data_9DD3 # _entry.id 9DD3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.407 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9DD3 pdb_00009dd3 10.2210/pdb9dd3/pdb WWPDB D_1000287669 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-08-20 ? 2 'Structure model' 1 1 2025-09-24 ? 3 'Structure model' 1 2 2025-10-08 ? 4 'Structure model' 1 3 2025-11-19 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' citation 5 4 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 3 'Structure model' '_citation.pdbx_database_id_PubMed' 10 3 'Structure model' '_citation.title' 11 4 'Structure model' '_citation.journal_volume' 12 4 'Structure model' '_citation.page_first' 13 4 'Structure model' '_citation.page_last' 14 4 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9DD3 _pdbx_database_status.recvd_initial_deposition_date 2024-08-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email dabaker@gmail.com _pdbx_contact_author.name_first David _pdbx_contact_author.name_last Baker _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7896-6217 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bera, A.K.' 1 ? 'Broerman, A.' 2 ? 'Baker, D.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nature _citation.journal_id_ASTM NATUAS _citation.journal_id_CSD 0006 _citation.journal_id_ISSN 1476-4687 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 647 _citation.language ? _citation.page_first 528 _citation.page_last 535 _citation.title 'Design of facilitated dissociation enables timing of cytokine signalling.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41586-025-09549-z _citation.pdbx_database_id_PubMed 40993395 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Broerman, A.J.' 1 0000-0002-6878-1769 primary 'Pollmann, C.' 2 ? primary 'Zhao, Y.' 3 0000-0002-6596-499X primary 'Lichtenstein, M.A.' 4 0000-0002-2124-8262 primary 'Jackson, M.D.' 5 ? primary 'Tessmer, M.H.' 6 ? primary 'Ryu, W.H.' 7 ? primary 'Ogishi, M.' 8 0000-0003-2421-7389 primary 'Abedi, M.H.' 9 ? primary 'Sahtoe, D.D.' 10 0000-0001-9095-0744 primary 'Allen, A.' 11 ? primary 'Kang, A.' 12 0000-0001-5487-0499 primary 'De La Cruz, J.' 13 ? primary 'Brackenbrough, E.' 14 ? primary 'Sankaran, B.' 15 0000-0002-3266-8131 primary 'Bera, A.K.' 16 0000-0001-9473-2912 primary 'Zuckerman, D.M.' 17 0000-0001-7662-2031 primary 'Stoll, S.' 18 0000-0003-4255-9550 primary 'Garcia, K.C.' 19 0000-0001-9273-0278 primary 'Praetorius, F.' 20 0000-0002-0806-8101 primary 'Piehler, J.' 21 0000-0002-2143-2270 primary 'Baker, D.' 22 0000-0001-7896-6217 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Designed allosteric facilitated dissociation switch AS5 H' 28478.879 1 ? ? ? ? 2 polymer man 'Designed allosteric facilitated dissociation switch AS5 E' 3091.635 1 ? ? ? ? 3 water nat water 18.015 70 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MSGSLREEIRKLAEQLSEKYKDEEIRELAREAAELAEESDDPEVLELAYEALKKGLELEDEEKVKLILLAAVLAARVARG EVPEEKLEIALKALELAEASEDERIIRGALRAALAAARTDDPLALEVVLEALERAQASEDERLIRAILAAAYAFALLAVA GASAERLKEAEAIVKELIAAAEKGASPQELVLLVIEMMVKGMGVTMETHRSGNEVKVVIKGLHESQQEVLLEAVLFAAEL MGVRVRIRFKGDTVTIVVRE ; ;MSGSLREEIRKLAEQLSEKYKDEEIRELAREAAELAEESDDPEVLELAYEALKKGLELEDEEKVKLILLAAVLAARVARG EVPEEKLEIALKALELAEASEDERIIRGALRAALAAARTDDPLALEVVLEALERAQASEDERLIRAILAAAYAFALLAVA GASAERLKEAEAIVKELIAAAEKGASPQELVLLVIEMMVKGMGVTMETHRSGNEVKVVIKGLHESQQEVLLEAVLFAAEL MGVRVRIRFKGDTVTIVVRE ; A ? 