG1 sing N N 203 ILE CB CG2 sing N N 204 ILE CB HB sing N N 205 ILE CG1 CD1 sing N N 206 ILE CG1 HG12 sing N N 207 ILE CG1 HG13 sing N N 208 ILE CG2 HG21 sing N N 209 ILE CG2 HG22 sing N N 210 ILE CG2 HG23 sing N N 211 ILE CD1 HD11 sing N N 212 ILE CD1 HD12 sing N N 213 ILE CD1 HD13 sing N N 214 ILE OXT HXT sing N N 215 LEU N CA sing N N 216 LEU N H sing N N 217 LEU N H2 sing N N 218 LEU CA C sing N N 219 LEU CA CB sing N N 220 LEU CA HA sing N N 221 LEU C O doub N N 222 LEU C OXT sing N N 223 LEU CB CG sing N N 224 LEU CB HB2 sing N N 225 LEU CB HB3 sing N N 226 LEU CG CD1 sing N N 227 LEU CG CD2 sing N N 228 LEU CG HG sing N N 229 LEU CD1 HD11 sing N N 230 LEU CD1 HD12 sing N N 231 LEU CD1 HD13 sing N N 232 LEU CD2 HD21 sing N N 233 LEU CD2 HD22 sing N N 234 LEU CD2 HD23 sing N N 235 LEU OXT HXT sing N N 236 LYS N CA sing N N 237 LYS N H sing N N 238 LYS N H2 sing N N 239 LYS CA C sing N N 240 LYS CA CB sing N N 241 LYS CA HA sing N N 242 LYS C O doub N N 243 LYS C OXT sing N N 244 LYS CB CG sing N N 245 LYS CB HB2 sing N N 246 LYS CB HB3 sing N N 247 LYS CG CD sing N N 248 LYS CG HG2 sing N N 249 LYS CG HG3 sing N N 250 LYS CD CE sing N N 251 LYS CD HD2 sing N N 252 LYS CD HD3 sing N N 253 LYS CE NZ sing N N 254 LYS CE HE2 sing N N 255 LYS CE HE3 sing N N 256 LYS NZ HZ1 sing N N 257 LYS NZ HZ2 sing N N 258 LYS NZ HZ3 sing N N 259 LYS OXT HXT sing N N 260 MET N CA sing N N 261 MET N H sing N N 262 MET N H2 sing N N 263 MET CA C sing N N 264 MET CA CB sing N N 265 MET CA HA sing N N 266 MET C O doub N N 267 MET C OXT sing N N 268 MET CB CG sing N N 269 MET CB HB2 sing N N 270 MET CB HB3 sing N N 271 MET CG SD sing N N 272 MET CG HG2 sing N N 273 MET CG HG3 sing N N 274 MET SD CE sing N N 275 MET CE HE1 sing N N 276 MET CE HE2 sing N N 277 MET CE HE3 sing N N 278 MET OXT HXT sing N N 279 PHE N CA sing N N 280 PHE N H sing N N 281 PHE N H2 sing N N 282 PHE CA C sing N N 283 PHE CA CB sing N N 284 PHE CA HA sing N N 285 PHE C O doub N N 286 PHE C OXT sing N N 287 PHE CB CG sing N N 288 PHE CB HB2 sing N N 289 PHE CB HB3 sing N N 290 PHE CG CD1 doub Y N 291 PHE CG CD2 sing Y N 292 PHE CD1 CE1 sing Y N 293 PHE CD1 HD1 sing N N 294 PHE CD2 CE2 doub Y N 295 PHE CD2 HD2 sing N N 296 PHE CE1 CZ doub Y N 297 PHE CE1 HE1 sing N N 298 PHE CE2 CZ sing Y N 299 PHE CE2 HE2 sing N N 300 PHE CZ HZ sing N N 301 PHE OXT HXT sing N N 302 PRO N CA sing N N 303 PRO N CD sing N N 304 PRO N H sing N N 305 PRO CA C sing N N 306 PRO CA CB sing N N 307 PRO CA HA sing N N 308 PRO C O doub N N 309 PRO C OXT sing N N 310 PRO CB CG sing N N 311 PRO CB HB2 sing N N 312 PRO CB HB3 sing N N 313 PRO CG CD sing N N 314 PRO CG HG2 sing N N 315 PRO CG HG3 sing N N 316 PRO CD HD2 sing N N 317 PRO CD HD3 sing N N 318 PRO OXT HXT sing N N 319 SER N CA sing N N 320 SER N H sing N N 321 SER N H2 sing N N 322 SER CA C sing N N 323 SER CA CB sing N N 324 