2 'polypeptide(L)' no no EERKKELAKEVIETAKKLIEKLAKEE EERKKELAKEVIETAKKLIEKLAKEE B ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLY n 1 4 SER n 1 5 LEU n 1 6 ARG n 1 7 GLU n 1 8 GLU n 1 9 ILE n 1 10 ARG n 1 11 LYS n 1 12 LEU n 1 13 ALA n 1 14 GLU n 1 15 GLN n 1 16 LEU n 1 17 SER n 1 18 GLU n 1 19 LYS n 1 20 TYR n 1 21 LYS n 1 22 ASP n 1 23 GLU n 1 24 GLU n 1 25 ILE n 1 26 ARG n 1 27 GLU n 1 28 LEU n 1 29 ALA n 1 30 ARG n 1 31 GLU n 1 32 ALA n 1 33 ALA n 1 34 GLU n 1 35 LEU n 1 36 ALA n 1 37 GLU n 1 38 GLU n 1 39 SER n 1 40 ASP n 1 41 ASP n 1 42 PRO n 1 43 GLU n 1 44 VAL n 1 45 LEU n 1 46 GLU n 1 47 LEU n 1 48 ALA n 1 49 TYR n 1 50 GLU n 1 51 ALA n 1 52 LEU n 1 53 LYS n 1 54 LYS n 1 55 GLY n 1 56 LEU n 1 57 GLU n 1 58 LEU n 1 59 GLU n 1 60 ASP n 1 61 GLU n 1 62 GLU n 1 63 LYS n 1 64 VAL n 1 65 LYS n 1 66 LEU n 1 67 ILE n 1 68 LEU n 1 69 LEU n 1 70 ALA n 1 71 ALA n 1 72 VAL n 1 73 LEU n 1 74 ALA n 1 75 ALA n 1 76 ARG n 1 77 VAL n 1 78 ALA n 1 79 ARG n 1 80 GLY n 1 81 GLU n 1 82 VAL n 1 83 PRO n 1 84 GLU n 1 85 GLU n 1 86 LYS n 1 87 LEU n 1 88 GLU n 1 89 ILE n 1 90 ALA n 1 91 LEU n 1 92 LYS n 1 93 ALA n 1 94 LEU n 1 95 GLU n 1 96 LEU n 1 97 ALA n 1 98 GLU n 1 99 ALA n 1 100 SER n 1 101 GLU n 1 102 ASP n 1 103 GLU n 1 104 ARG n 1 105 ILE n 1 106 ILE n 1 107 ARG n 1 108 GLY n 1 109 ALA n 1 110 LEU n 1 111 ARG n 1 112 ALA n 1 113 ALA n 1 114 LEU n 1 115 ALA n 1 116 ALA n 1 117 ALA n 1 118 ARG n 1 119 THR n 1 120 ASP n 1 121 ASP n 1 122 PRO n 1 123 LEU n 1 124 ALA n 1 125 LEU n 1 126 GLU n 1 127 VAL n 1 128 VAL n 1 129 LEU n 1 130 GLU n 1 131 ALA n 1 132 LEU n 1 133 GLU n 1 134 ARG n 1 135 ALA n 1 136 GLN n 1 137 ALA n 1 138 SER n 1 139 GLU n 1 140 ASP n 1 141 GLU n 1 142 ARG n 1 143 LEU n 1 144 ILE n 1 145 ARG n 1 146 ALA n 1 147 ILE n 1 148 LEU n 1 149 ALA n 1 150 ALA n 1 151 ALA n 1 152 TYR n 1 153 ALA n 1 154 PHE n 1 155 ALA n 1 156 LEU n 1 157 LEU n 1 158 ALA n 1 159 VAL n 1 160 ALA n 1 161 GLY n 1 162 ALA n 1 163 SER n 1 164 ALA n 1 165 GLU n 1 166 ARG n 1 167 LEU n 1 168 LYS n 1 169 GLU n 1 170 ALA n 1 171 GLU n 1 172 ALA n 1 173 ILE n 1 174 VAL n 1 175 LYS n 1 176 GLU n 1 177 LEU n 1 178 ILE n 1 179 ALA n 1 180 ALA n 1 181 ALA n 1 182 GLU n 1 183 LYS n 1 184 GLY n 1 185 ALA n 1 186 SER n 1 187 PRO n 1 188 GLN n 1 189 GLU n 1 190 LEU n 1 191 VAL n 1 192 LEU n 1 193 LEU n 1 194 VAL n 1 195 ILE n 1 196 GLU n 1 197 MET n 1 198 MET n 1 199 VAL n 1 200 LYS n 1 201 GLY n 1 202 MET n 1 203 GLY n 1 204 VAL n 1 205 THR n 1 206 MET n 1 207 GLU n 1 208 THR n 1 209 HIS n 1 210 ARG n 1 211 SER n 1 212 GLY n 1 213 ASN n 1 214 GLU n 1 215 VAL n 1 216 LYS n 1 217 VAL n 1 218 VAL n 1 219 ILE n 1 220 LYS n 1 221 GLY n 1 222 LEU n 1 223 HIS n 1 224 GLU n 1 225 SER n 1 226 GLN n 1 227 GLN n 1 228 GLU n 1 229 VAL n 1 230 LEU n 1 231 LEU n 1 232 GLU n 1 233 ALA n 1 234 VAL n 1 235 LEU n 1 236 PHE n 1 237 ALA n 1 238 ALA n 1 239 GLU n 1 240 LEU n 1 241 MET n 1 242 GLY n 1 243 VAL n 1 244 ARG n 1 245 VAL n 1 246 ARG n 1 247 ILE n 1 248 ARG n 1 249 PHE n 1 250 LYS n 1 251 GLY n 1 252 ASP n 1 253 THR n 1 254 VAL n 1 255 THR n 1 256 ILE n 1 257 VAL n 1 258 VAL n 1 259 ARG n 1 260 GLU n 2 1 GLU n 2 2 GLU n 2 3 ARG n 2 4 LYS n 2 5 LYS n 2 6 GLU n 2 7 LEU n 2 8 ALA n 2 9 LYS n 2 10 GLU n 2 11 VAL n 2 12 ILE n 2 13 GLU n 2 14 THR n 2 15 ALA n 2 16 LYS n 2 17 LYS n 2 18 LEU n 2 19 ILE n 2 20 GLU n 2 21 LYS n 2 22 LEU n 2 23 ALA n 2 24 LYS n 2 25 GLU n 2 26 GLU n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 260 ? ? ? ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 26 ? ? ? ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -2 ? ? ? A . n A 1 2 SER 2 -1 ? ? ? A . n A 1 3 GLY 3 0 0 GLY GLY A . n A 1 4 SER 4 1 1 SER SER A . n A 1 5 LEU 5 2 2 LEU LEU A . n A 1 6 ARG 6 3 3 ARG ARG A . n A 1 7 GLU 7 4 4 GLU GLU A . n A 1 8 GLU 8 5 5 GLU GLU A . n A 1 9 ILE 9 6 6 ILE ILE A . n A 1 10 ARG 10 7 7 ARG ARG A . n A 1 11 LYS 11 8 8 LYS LYS A . n A 1 12 LEU 12 9 9 LEU LEU A . n A 1 13 ALA 13 10 10 ALA ALA A . n A 1 14 GLU 14 11 11 GLU GLU A . n A 1 15 GLN 15 12 12 GLN GLN A . n A 1 16 LEU 16 13 13 LEU LEU A . n A 1 17 SER 17 14 14 SER SER A . n A 1 18 GLU 18 15 15 GLU GLU A . n A 1 19 LYS 19 16 16 LYS LYS A . n A 1 20 TYR 20 17 17 TYR TYR A . n A 1 21 LYS 21 18 18 LYS LYS A . n A 1 22 ASP 22 19 19 ASP ASP A . n A 1 23 GLU 23 20 20 GLU GLU A . n A 1 24 GLU 24 21 21 GLU GLU A . n A 1 25 ILE 25 22 22 ILE ILE A . n A 1 26 ARG 26 23 23 ARG ARG A . n A 1 27 GLU 27 24 24 GLU GLU A . n A 1 28 LEU 28 25 25 LEU LEU A . n A 1 29 ALA 29 26 26 ALA ALA A . n A 1 30 ARG 30 27 27 ARG ARG A . n A 1 31 GLU 31 28 28 GLU GLU A . n A 1 32 ALA 32 29 29 ALA ALA A . n A 1 33 ALA 33 30 30 ALA ALA A . n A 1 34 GLU 34 31 31 GLU GLU A . n A 1 35 LEU 35 32 32 LEU LEU A . n A 1 36 ALA 36 33 33 ALA ALA A . n A 1 37 GLU 37 34 34 GLU GLU A . n A 1 38 GLU 38 35 35 GLU GLU A . n A 1 39 SER 39 36 36 SER SER A . n A 1 40 ASP 40 37 37 ASP ASP A . n A 1 41 ASP 41 38 38 ASP ASP A . n A 1 42 PRO 42 39 39 PRO PRO A . n A 1 43 GLU 43 40 40 GLU GLU A . n A 1 44 VAL 44 41 41 VAL VAL A . n A 1 45 LEU 45 42 42 LEU LEU A . n A 1 46 GLU 46 43 43 GLU GLU A . n A 1 47 LEU 47 44 44 LEU LEU A . n A 1 48 ALA 48 45 45 ALA ALA A . n A 1 49 TYR 49 46 46 TYR TYR A . n A 1 50 GLU 50 47 47 GLU GLU A . n A 1 51 ALA 51 48 48 ALA ALA A . n A 1 52 LEU 52 49 49 LEU LEU A . n A 1 53 LYS 53 50 50 LYS LYS A . n A 1 54 LYS 54 51 51 LYS LYS A . n A 1 55 GLY 55 52 52 GLY GLY A . n A 1 56 LEU 56 53 53 LEU LEU A . n A 1 57 GLU 57 54 54 GLU GLU A . n A 1 58 LEU 58 55 55 LEU LEU A . n A 1 59 GLU 59 56 56 GLU GLU A . n A 1 60 ASP 60 57 57 ASP ASP A . n A 1 61 GLU 61 58 58 GLU GLU A . n A 1 62 GLU 62 59 59 GLU GLU A . n A 1 63 LYS 63 60 60 LYS LYS A . n A 1 64 VAL 64 61 61 VAL VAL A . n A 1 65 LYS 65 62 62 LYS LYS A . n A 1 66 LEU 66 63 63 LEU LEU A . n A 1 67 ILE 67 64 64 ILE ILE A . n A 1 68 LEU 68 65 65 LEU LEU A . n A 1 69 LEU 69 66 66 LEU LEU A . n A 1 70 ALA 70 67 67 ALA ALA A . n A 1 71 ALA 71 68 68 ALA ALA A . n A 1 72 VAL 72 69 69 VAL VAL A . n A 1 73 LEU 73 70 70 LEU LEU A . n A 1 74 ALA 74 71 71 ALA ALA A . n A 1 75 ALA 75 72 72 ALA ALA A . n A 1 76 ARG 76 73 73 ARG ARG A . n A 1 77 VAL 77 74 74 VAL VAL A . n A 1 78 ALA 78 75 75 ALA ALA A . n A 1 79 ARG 79 76 76 ARG ARG A . n A 1 80 GLY 80 77 77 GLY GLY A . n A 1 81 GLU 81 78 78 GLU GLU A . n A 1 82 VAL 82 79 79 VAL VAL A . n A 1 83 PRO 83 80 80 PRO PRO A . n A 1 84 GLU 84 81 81 GLU GLU A . n A 1 85 GLU 85 82 82 GLU GLU A . n A 1 86 LYS 86 83 83 LYS LYS A . n A 1 87 LEU 87 84 84 LEU LEU A . n A 1 88 GLU 88 85 85 GLU GLU A . n A 1 89 ILE 89 86 86 ILE ILE A . n A 1 90 ALA 90 87 87 ALA ALA A . n A 1 91 LEU 91 88 88 LEU LEU A . n A 1 92 LYS 92 89 89 LYS LYS A . n A 1 93 ALA 93 90 90 ALA ALA A . n A 1 94 LEU 94 91 91 LEU LEU A . n A 1 95 GLU 95 92 92 GLU GLU A . n A 1 96 LEU 96 93 93 LEU LEU A . n A 1 97 ALA 97 94 94 ALA ALA A . n A 1 98 GLU 98 95 95 GLU GLU A . n A 1 99 ALA 99 96 96 ALA ALA A . n A 1 100 SER 100 97 97 SER SER A . n A 1 101 GLU 101 98 98 GLU GLU A . n A 1 102 ASP 102 99 99 ASP ASP A . n A 1 103 GLU 103 100 100 GLU GLU A . n A 1 104 ARG 104 101 101 ARG ARG A . n A 1 105 ILE 105 102 102 ILE ILE A . n A 1 106 ILE 106 103 103 ILE ILE A . n A 1 107 ARG 107 104 104 ARG ARG A . n A 1 108 GLY 108 105 105 GLY GLY A . n A 1 109 ALA 109 106 106 ALA ALA A . n A 1 110 LEU 110 107 107 LEU LEU A . n A 1 111 ARG 111 108 108 ARG ARG A . n A 1 112 ALA 112 109 109 ALA ALA A . n A 1 113 ALA 113 110 110 ALA ALA A . n A 1 114 LEU 114 111 111 LEU LEU A . n A 1 115 ALA 115 112 112 ALA ALA A . n A 1 116 ALA 116 113 113 ALA ALA A . n A 1 117 ALA 117 114 114 ALA ALA A . n A 1 118 ARG 118 115 115 ARG ARG A . n A 1 119 THR 119 116 116 THR THR A . n A 1 120 ASP 120 117 117 ASP ASP A . n A 1 121 ASP 121 118 118 ASP ASP A . n A 1 122 PRO 122 119 119 PRO PRO A . n A 1 123 LEU 123 120 120 LEU LEU A . n A 1 124 ALA 124 121 121 ALA ALA A . n A 1 125 LEU 125 122 122 LEU LEU A . n A 1 126 GLU 126 123 123 GLU GLU A . n A 1 127 VAL 127 124 124 VAL VAL A . n A 1 128 VAL 128 125 125 VAL VAL A . n A 1 129 LEU 129 126 126 LEU LEU A . n A 1 130 GLU 130 127 127 GLU GLU A . n A 1 131 ALA 131 128 128 ALA ALA A . n A 1 132 LEU 132 129 129 LEU LEU A . n A 1 133 GLU 133 130 130 GLU GLU A . n A 1 134 ARG 134 131 131 ARG ARG A . n A 1 135 ALA 135 132 132 ALA ALA A . n A 1 136 GLN 136 133 133 GLN GLN A . n A 1 137 ALA 137 134 134 ALA ALA A . n A 1 138 SER 138 135 135 SER SER A . n A 1 139 GLU 139 136 136 GLU GLU A . n A 1 140 ASP 140 137 137 ASP ASP A . n A 1 141 GLU 141 138 138 GLU GLU A . n A 1 142 ARG 142 139 139 ARG ARG A . n A 1 143 LEU 143 140 140 LEU LEU A . n A 1 144 ILE 144 141 141 ILE ILE A . n A 1 145 ARG 145 142 142 ARG ARG A . n A 1 146 ALA 146 143 143 ALA ALA A . n A 1 147 ILE 147 144 144 ILE ILE A . n A 1 148 LEU 148 145 145 LEU LEU A . n A 1 149 ALA 149 146 146 ALA ALA A . n A 1 150 ALA 150 147 147 ALA ALA A . n A 1 151 ALA 151 148 148 ALA ALA A . n A 1 152 TYR 152 149 149 TYR TYR A . n A 1 153 ALA 153 150 150 ALA ALA A . n A 1 154 PHE 154 151 151 PHE PHE A . n A 1 155 ALA 155 152 152 ALA ALA A . n A 1 156 LEU 156 153 153 LEU LEU A . n A 1 157 LEU 157 154 154 LEU LEU A . n A 1 158 ALA 158 155 155 ALA ALA A . n A 1 159 VAL 159 156 156 VAL VAL A . n A 1 160 ALA 160 157 157 ALA ALA A . n A 1 161 GLY 161 158 158 GLY GLY A . n A 1 162 ALA 162 159 159 ALA ALA A . n A 1 163 SER 163 160 160 SER SER A . n A 1 164 ALA 164 161 161 ALA ALA A . n A 1 165 GLU 165 162 162 GLU GLU A . n A 1 166 ARG 166 163 163 ARG ARG A . n A 1 167 LEU 167 164 164 LEU LEU A . n A 1 168 LYS 168 165 165 LYS LYS A . n A 1 169 GLU 169 166 166 GLU GLU A . n A 1 170 ALA 170 167 167 ALA ALA A . n A 1 171 GLU 171 168 168 GLU GLU A . n A 1 172 ALA 172 169 169 ALA ALA A . n A 1 173 ILE 173 170 170 ILE ILE A . n A 1 174 VAL 174 171 171 VAL VAL A . n A 1 175 LYS 175 172 172 LYS LYS A . n A 1 176 GLU 176 173 173 GLU GLU A . n A 1 177 LEU 177 174 174 LEU LEU A . n A 1 178 ILE 178 175 175 ILE ILE A . n A 1 179 ALA 179 176 176 ALA ALA A . n A 1 180 ALA 180 177 177 ALA ALA A . n A 1 181 ALA 181 178 178 ALA ALA A . n A 1 182 GLU 182 179 179 GLU GLU A . n A 1 183 LYS 183 180 180 LYS LYS A . n A 1 184 GLY 184 181 181 GLY GLY A . n A 1 185 ALA 185 182 182 ALA ALA A . n A 1 186 SER 186 183 183 SER SER A . n A 1 187 PRO 187 184 184 PRO PRO A . n A 1 188 GLN 188 185 185 GLN GLN A . n A 1 189 GLU 189 186 186 GLU GLU A . n A 1 190 LEU 190 187 187 LEU LEU A . n A 1 191 VAL 191 188 188 VAL VAL A . n A 1 192 LEU 192 189 189 LEU LEU A . n A 1 193 LEU 193 190 190 LEU LEU A . n A 1 194 VAL 194 191 191 VAL VAL A . n A 1 195 ILE 195 192 192 ILE ILE A . n A 1 196 GLU 196 193 193 GLU GLU A . n A 1 197 MET 197 194 194 MET MET A . n A 1 198 MET 198 195 195 MET MET A . n A 1 199 VAL 199 196 196 VAL VAL A . n A 1 200 LYS 200 197 197 LYS LYS A . n A 1 201 GLY 201 198 198 GLY GLY A . n A 1 202 MET 202 199 199 MET MET A . n A 1 203 GLY 203 200 200 GLY GLY A . n A 1 204 VAL 204 201 201 VAL VAL A . n A 1 205 THR 205 202 202 THR THR A . n A 1 206 MET 206 203 203 MET MET A . n A 1 207 GLU 207 204 204 GLU GLU A . n A 1 208 THR 208 205 205 THR THR A . n A 1 209 HIS 209 206 206 HIS HIS A . n A 1 210 ARG 210 207 207 ARG ARG A . n A 1 211 SER 211 208 208 SER SER A . n A 1 212 GLY 212 209 209 GLY GLY A . n A 1 213 ASN 213 210 210 ASN ASN A . n A 1 214 GLU 214 211 211 GLU GLU A . n A 1 215 VAL 215 212 212 VAL VAL A . n A 1 216 LYS 216 213 213 LYS LYS A . n A 1 217 VAL 217 214 214 VAL VAL A . n A 1 218 VAL 218 215 215 VAL VAL A . n A 1 219 