SER CA HA sing N N 325 SER C O doub N N 326 SER C OXT sing N N 327 SER CB OG sing N N 328 SER CB HB2 sing N N 329 SER CB HB3 sing N N 330 SER OG HG sing N N 331 SER OXT HXT sing N N 332 THR N CA sing N N 333 THR N H sing N N 334 THR N H2 sing N N 335 THR CA C sing N N 336 THR CA CB sing N N 337 THR CA HA sing N N 338 THR C O doub N N 339 THR C OXT sing N N 340 THR CB OG1 sing N N 341 THR CB CG2 sing N N 342 THR CB HB sing N N 343 THR OG1 HG1 sing N N 344 THR CG2 HG21 sing N N 345 THR CG2 HG22 sing N N 346 THR CG2 HG23 sing N N 347 THR OXT HXT sing N N 348 TRP N CA sing N N 349 TRP N H sing N N 350 TRP N H2 sing N N 351 TRP CA C sing N N 352 TRP CA CB sing N N 353 TRP CA HA sing N N 354 TRP C O doub N N 355 TRP C OXT sing N N 356 TRP CB CG sing N N 357 TRP CB HB2 sing N N 358 TRP CB HB3 sing N N 359 TRP CG CD1 doub Y N 360 TRP CG CD2 sing Y N 361 TRP CD1 NE1 sing Y N 362 TRP CD1 HD1 sing N N 363 TRP CD2 CE2 doub Y N 364 TRP CD2 CE3 sing Y N 365 TRP NE1 CE2 sing Y N 366 TRP NE1 HE1 sing N N 367 TRP CE2 CZ2 sing Y N 368 TRP CE3 CZ3 doub Y N 369 TRP CE3 HE3 sing N N 370 TRP CZ2 CH2 doub Y N 371 TRP CZ2 HZ2 sing N N 372 TRP CZ3 CH2 sing Y N 373 TRP CZ3 HZ3 sing N N 374 TRP CH2 HH2 sing N N 375 TRP OXT HXT sing N N 376 TYR N CA sing N N 377 TYR N H sing N N 378 TYR N H2 sing N N 379 TYR CA C sing N N 380 TYR CA CB sing N N 381 TYR CA HA sing N N 382 TYR C O doub N N 383 TYR C OXT sing N N 384 TYR CB CG sing N N 385 TYR CB HB2 sing N N 386 TYR CB HB3 sing N N 387 TYR CG CD1 doub Y N 388 TYR CG CD2 sing Y N 389 TYR CD1 CE1 sing Y N 390 TYR CD1 HD1 sing N N 391 TYR CD2 CE2 doub Y N 392 TYR CD2 HD2 sing N N 393 TYR CE1 CZ doub Y N 394 TYR CE1 HE1 sing N N 395 TYR CE2 CZ sing Y N 396 TYR CE2 HE2 sing N N 397 TYR CZ OH sing N N 398 TYR OH HH sing N N 399 TYR OXT HXT sing N N 400 VAL N CA sing N N 401 VAL N H sing N N 402 VAL N H2 sing N N 403 VAL CA C sing N N 404 VAL CA CB sing N N 405 VAL CA HA sing N N 406 VAL C O doub N N 407 VAL C OXT sing N N 408 VAL CB CG1 sing N N 409 VAL CB CG2 sing N N 410 VAL CB HB sing N N 411 VAL CG1 HG11 sing N N 412 VAL CG1 HG12 sing N N 413 VAL CG1 HG13 sing N N 414 VAL CG2 HG21 sing N N 415 VAL CG2 HG22 sing N N 416 VAL CG2 HG23 sing N N 417 VAL OXT HXT sing N N 418 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM041916 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 'S10 OD020068' 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4P5E _pdbx_initial_refinement_model.details 'CRYSTAL STRUCTURE OF HUMAN DNPH1 (RCL) WITH 6-NAPHTHYL-PURINE-RIBOSIDE-MONOPHOSPHATE' # _atom_sites.entry_id 9DA4 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.012004 _atom_sites.fract_transf_matrix[1][2] 0.006931 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013861 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012409 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S # loop_