ILE 219 216 216 ILE ILE A . n A 1 220 LYS 220 217 217 LYS LYS A . n A 1 221 GLY 221 218 218 GLY GLY A . n A 1 222 LEU 222 219 219 LEU LEU A . n A 1 223 HIS 223 220 220 HIS HIS A . n A 1 224 GLU 224 221 221 GLU GLU A . n A 1 225 SER 225 222 222 SER SER A . n A 1 226 GLN 226 223 223 GLN GLN A . n A 1 227 GLN 227 224 224 GLN GLN A . n A 1 228 GLU 228 225 225 GLU GLU A . n A 1 229 VAL 229 226 226 VAL VAL A . n A 1 230 LEU 230 227 227 LEU LEU A . n A 1 231 LEU 231 228 228 LEU LEU A . n A 1 232 GLU 232 229 229 GLU GLU A . n A 1 233 ALA 233 230 230 ALA ALA A . n A 1 234 VAL 234 231 231 VAL VAL A . n A 1 235 LEU 235 232 232 LEU LEU A . n A 1 236 PHE 236 233 233 PHE PHE A . n A 1 237 ALA 237 234 234 ALA ALA A . n A 1 238 ALA 238 235 235 ALA ALA A . n A 1 239 GLU 239 236 236 GLU GLU A . n A 1 240 LEU 240 237 237 LEU LEU A . n A 1 241 MET 241 238 238 MET MET A . n A 1 242 GLY 242 239 239 GLY GLY A . n A 1 243 VAL 243 240 240 VAL VAL A . n A 1 244 ARG 244 241 241 ARG ARG A . n A 1 245 VAL 245 242 242 VAL VAL A . n A 1 246 ARG 246 243 243 ARG ARG A . n A 1 247 ILE 247 244 244 ILE ILE A . n A 1 248 ARG 248 245 245 ARG ARG A . n A 1 249 PHE 249 246 246 PHE PHE A . n A 1 250 LYS 250 247 247 LYS LYS A . n A 1 251 GLY 251 248 248 GLY GLY A . n A 1 252 ASP 252 249 249 ASP ASP A . n A 1 253 THR 253 250 250 THR THR A . n A 1 254 VAL 254 251 251 VAL VAL A . n A 1 255 THR 255 252 252 THR THR A . n A 1 256 ILE 256 253 253 ILE ILE A . n A 1 257 VAL 257 254 254 VAL VAL A . n A 1 258 VAL 258 255 255 VAL VAL A . n A 1 259 ARG 259 256 256 ARG ARG A . n A 1 260 GLU 260 257 257 GLU GLU A . n B 2 1 GLU 1 1 ? ? ? B . n B 2 2 GLU 2 2 ? ? ? B . n B 2 3 ARG 3 3 ? ? ? B . n B 2 4 LYS 4 4 261 LYS LYS B . n B 2 5 LYS 5 5 262 LYS LYS B . n B 2 6 GLU 6 6 263 GLU GLU B . n B 2 7 LEU 7 7 264 LEU LEU B . n B 2 8 ALA 8 8 265 ALA ALA B . n B 2 9 LYS 9 9 266 LYS LYS B . n B 2 10 GLU 10 10 267 GLU GLU B . n B 2 11 VAL 11 11 268 VAL VAL B . n B 2 12 ILE 12 12 269 ILE ILE B . n B 2 13 GLU 13 13 270 GLU GLU B . n B 2 14 THR 14 14 271 THR THR B . n B 2 15 ALA 15 15 272 ALA ALA B . n B 2 16 LYS 16 16 273 LYS LYS B . n B 2 17 LYS 17 17 274 LYS LYS B . n B 2 18 LEU 18 18 275 LEU LEU B . n B 2 19 ILE 19 19 276 ILE ILE B . n B 2 20 GLU 20 20 277 GLU GLU B . n B 2 21 LYS 21 21 278 LYS LYS B . n B 2 22 LEU 22 22 279 LEU LEU B . n B 2 23 ALA 23 23 280 ALA ALA B . n B 2 24 LYS 24 24 ? ? ? B . n B 2 25 GLU 25 25 ? ? ? B . n B 2 26 GLU 26 26 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 301 51 HOH HOH A . C 3 HOH 2 302 52 HOH HOH A . C 3 HOH 3 303 15 HOH HOH A . C 3 HOH 4 304 16 HOH HOH A . C 3 HOH 5 305 67 HOH HOH A . C 3 HOH 6 306 11 HOH HOH A . C 3 HOH 7 307 23 HOH HOH A . C 3 HOH 8 308 44 HOH HOH A . C 3 HOH 9 309 28 HOH HOH A . C 3 HOH 10 310 5 HOH HOH A . C 3 HOH 11 311 1 HOH HOH A . C 3 HOH 12 312 32 HOH HOH A . C 3 HOH 13 313 48 HOH HOH A . C 3 HOH 14 314 38 HOH HOH A . C 3 HOH 15 315 10 HOH HOH A . C 3 HOH 16 316 36 HOH HOH A . C 3 HOH 17 317 26 HOH HOH A . C 3 HOH 18 318 14 HOH HOH A . C 3 HOH 19 319 66 HOH HOH A . C 3 HOH 20 320 65 HOH HOH A . C 3 HOH 21 321 24 HOH HOH A . C 3 HOH 22 322 25 HOH HOH A . C 3 HOH 23 323 39 HOH HOH A . C 3 HOH 24 324 8 HOH HOH A . C 3 HOH 25 325 9 HOH HOH A . C 3 HOH 26 326 12 HOH HOH A . C 3 HOH 27 327 37 HOH HOH A . C 3 HOH 28 328 13 HOH HOH A . C 3 HOH 29 329 42 HOH HOH A . C 3 HOH 30 330 22 HOH HOH A . C 3 HOH 31 331 34 HOH HOH A . C 3 HOH 32 332 59 HOH HOH A . C 3 HOH 33 333 45 HOH HOH A . C 3 HOH 34 334 57 HOH HOH A . C 3 HOH 35 335 69 HOH HOH A . C 3 HOH 36 336 18 HOH HOH A . C 3 HOH 37 337 27 HOH HOH A . C 3 HOH 38 338 2 HOH HOH A . C 3 HOH 39 339 40 HOH HOH A . C 3 HOH 40 340 50 HOH HOH A . C 3 HOH 41 341 3 HOH HOH A . C 3 HOH 42 342 35 HOH HOH A . C 3 HOH 43 343 49 HOH HOH A . C 3 HOH 44 344 46 HOH HOH A . C 3 HOH 45 345 29 HOH HOH A . C 3 HOH 46 346 19 HOH HOH A . C 3 HOH 47 347 53 HOH HOH A . C 3 HOH 48 348 7 HOH HOH A . C 3 HOH 49 349 58 HOH HOH A . C 3 HOH 50 350 6 HOH HOH A . C 3 HOH 51 351 31 HOH HOH A . C 3 HOH 52 352 17 HOH HOH A . C 3 HOH 53 353 64 HOH HOH A . C 3 HOH 54 354 4 HOH HOH A . C 3 HOH 55 355 33 HOH HOH A . C 3 HOH 56 356 68 HOH HOH A . C 3 HOH 57 357 62 HOH HOH A . C 3 HOH 58 358 55 HOH HOH A . C 3 HOH 59 359 61 HOH HOH A . C 3 HOH 60 360 70 HOH HOH A . C 3 HOH 61 361 63 HOH HOH A . C 3 HOH 62 362 60 HOH HOH A . C 3 HOH 63 363 21 HOH HOH A . C 3 HOH 64 364 41 HOH HOH A . C 3 HOH 65 365 56 HOH HOH A . C 3 HOH 66 366 20 HOH HOH A . D 3 HOH 1 301 43 HOH HOH B . D 3 HOH 2 302 47 HOH HOH B . D 3 HOH 3 303 30 HOH HOH B . D 3 HOH 4 304 54 HOH HOH B . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 207 ? CG ? A ARG 210 CG 2 1 Y 1 A ARG 207 ? CD ? A ARG 210 CD 3 1 Y 1 A ARG 207 ? NE ? A ARG 210 NE 4 1 Y 1 A ARG 207 ? CZ ? A ARG 210 CZ 5 1 Y 1 A ARG 207 ? NH1 ? A ARG 210 NH1 6 1 Y 1 A ARG 207 ? NH2 ? A ARG 210 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? dev_4761 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 116.200 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9DD3 _cell.details ? _cell.formula_units_Z ? _cell.length_a 90.171 _cell.length_a_esd ? _cell.length_b 35.663 _cell.length_b_esd ? _cell.length_c 75.522 _cell.length_c_esd ? _cell.volume 217909.297 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9DD3 _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall 'C 2y' _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9DD3 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 28.72 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Magnesium chloride hexahydrate, 0.1 M Tris pH 8.5 and 25% w/v Polyethylene glycol 3,350' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details 'Horizontal pre-focus bimorph mirror & KB bimorph mirrors' _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-11-17 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111) DCM' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.92009 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS-II BEAMLINE 17-ID-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.92009 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID-2 _diffrn_source.pdbx_synchrotron_site NSLS-II # _reflns.B_iso_Wilson_estimate 28.07 _reflns.entry_id 9DD3 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.64 _reflns.d_resolution_low 31.69 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 24348 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 91.01 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 1.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.62 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.054 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.993 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.062 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.64 _reflns_shell.d_res_low 1.68 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1919 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 1.9 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.054 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.717 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 95.00 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.062 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 35.23 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9DD3 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.64 _refine.ls_d_res_low 31.69 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 24348 _refine.ls_number_reflns_R_free 1855 _refine.ls_number_reflns_R_work 22493 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 91.01 _refine.ls_percent_reflns_R_free 7.62 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2059 _refine.ls_R_factor_R_free 0.2514 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2020 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.6189 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2351 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.64 _refine_hist.d_res_low 31.69 _refine_hist.number_atoms_solvent 70 _refine_hist.number_atoms_total 2202 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2132 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0030 ? 2161 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.5247 ? 2905 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0368 ? 355 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0045 ? 374 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 3.8101 ? 302 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.64 1.68 . . 146 1773 95.00 . . . . 0.3238 . . . . . . . . . . . 0.3456 'X-RAY DIFFRACTION' 1.68 1.73 . . 148 1793 94.45 . . . . 0.3027 . . . . . . . . . . . 0.3393 'X-RAY DIFFRACTION' 1.73 1.79 . . 147 1780 94.60 . . . . 0.2731 . . . . . . . . . . . 0.2938 'X-RAY DIFFRACTION' 1.79 1.85 . . 147 1779 94.13 . . . . 0.2548 . . . . . . . . . . . 0.3405 'X-RAY DIFFRACTION' 1.85 1.93 . . 144 1749 93.71 . . . . 0.2473 . . . . . . . . . . . 0.3058 'X-RAY DIFFRACTION' 1.93 2.02 . . 145 1759 93.15 . . . . 0.2384 . . . . . . . . . . . 0.2956 'X-RAY DIFFRACTION' 2.02 2.12 . . 144 1749 91.49 . . . . 0.2059 . . . . . . . . . . . 0.2903 'X-RAY DIFFRACTION' 2.12 2.25 . . 139 1695 89.86 . . . . 0.1919 . . . . . . . . . . . 0.2723 'X-RAY DIFFRACTION' 2.26 2.43 . . 140 1692 89.06 . . . . 0.1951 . . . . . . . . . . . 0.2325 'X-RAY DIFFRACTION' 2.43 2.67 . . 142 1720 90.39 . . . . 0.1992 . . . . . . . . . . . 0.2880 'X-RAY DIFFRACTION' 2.67 3.06 . . 140 1696 88.91 . . . . 0.2001 . . . . . . . . . . . 0.2545 'X-RAY DIFFRACTION' 3.06 3.85 . . 137 1663 86.33 . . . . 0.1908 . . . . . . . . . . . 0.2109 'X-RAY DIFFRACTION' 3.85 31.69 . . 136 1645 82.72 . . . . 0.1801 . . . . . . . . . . . 0.2274 # _struct.entry_id 9DD3 _struct.title 'Crystal Structure of Designed allosteric facilitated dissociation switch AS5 in complex state HE' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9DD3 _struct_keywords.text 'de novo protein, design model, Effector, kinetics and dynamics, Protein-protein interactions' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 PDB 9DD3 9DD3 ? 1 ? 1 2 PDB 9DD3 9DD3 ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9DD3 A 1 ? 260 ? 9DD3 -2 ? 257 ? -2 257 2 2 9DD3 B 1 ? 26 ? 9DD3 1 ? 26 ? 1 26 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2000 ? 1 MORE -21 ? 1 'SSA (A^2)' 12670 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 3 ? TYR A 20 ? GLY A 0 TYR A 17 1 ? 18 HELX_P HELX_P2 AA2 ASP A 22 ? SER A 39 ? ASP A 19 SER A 36 1 ? 18 HELX_P HELX_P3 AA3 ASP A 41 ? LEU A 58 ? ASP A 38 LEU A 55 1 ? 18 HELX_P HELX_P4 AA4 ASP A 60 ? ARG A 79 ? ASP A 57 ARG A 76 1 ? 20 HELX_P HELX_P5 AA5 PRO A 83 ? SER A 100 ? PRO A 80 SER A 97 1 ? 18 HELX_P HELX_P6 AA6 ASP A 102 ? THR A 119 ? ASP A 99 THR A 116 1 ? 18 HELX_P HELX_P7 AA7 ASP A 121 ? SER A 138 ? ASP A 118 SER A 135 1 ? 18 HELX_P HELX_P8 AA8 ASP A 140 ? ALA A 160 ? ASP A 137 ALA A 157 1 ? 21 HELX_P HELX_P9 AA9 SER A 163 ? LYS A 183 ? SER A 160 LYS A 180 1 ? 21 HELX_P HELX_P10 AB1 SER A 186 ? MET A 202 ? SER A 183 MET A 199 1 ? 17 HELX_P HELX_P11 AB2 HIS A 223 ? GLY A 242 ? HIS A 220 GLY A 239 1 ? 20 HELX_P HELX_P12 AB3 LYS B 5 ? ALA B 23 ? LYS B 5 ALA B 23 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 205 ? ARG A 210 ? THR A 202 ARG A 207 AA1 2 VAL A 215 ? LYS A 220 ? VAL A 212 LYS A 217 AA1 3 THR A 253 ? VAL A 258 ? THR A 250 VAL A 255 AA1 4 VAL A 245 ? PHE A 249 ? VAL A 242 PHE A 246 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N HIS A 209 ? N HIS A 206 O LYS A 216 ? O LYS A 213 AA1 2 3 N ILE A 219 ? N ILE A 216 O VAL A 254 ? O VAL A 251 AA1 3 4 O THR A 255 ? O THR A 252 N ARG A 248 ? N ARG A 245 # _pdbx_entry_details.entry_id 9DD3 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 201 ? ? -115.73 -166.74 2 1 LYS A 247 ? ? -108.24 -146.15 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -x,y,-z 3 x+1/2,y+1/2,z 4 -x+1/2,y+1/2,-z # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -2 ? A MET 1 2 1 Y 1 A SER -1 ? A SER 2 3 1 Y 1 B GLU 1 ? B GLU 1 4 1 Y 1 B GLU 2 ? B GLU 2 5 1 Y 1 B ARG 3 ? B ARG 3 6 1 Y 1 B LYS 24 ? B LYS 24 7 1 Y 1 B GLU 25 ? B GLU 25 8 1 Y 1 B GLU 26 ? B GLU 26 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 THR N N N N 290 THR CA C N S 291 THR C C N N 292 THR O O N N 293 THR CB C N R 294 THR OG1 O N N 295 THR CG2 C N N 296 THR OXT O N N 297 THR H H N N 298 THR H2 H N N 299 THR HA H N N 300 THR HB H N N 301 THR HG1 H N N 302 THR HG21 H N N 303 THR HG22 H N N 304 THR HG23 H N N 305 THR HXT H N N 306 TYR N N N N 307 TYR CA C N S 308 TYR C C N N 309 TYR O O N N 310 TYR CB C N N 311 TYR CG C Y N 312 TYR CD1 C Y N 313 TYR CD2 C Y N 314 TYR CE1 C Y N 315 TYR CE2 C Y N 316 TYR CZ C Y N 317 TYR OH O N N 318 TYR OXT O N N 319 TYR H H N N 320 TYR H2 H N N 321 TYR HA H N N 322 TYR HB2 H N N 323 TYR HB3 H N N 324 TYR HD1 H N N 325 TYR HD2 H N N 326 TYR HE1 H N N 327 TYR HE2 H N N 328 TYR HH H N N 329 TYR HXT H N N 330 VAL N N N N 331 VAL CA C N S 332 VAL C C N N 333 VAL O O N N 334 VAL CB C N N 335 VAL CG1 C N N 336 VAL CG2 C N N 337 VAL OXT O N N 338 VAL H H N N 339 VAL H2 H N N 340 VAL HA H N N 341 VAL HB H N N 342 VAL HG11 H N N 343 VAL HG12 H N N 344 VAL HG13 H N N 345 VAL HG21 H N N 346 VAL HG22 H N N 347 VAL HG23 H N N 348 VAL HXT H N N 349 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TYR N CA sing N N 293 TYR N H sing N N 294 TYR N H2 sing N N 295 TYR CA C sing N N 296 TYR CA CB sing N N 297 TYR CA HA sing N N 298 TYR C O doub N N 299 TYR C OXT sing N N 300 TYR CB CG sing N N 301 TYR CB HB2 sing N N 302 TYR CB HB3 sing N N 303 TYR CG CD1 doub Y N 304 TYR CG CD2 sing Y N 305 TYR CD1 CE1 sing Y N 306 TYR CD1 HD1 sing N N 307 TYR CD2 CE2 doub Y N 308 TYR CD2 HD2 sing N N 309 TYR CE1 CZ doub Y N 310 TYR CE1 HE1 sing N N 311 TYR CE2 CZ sing Y N 312 TYR CE2 HE2 sing N N 313 TYR CZ OH sing N N 314 TYR OH HH sing N N 315 TYR OXT HXT sing N N 316 VAL N CA sing N N 317 VAL N H sing N N 318 VAL N H2 sing N N 319 VAL CA C sing N N 320 VAL CA CB sing N N 321 VAL CA HA sing N N 322 VAL C O doub N N 323 VAL C OXT sing N N 324 VAL CB CG1 sing N N 325 VAL CB CG2 sing N N 326 VAL CB HB sing N N 327 VAL CG1 HG11 sing N N 328 VAL CG1 HG12 sing N N 329 VAL CG1 HG13 sing N N 330 VAL CG2 HG21 sing N N 331 VAL CG2 HG22 sing N N 332 VAL CG2 HG23 sing N N 333 VAL OXT HXT sing N N 334 # _pdbx_audit_support.funding_organization 'Howard Hughes Medical Institute (HHMI)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'de novo designed model' # _space_group.name_H-M_alt 'C 1 2 1' _space_group.name_Hall 'C 2y' _space_group.IT_number 5 _space_group.crystal_system monoclinic _space_group.id 1 # _atom_sites.entry_id 9DD3 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.011090 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.005457 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.028040 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014757 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #