data_9DIN # _entry.id 9DIN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.403 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9DIN pdb_00009din 10.2210/pdb9din/pdb WWPDB D_1000288031 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-04-16 ? 2 'Structure model' 1 1 2025-05-07 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9DIN _pdbx_database_status.recvd_initial_deposition_date 2024-09-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 3 caz@uic.edu Celerino Abad-Zapatero ? 'principal investigator/group leader' 0000-0003-0741-9579 4 ninamwolf@gmail.com Nina Wolf M 'principal investigator/group leader' 0000-0002-4685-4103 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Abad-Zapatero, C.' 1 0000-0003-0741-9579 'Wolf, N.M.' 2 0000-0002-4685-4103 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_patent _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary J.Nat.Prod. ? ? 1520-6025 ? ? 88 ? 907 925 'Structure-Based Analysis of Semisynthetic Anti-TB Rufomycin Analogues.' 2025 ? 10.1021/acs.jnatprod.4c01266 40126472 ? ? ? ? ? ? ? ? ? US ? ? 1 'ACS Infect Dis' ? ? 2373-8227 ? ? 5 ? 829 840 ;High-Resolution Structure of ClpC1-Rufomycin and Ligand Binding Studies Provide a Framework to Design and Optimize Anti-Tuberculosis Leads. ; 2019 ? 10.1021/acsinfecdis.8b00276 30990022 ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhou, B.' 1 ? primary 'Shetye, G.' 2 ? primary 'Klein, L.L.' 3 ? primary 'Wolf, N.M.' 4 ? primary 'Lee, H.' 5 ? primary 'McAlpine, J.B.' 6 ? primary 'Harris, G.' 7 ? primary 'Chen, S.N.' 8 ? primary 'Suh, J.W.' 9 ? primary 'Cho, S.H.' 10 ? primary 'Franzblau, S.G.' 11 ? primary 'Abad-Zapatero, C.' 12 ? primary 'Pauli, G.F.' 13 ? 1 'Wolf, N.M.' 14 ? 1 'Lee, H.' 15 ? 1 'Choules, M.P.' 16 0000-0003-1771-3245 1 'Pauli, G.F.' 17 0000-0003-1022-4326 1 'Phansalkar, R.' 18 0000-0001-9664-1950 1 'Anderson, J.R.' 19 ? 1 'Gao, W.' 20 ? 1 'Ren, J.' 21 ? 1 'Santarsiero, B.D.' 22 ? 1 'Lee, H.' 23 ? 1 'Cheng, J.' 24 ? 1 'Jin, Y.Y.' 25 ? 1 'Ho, N.A.' 26 ? 1 'Duc, N.M.' 27 ? 1 'Suh, J.W.' 28 ? 1 'Abad-Zapatero, C.' 29 ? 1 'Cho, S.' 30 0000-0003-0926-6246 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ATP-dependent Clp protease ATP-binding subunit ClpC1' 17469.012 1 ? ? ? ? 2 polymer syn 'Rufomycin analog' 1156.841 1 ? ? ? ? 3 non-polymer syn 'ACETIC ACID' 60.052 1 ? ? ? ? 4 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 5 non-polymer nat 'CHLORIDE ION' 35.453 1 ? ? ? ? 6 water nat water 18.015 57 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;AFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLESLGISLEGVRSQVEEIIGQGQQAPSGHIPF TPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVAAQVLVKLGAELTRVRQQVIQLLSGYKLAAALEHHHHHH ; ;AFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLESLGISLEGVRSQVEEIIGQGQQAPSGHIPF TPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVAAQVLVKLGAELTRVRQQVIQLLSGYKLAAALEHHHHHH ; A ? 2 'polypeptide(L)' no yes '(A1A5S)(MLE)(NIY)A(A1A5T)L(NLE)' XLYAXLL C ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'ACETIC ACID' ACY 4 GLYCEROL GOL 5 'CHLORIDE ION' CL 6 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 PHE n 1 3 GLU n 1 4 ARG n 1 5 PHE n 1 6 THR n 1 7 ASP n 1 8 ARG n 1 9 ALA n 1 10 ARG n 1 11 ARG n 1 12 VAL n 1 13 VAL n 1 14 VAL n 1 15 LEU n 1 16 ALA n 1 17 GLN n 1 18 GLU n 1 19 GLU n 1 20 ALA n 1 21 ARG n 1 22 MET n 1 23 LEU n 1 24 ASN n 1 25 HIS n 1 26 ASN n 1 27 TYR n 1 28 ILE n 1 29 GLY n 1 30 THR n 1 31 GLU n 1 32 HIS n 1 33 ILE n 1 34 LEU n 1 35 LEU n 1 36 GLY n 1 37 LEU n 1 38 ILE n 1 39 HIS n 1 40 GLU n 1 41 GLY n 1 42 GLU n 1 43 GLY n 1 44 VAL n 1 45 ALA n 1 46 ALA n 1 47 LYS n 1 48 SER n 1 49 LEU n 1 50 GLU n 1 51 SER n 1 52 LEU n 1 53 GLY n 1 54 ILE n 1 55 SER n 1 56 LEU n 1 57 GLU n 1 58 GLY n 1 59 VAL n 1 60 ARG n 1 61 SER n 1 62 GLN n 1 63 VAL n 1 64 GLU n 1 65 GLU n 1 66 ILE n 1 67 ILE n 1 68 GLY n 1 69 GLN n 1 70 GLY n 1 71 GLN n 1 72 GLN n 1 73 ALA n 1 74 PRO n 1 75 SER n 1 76 GLY n 1 77 HIS n 1 78 ILE n 1 79 PRO n 1 80 PHE n 1 81 THR n 1 82 PRO n 1 83 ARG n 1 84 ALA n 1 85 LYS n 1 86 LYS n 1 87 VAL n 1 88 LEU n 1 89 GLU n 1 90 LEU n 1 91 SER n 1 92 LEU n 1 93 ARG n 1 94 GLU n 1 95 ALA n 1 96 LEU n 1 97 GLN n 1 98 LEU n 1 99 GLY n 1 100 HIS n 1 101 ASN n 1 102 TYR n 1 103 ILE n 1 104 GLY n 1 105 THR n 1 106 GLU n 1 107 HIS n 1 108 ILE n 1 109 LEU n 1 110 LEU n 1 111 GLY n 1 112 LEU n 1 113 ILE n 1 114 ARG n 1 115 GLU n 1 116 GLY n 1 117 GLU n 1 118 GLY n 1 119 VAL n 1 120 ALA n 1 121 ALA n 1 122 GLN n 1 123 VAL n 1 124 LEU n 1 125 VAL n 1 126 LYS n 1 127 LEU n 1 128 GLY n 1 129 ALA n 1 130 GLU n 1 131 LEU n 1 132 THR n 1 133 ARG n 1 134 VAL n 1 135 ARG n 1 136 GLN n 1 137 GLN n 1 138 VAL n 1 139 ILE n 1 140 GLN n 1 141 LEU n 1 142 LEU n 1 143 SER n 1 144 GLY n 1 145 TYR n 1 146 LYS n 1 147 LEU n 1 148 ALA n 1 149 ALA n 1 150 ALA n 1 151 LEU n 1 152 GLU n 1 153 HIS n 1 154 HIS n 1 155 HIS n 1 156 HIS n 1 157 HIS n 1 158 HIS n 2 1 A1A5S n 2 2 MLE n 2 3 NIY n 2 4 ALA n 2 5 A1A5T n 2 6 LEU n 2 7 NLE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 158 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'clpC1, Rv3596c, MTCY07H7B.26' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1773 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 7 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1A5S 'L-peptide linking' n '1-[(3S)-4-chloro-3-hydroxy-2-methylbutan-2-yl]-L-tryptophan' ? 'C16 H21 Cl N2 O3' 324.803 A1A5T 'L-peptide linking' n '(4S)-5-butoxy-N-methyl-L-leucine' ? 'C11 H23 N O3' 217.305 ACY non-polymer . 'ACETIC ACID' ? 'C2 H4 O2' 60.052 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MLE 'L-peptide linking' n N-METHYLLEUCINE ? 'C7 H15 N O2' 145.199 NIY 'L-peptide linking' n META-NITRO-TYROSINE ? 'C9 H10 N2 O5' 226.186 NLE 'L-peptide linking' n NORLEUCINE ? 'C6 H13 N O2' 131.173 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 HIS 100 100 100 HIS HIS A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 TYR 102 102 102 TYR TYR A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 HIS 107 107 107 HIS HIS A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 ARG 114 114 114 ARG ARG A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 ARG 135 135 135 ARG ARG A . n A 1 136 GLN 136 136 136 GLN GLN A . n A 1 137 GLN 137 137 137 GLN GLN A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 GLN 140 140 140 GLN GLN A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 TYR 145 145 ? ? ? A . n A 1 146 LYS 146 146 ? ? ? A . n A 1 147 LEU 147 147 ? ? ? A . n A 1 148 ALA 148 148 ? ? ? A . n A 1 149 ALA 149 149 ? ? ? A . n A 1 150 ALA 150 150 ? ? ? A . n A 1 151 LEU 151 151 ? ? ? A . n A 1 152 GLU 152 152 ? ? ? A . n A 1 153 HIS 153 153 ? ? ? A . n A 1 154 HIS 154 154 ? ? ? A . n A 1 155 HIS 155 155 ? ? ? A . n A 1 156 HIS 156 156 ? ? ? A . n A 1 157 HIS 157 157 ? ? ? A . n A 1 158 HIS 158 158 ? ? ? A . n B 2 1 A1A5S 1 1 204 A1A5S IJY C . n B 2 2 MLE 2 2 204 MLE IJY C . n B 2 3 NIY 3 3 204 NIY IJY C . n B 2 4 ALA 4 4 204 ALA IJY C . n B 2 5 A1A5T 5 5 204 A1A5T IJY C . n B 2 6 LEU 6 6 204 LEU IJY C . n B 2 7 NLE 7 7 204 NLE IJY C . n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 ACY ? ? ACY ? ? 'SUBJECT OF INVESTIGATION' ? 2 NLE ? ? NLE ? ? 'SUBJECT OF INVESTIGATION' ? 3 A1A5T ? ? A1A5T ? ? 'SUBJECT OF INVESTIGATION' ? 4 A1A5S ? ? A1A5S ? ? 'SUBJECT OF INVESTIGATION' ? 5 MLE ? ? MLE ? ? 'SUBJECT OF INVESTIGATION' ? 6 NIY ? ? NIY ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 ACY 1 201 201 ACY ACT A . D 4 GOL 1 202 203 GOL GOL A . E 5 CL 1 203 1 CL CL A . F 6 HOH 1 301 40 HOH HOH A . F 6 HOH 2 302 571 HOH HOH A . F 6 HOH 3 303 491 HOH HOH A . F 6 HOH 4 304 27 HOH HOH A . F 6 HOH 5 305 232 HOH HOH A . F 6 HOH 6 306 5 HOH HOH A . F 6 HOH 7 307 569 HOH HOH A . F 6 HOH 8 308 30 HOH HOH A . F 6 HOH 9 309 584 HOH HOH A . F 6 HOH 10 310 124 HOH HOH A . F 6 HOH 11 311 32 HOH HOH A . F 6 HOH 12 312 621 HOH HOH A . F 6 HOH 13 313 6 HOH HOH A . F 6 HOH 14 314 84 HOH HOH A . F 6 HOH 15 315 562 HOH HOH A . F 6 HOH 16 316 35 HOH HOH A . F 6 HOH 17 317 500 HOH HOH A . F 6 HOH 18 318 105 HOH HOH A . F 6 HOH 19 319 21 HOH HOH A . F 6 HOH 20 320 9 HOH HOH A . F 6 HOH 21 321 383 HOH HOH A . F 6 HOH 22 322 8 HOH HOH A . F 6 HOH 23 323 15 HOH HOH A . F 6 HOH 24 324 26 HOH HOH A . F 6 HOH 25 325 4 HOH HOH A . F 6 HOH 26 326 12 HOH HOH A . F 6 HOH 27 327 19 HOH HOH A . F 6 HOH 28 328 10 HOH HOH A . F 6 HOH 29 329 23 HOH HOH A . F 6 HOH 30 330 3 HOH HOH A . F 6 HOH 31 331 429 HOH HOH A . F 6 HOH 32 332 14 HOH HOH A . F 6 HOH 33 333 616 HOH HOH A . F 6 HOH 34 334 17 HOH HOH A . F 6 HOH 35 335 596 HOH HOH A . F 6 HOH 36 336 574 HOH HOH A . F 6 HOH 37 337 11 HOH HOH A . F 6 HOH 38 338 125 HOH HOH A . F 6 HOH 39 339 13 HOH HOH A . F 6 HOH 40 340 611 HOH HOH A . F 6 HOH 41 341 238 HOH HOH A . F 6 HOH 42 342 73 HOH HOH A . F 6 HOH 43 343 170 HOH HOH A . F 6 HOH 44 344 586 HOH HOH A . F 6 HOH 45 345 607 HOH HOH A . F 6 HOH 46 346 28 HOH HOH A . F 6 HOH 47 347 34 HOH HOH A . F 6 HOH 48 348 242 HOH HOH A . F 6 HOH 49 349 204 HOH HOH A . F 6 HOH 50 350 632 HOH HOH A . F 6 HOH 51 351 602 HOH HOH A . F 6 HOH 52 352 578 HOH HOH A . G 6 HOH 1 101 137 HOH HOH C . G 6 HOH 2 102 1 HOH HOH C . G 6 HOH 3 103 16 HOH HOH C . G 6 HOH 4 104 633 HOH HOH C . G 6 HOH 5 105 490 HOH HOH C . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21.1_5286 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? AMoRE ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9DIN _cell.details ? _cell.formula_units_Z ? _cell.length_a 33.960 _cell.length_a_esd ? _cell.length_b 58.160 _cell.length_b_esd ? _cell.length_c 60.740 _cell.length_c_esd ? _cell.volume 119968.573 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9DIN _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall 'P 2ac 2ab' _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9DIN _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.61 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 23.61 _exptl_crystal.description prismatic _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Sodium acetate, 0.1 M TRIS pH 8.5, 16% PEG 4000' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 295 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-07-22 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator diamond _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.12713 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.12713 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-D _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 21.34 _reflns.entry_id 9DIN _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.64 _reflns.d_resolution_low 42.01 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15221 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F 0.0 _reflns.observed_criterion_sigma_I 1.0 _reflns.percent_possible_obs 94.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 25.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.109 _reflns.pdbx_Rpim_I_all 0.044 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star 0.999 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.071 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.071 _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.65 _reflns_shell.d_res_low 1.68 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.2 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 514 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 5.1 _reflns_shell.pdbx_chi_squared 0.677 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.539 _reflns_shell.pdbx_Rpim_I_all 0.205 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.924 _reflns_shell.pdbx_CC_star 0.980 _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 67.8 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 29.17 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9DIN _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.64 _refine.ls_d_res_low 30.37 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15190 _refine.ls_number_reflns_R_free 1415 _refine.ls_number_reflns_R_work 26719 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.46 _refine.ls_percent_reflns_R_free 5.03 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1814 _refine.ls_R_factor_R_free 0.2109 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1800 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.05 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.7111 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2202 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.64 _refine_hist.d_res_low 30.37 _refine_hist.number_atoms_solvent 57 _refine_hist.number_atoms_total 1258 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1110 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 91 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0090 ? 1215 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.5239 ? 1642 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0840 ? 188 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0102 ? 208 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 21.0038 ? 462 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.64 1.70 . . 131 2676 99.19 . . . . 0.2996 . . . . . . . . . . . 0.3566 'X-RAY DIFFRACTION' 1.70 1.77 . . 158 2665 99.19 . . . . 0.2676 . . . . . . . . . . . 0.3200 'X-RAY DIFFRACTION' 1.77 1.85 . . 144 2659 99.57 . . . . 0.2330 . . . . . . . . . . . 0.2484 'X-RAY DIFFRACTION' 1.85 1.95 . . 175 2636 99.57 . . . . 0.2070 . . . . . . . . . . . 0.2525 'X-RAY DIFFRACTION' 1.95 2.07 . . 160 2660 99.65 . . . . 0.2055 . . . . . . . . . . . 0.2815 'X-RAY DIFFRACTION' 2.07 2.23 . . 146 2654 98.84 . . . . 0.1696 . . . . . . . . . . . 0.2352 'X-RAY DIFFRACTION' 2.23 2.46 . . 104 2728 100.00 . . . . 0.1844 . . . . . . . . . . . 0.2194 'X-RAY DIFFRACTION' 2.46 2.81 . . 121 2712 99.93 . . . . 0.1778 . . . . . . . . . . . 0.2152 'X-RAY DIFFRACTION' 2.81 3.54 . . 145 2653 99.71 . . . . 0.1684 . . . . . . . . . . . 0.2003 'X-RAY DIFFRACTION' 3.54 30.37 . . 131 2676 98.91 . . . . 0.1532 . . . . . . . . . . . 0.1538 # _struct.entry_id 9DIN _struct.title 'Structure of ClpC1 N-terminal Domain complexed with semi-synthetic Rufomycin analog' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9DIN _struct_keywords.text 'ClpC1 ATPase, Rufomycin, Antibiotic, ClpC1-NTD-complex, CHAPERONE, CHAPERONE-ANTIBIOTIC complex' _struct_keywords.pdbx_keywords CHAPERONE/ANTIBIOTIC # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? G N N 6 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP CLPC1_MYCTU P9WPC9 ? 1 ;FERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLESLGISLEGVRSQVEEIIGQGQQAPSGHIPFT PRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVAAQVLVKLGAELTRVRQQVIQLLSGY ; 2 2 PDB 9DIN 9DIN ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9DIN A 2 ? 145 ? P9WPC9 2 ? 145 ? 2 145 2 2 9DIN C 1 ? 7 ? 9DIN 1 ? 7 ? 1 7 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9DIN ALA A 1 ? UNP P9WPC9 ? ? 'expression tag' 1 1 1 9DIN LYS A 146 ? UNP P9WPC9 ? ? 'expression tag' 146 2 1 9DIN LEU A 147 ? UNP P9WPC9 ? ? 'expression tag' 147 3 1 9DIN ALA A 148 ? UNP P9WPC9 ? ? 'expression tag' 148 4 1 9DIN ALA A 149 ? UNP P9WPC9 ? ? 'expression tag' 149 5 1 9DIN ALA A 150 ? UNP P9WPC9 ? ? 'expression tag' 150 6 1 9DIN LEU A 151 ? UNP P9WPC9 ? ? 'expression tag' 151 7 1 9DIN GLU A 152 ? UNP P9WPC9 ? ? 'expression tag' 152 8 1 9DIN HIS A 153 ? UNP P9WPC9 ? ? 'expression tag' 153 9 1 9DIN HIS A 154 ? UNP P9WPC9 ? ? 'expression tag' 154 10 1 9DIN HIS A 155 ? UNP P9WPC9 ? ? 'expression tag' 155 11 1 9DIN HIS A 156 ? UNP P9WPC9 ? ? 'expression tag' 156 12 1 9DIN HIS A 157 ? UNP P9WPC9 ? ? 'expression tag' 157 13 1 9DIN HIS A 158 ? UNP P9WPC9 ? ? 'expression tag' 158 14 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1510 ? 1 MORE -20 ? 1 'SSA (A^2)' 7270 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'surface plasmon resonance' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 1 ? PHE A 5 ? ALA A 1 PHE A 5 5 ? 5 HELX_P HELX_P2 AA2 THR A 6 ? LEU A 23 ? THR A 6 LEU A 23 1 ? 18 HELX_P HELX_P3 AA3 GLY A 29 ? GLY A 41 ? GLY A 29 GLY A 41 1 ? 13 HELX_P HELX_P4 AA4 GLY A 43 ? LEU A 52 ? GLY A 43 LEU A 52 1 ? 10 HELX_P HELX_P5 AA5 SER A 55 ? ILE A 67 ? SER A 55 ILE A 67 1 ? 13 HELX_P HELX_P6 AA6 THR A 81 ? LEU A 98 ? THR A 81 LEU A 98 1 ? 18 HELX_P HELX_P7 AA7 GLY A 104 ? GLY A 116 ? GLY A 104 GLY A 116 1 ? 13 HELX_P HELX_P8 AA8 GLY A 118 ? LEU A 127 ? GLY A 118 LEU A 127 1 ? 10 HELX_P HELX_P9 AA9 GLU A 130 ? SER A 143 ? GLU A 130 SER A 143 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale one ? B A1A5S 1 C ? ? ? 1_555 B MLE 2 N ? ? C A1A5S 1 C MLE 2 1_555 ? ? ? ? ? ? ? 1.449 ? ? covale2 covale one ? B A1A5S 1 N ? ? ? 1_555 B NLE 7 C ? ? C A1A5S 1 C NLE 7 1_555 ? ? ? ? ? ? ? 1.300 ? ? covale3 covale both ? B MLE 2 C ? ? ? 1_555 B NIY 3 N ? ? C MLE 2 C NIY 3 1_555 ? ? ? ? ? ? ? 1.414 ? ? covale4 covale both ? B NIY 3 C ? ? ? 1_555 B ALA 4 N ? ? C NIY 3 C ALA 4 1_555 ? ? ? ? ? ? ? 1.412 ? ? covale5 covale one ? B ALA 4 C ? ? ? 1_555 B A1A5T 5 N ? ? C ALA 4 C A1A5T 5 1_555 ? ? ? ? ? ? ? 1.469 ? ? covale6 covale one ? B A1A5T 5 C ? ? ? 1_555 B LEU 6 N ? ? C A1A5T 5 C LEU 6 1_555 ? ? ? ? ? ? ? 1.533 ? ? covale7 covale one ? B A1A5T 5 CD2 ? ? ? 1_555 B LEU 6 N ? ? C A1A5T 5 C LEU 6 1_555 ? ? ? ? ? ? ? 1.511 ? ? covale8 covale both ? B LEU 6 C ? ? ? 1_555 B NLE 7 N ? ? C LEU 6 C NLE 7 1_555 ? ? ? ? ? ? ? 1.416 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MLE B 2 ? . . . . MLE C 2 ? 1_555 . . . . . . . LEU 1 MLE Methylation 'Named protein modification' 2 NIY B 3 ? . . . . NIY C 3 ? 1_555 . . . . . . . TYR 1 NIY Nitration 'Named protein modification' 3 NLE B 7 ? . . . . NLE C 7 ? 1_555 . . . . . . . LEU 1 NLE Norleucine 'Named protein modification' 4 A1A5S B 1 ? . . . . A1A5S C 1 ? 1_555 . . . . . . . TRP 1 A1A5S None 'Non-standard residue' 5 A1A5T B 5 ? . . . . A1A5T C 5 ? 1_555 . . . . . . . LEU 1 A1A5T None 'Non-standard residue' 6 A1A5S B 1 ? NLE B 7 ? A1A5S C 1 ? 1_555 NLE C 7 ? 1_555 N C . . . None 'Non-standard linkage' 7 A1A5T B 5 ? LEU B 6 ? A1A5T C 5 ? 1_555 LEU C 6 ? 1_555 CD2 N . . . None 'Non-standard linkage' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id A1A5S _struct_mon_prot_cis.label_seq_id 1 _struct_mon_prot_cis.label_asym_id B _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id A1A5S _struct_mon_prot_cis.auth_seq_id 1 _struct_mon_prot_cis.auth_asym_id C _struct_mon_prot_cis.pdbx_label_comp_id_2 MLE _struct_mon_prot_cis.pdbx_label_seq_id_2 2 _struct_mon_prot_cis.pdbx_label_asym_id_2 B _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 MLE _struct_mon_prot_cis.pdbx_auth_seq_id_2 2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 C _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -1.97 # _pdbx_entry_details.entry_id 9DIN _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 310 ? ? O A HOH 348 ? ? 1.94 2 1 O A HOH 312 ? ? O A HOH 350 ? ? 2.03 3 1 NH1 A ARG 93 ? ? O A HOH 301 ? ? 2.03 4 1 NH2 A ARG 11 ? ? O A HOH 302 ? ? 2.04 5 1 O A HOH 343 ? ? O A HOH 349 ? ? 2.11 6 1 NH1 A ARG 135 ? ? O A HOH 303 ? ? 2.11 7 1 O A HOH 335 ? ? O A HOH 336 ? ? 2.15 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 342 ? ? 1_555 O A HOH 349 ? ? 3_445 1.75 2 1 O A HOH 348 ? ? 1_555 O C HOH 101 ? ? 3_455 2.12 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 C _pdbx_validate_rmsd_bond.auth_asym_id_1 C _pdbx_validate_rmsd_bond.auth_comp_id_1 A1A5T _pdbx_validate_rmsd_bond.auth_seq_id_1 5 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 N _pdbx_validate_rmsd_bond.auth_asym_id_2 C _pdbx_validate_rmsd_bond.auth_comp_id_2 LEU _pdbx_validate_rmsd_bond.auth_seq_id_2 6 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.533 _pdbx_validate_rmsd_bond.bond_target_value 1.336 _pdbx_validate_rmsd_bond.bond_deviation 0.197 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.023 _pdbx_validate_rmsd_bond.linker_flag Y # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id A1A5T _pdbx_validate_torsion.auth_asym_id C _pdbx_validate_torsion.auth_seq_id 5 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 54.94 _pdbx_validate_torsion.psi -115.94 # _pdbx_molecule_features.prd_id PRD_002569 _pdbx_molecule_features.name 'Rufomycin analog' _pdbx_molecule_features.type 'Cyclic peptide' _pdbx_molecule_features.class Inhibitor _pdbx_molecule_features.details ? # _pdbx_molecule.instance_id 1 _pdbx_molecule.prd_id PRD_002569 _pdbx_molecule.asym_id B # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+1/2,-y+1/2,-z 3 -x,y+1/2,-z+1/2 4 -x+1/2,-y,z+1/2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A TYR 145 ? A TYR 145 2 1 Y 1 A LYS 146 ? A LYS 146 3 1 Y 1 A LEU 147 ? A LEU 147 4 1 Y 1 A ALA 148 ? A ALA 148 5 1 Y 1 A ALA 149 ? A ALA 149 6 1 Y 1 A ALA 150 ? A ALA 150 7 1 Y 1 A LEU 151 ? A LEU 151 8 1 Y 1 A GLU 152 ? A GLU 152 9 1 Y 1 A HIS 153 ? A HIS 153 10 1 Y 1 A HIS 154 ? A HIS 154 11 1 Y 1 A HIS 155 ? A HIS 155 12 1 Y 1 A HIS 156 ? A HIS 156 13 1 Y 1 A HIS 157 ? A HIS 157 14 1 Y 1 A HIS 158 ? A HIS 158 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1A5S C1 C N N 1 A1A5S C2 C N N 2 A1A5S C3 C N N 3 A1A5S C4 C N S 4 A1A5S C5 C N N 5 A1A5S CD1 C Y N 6 A1A5S CG C Y N 7 A1A5S O1 O N N 8 A1A5S CB C N N 9 A1A5S CA C N S 10 A1A5S O O N N 11 A1A5S C C N N 12 A1A5S CE2 C Y N 13 A1A5S CD2 C Y N 14 A1A5S CE3 C Y N 15 A1A5S CZ3 C Y N 16 A1A5S CH2 C Y N 17 A1A5S CZ2 C Y N 18 A1A5S NE1 N Y N 19 A1A5S N N N N 20 A1A5S CL1 CL N N 21 A1A5S H13 H N N 22 A1A5S H11 H N N 23 A1A5S H12 H N N 24 A1A5S H32 H N N 25 A1A5S H31 H N N 26 A1A5S H33 H N N 27 A1A5S H41 H N N 28 A1A5S H52 H N N 29 A1A5S H51 H N N 30 A1A5S HD1 H N N 31 A1A5S H14 H N N 32 A1A5S HB3 H N N 33 A1A5S HB2 H N N 34 A1A5S HA H N N 35 A1A5S HE3 H N N 36 A1A5S HZ3 H N N 37 A1A5S HH2 H N N 38 A1A5S HZ2 H N N 39 A1A5S H H N N 40 A1A5S H2 H N N 41 A1A5S OXT O N N 42 A1A5S HXT H N N 43 A1A5T O2 O N N 44 A1A5T C C N N 45 A1A5T CA C N S 46 A1A5T CD1 C N N 47 A1A5T CD2 C N N 48 A1A5T CB C N N 49 A1A5T CG C N S 50 A1A5T C28 C N N 51 A1A5T C29 C N N 52 A1A5T C30 C N N 53 A1A5T C31 C N N 54 A1A5T C40 C N N 55 A1A5T N N N N 56 A1A5T O O N N 57 A1A5T HA H N N 58 A1A5T HD11 H N N 59 A1A5T HD12 H N N 60 A1A5T HD13 H N N 61 A1A5T HD21 H N N 62 A1A5T HD22 H N N 63 A1A5T HB2 H N N 64 A1A5T HB3 H N N 65 A1A5T HG H N N 66 A1A5T H281 H N N 67 A1A5T H282 H N N 68 A1A5T H292 H N N 69 A1A5T H291 H N N 70 A1A5T H301 H N N 71 A1A5T H302 H N N 72 A1A5T H312 H N N 73 A1A5T H311 H N N 74 A1A5T H313 H N N 75 A1A5T H401 H N N 76 A1A5T H403 H N N 77 A1A5T H402 H N N 78 A1A5T H H N N 79 A1A5T OXT O N N 80 A1A5T HXT H N N 81 ACY C C N N 82 ACY O O N N 83 ACY OXT O N N 84 ACY CH3 C N N 85 ACY HXT H N N 86 ACY H1 H N N 87 ACY H2 H N N 88 ACY H3 H N N 89 ALA N N N N 90 ALA CA C N S 91 ALA C C N N 92 ALA O O N N 93 ALA CB C N N 94 ALA OXT O N N 95 ALA H H N N 96 ALA H2 H N N 97 ALA HA H N N 98 ALA HB1 H N N 99 ALA HB2 H N N 100 ALA HB3 H N N 101 ALA HXT H N N 102 ARG N N N N 103 ARG CA C N S 104 ARG C C N N 105 ARG O O N N 106 ARG CB C N N 107 ARG CG C N N 108 ARG CD C N N 109 ARG NE N N N 110 ARG CZ C N N 111 ARG NH1 N N N 112 ARG NH2 N N N 113 ARG OXT O N N 114 ARG H H N N 115 ARG H2 H N N 116 ARG HA H N N 117 ARG HB2 H N N 118 ARG HB3 H N N 119 ARG HG2 H N N 120 ARG HG3 H N N 121 ARG HD2 H N N 122 ARG HD3 H N N 123 ARG HE H N N 124 ARG HH11 H N N 125 ARG HH12 H N N 126 ARG HH21 H N N 127 ARG HH22 H N N 128 ARG HXT H N N 129 ASN N N N N 130 ASN CA C N S 131 ASN C C N N 132 ASN O O N N 133 ASN CB C N N 134 ASN CG C N N 135 ASN OD1 O N N 136 ASN ND2 N N N 137 ASN OXT O N N 138 ASN H H N N 139 ASN H2 H N N 140 ASN HA H N N 141 ASN HB2 H N N 142 ASN HB3 H N N 143 ASN HD21 H N N 144 ASN HD22 H N N 145 ASN HXT H N N 146 ASP N N N N 147 ASP CA C N S 148 ASP C C N N 149 ASP O O N N 150 ASP CB C N N 151 ASP CG C N N 152 ASP OD1 O N N 153 ASP OD2 O N N 154 ASP OXT O N N 155 ASP H H N N 156 ASP H2 H N N 157 ASP HA H N N 158 ASP HB2 H N N 159 ASP HB3 H N N 160 ASP HD2 H N N 161 ASP HXT H N N 162 CL CL CL N N 163 GLN N N N N 164 GLN CA C N S 165 GLN C C N N 166 GLN O O N N 167 GLN CB C N N 168 GLN CG C N N 169 GLN CD C N N 170 GLN OE1 O N N 171 GLN NE2 N N N 172 GLN OXT O N N 173 GLN H H N N 174 GLN H2 H N N 175 GLN HA H N N 176 GLN HB2 H N N 177 GLN HB3 H N N 178 GLN HG2 H N N 179 GLN HG3 H N N 180 GLN HE21 H N N 181 GLN HE22 H N N 182 GLN HXT H N N 183 GLU N N N N 184 GLU CA C N S 185 GLU C C N N 186 GLU O O N N 187 GLU CB C N N 188 GLU CG C N N 189 GLU CD C N N 190 GLU OE1 O N N 191 GLU OE2 O N N 192 GLU OXT O N N 193 GLU H H N N 194 GLU H2 H N N 195 GLU HA H N N 196 GLU HB2 H N N 197 GLU HB3 H N N 198 GLU HG2 H N N 199 GLU HG3 H N N 200 GLU HE2 H N N 201 GLU HXT H N N 202 GLY N N N N 203 GLY CA C N N 204 GLY C C N N 205 GLY O O N N 206 GLY OXT O N N 207 GLY H H N N 208 GLY H2 H N N 209 GLY HA2 H N N 210 GLY HA3 H N N 211 GLY HXT H N N 212 GOL C1 C N N 213 GOL O1 O N N 214 GOL C2 C N N 215 GOL O2 O N N 216 GOL C3 C N N 217 GOL O3 O N N 218 GOL H11 H N N 219 GOL H12 H N N 220 GOL HO1 H N N 221 GOL H2 H N N 222 GOL HO2 H N N 223 GOL H31 H N N 224 GOL H32 H N N 225 GOL HO3 H N N 226 HIS N N N N 227 HIS CA C N S 228 HIS C C N N 229 HIS O O N N 230 HIS CB C N N 231 HIS CG C Y N 232 HIS ND1 N Y N 233 HIS CD2 C Y N 234 HIS CE1 C Y N 235 HIS NE2 N Y N 236 HIS OXT O N N 237 HIS H H N N 238 HIS H2 H N N 239 HIS HA H N N 240 HIS HB2 H N N 241 HIS HB3 H N N 242 HIS HD1 H N N 243 HIS HD2 H N N 244 HIS HE1 H N N 245 HIS HE2 H N N 246 HIS HXT H N N 247 HOH O O N N 248 HOH H1 H N N 249 HOH H2 H N N 250 ILE N N N N 251 ILE CA C N S 252 ILE C C N N 253 ILE O O N N 254 ILE CB C N S 255 ILE CG1 C N N 256 ILE CG2 C N N 257 ILE CD1 C N N 258 ILE OXT O N N 259 ILE H H N N 260 ILE H2 H N N 261 ILE HA H N N 262 ILE HB H N N 263 ILE HG12 H N N 264 ILE HG13 H N N 265 ILE HG21 H N N 266 ILE HG22 H N N 267 ILE HG23 H N N 268 ILE HD11 H N N 269 ILE HD12 H N N 270 ILE HD13 H N N 271 ILE HXT H N N 272 LEU N N N N 273 LEU CA C N S 274 LEU C C N N 275 LEU O O N N 276 LEU CB C N N 277 LEU CG C N N 278 LEU CD1 C N N 279 LEU CD2 C N N 280 LEU OXT O N N 281 LEU H H N N 282 LEU H2 H N N 283 LEU HA H N N 284 LEU HB2 H N N 285 LEU HB3 H N N 286 LEU HG H N N 287 LEU HD11 H N N 288 LEU HD12 H N N 289 LEU HD13 H N N 290 LEU HD21 H N N 291 LEU HD22 H N N 292 LEU HD23 H N N 293 LEU HXT H N N 294 LYS N N N N 295 LYS CA C N S 296 LYS C C N N 297 LYS O O N N 298 LYS CB C N N 299 LYS CG C N N 300 LYS CD C N N 301 LYS CE C N N 302 LYS NZ N N N 303 LYS OXT O N N 304 LYS H H N N 305 LYS H2 H N N 306 LYS HA H N N 307 LYS HB2 H N N 308 LYS HB3 H N N 309 LYS HG2 H N N 310 LYS HG3 H N N 311 LYS HD2 H N N 312 LYS HD3 H N N 313 LYS HE2 H N N 314 LYS HE3 H N N 315 LYS HZ1 H N N 316 LYS HZ2 H N N 317 LYS HZ3 H N N 318 LYS HXT H N N 319 MET N N N N 320 MET CA C N S 321 MET C C N N 322 MET O O N N 323 MET CB C N N 324 MET CG C N N 325 MET SD S N N 326 MET CE C N N 327 MET OXT O N N 328 MET H H N N 329 MET H2 H N N 330 MET HA H N N 331 MET HB2 H N N 332 MET HB3 H N N 333 MET HG2 H N N 334 MET HG3 H N N 335 MET HE1 H N N 336 MET HE2 H N N 337 MET HE3 H N N 338 MET HXT H N N 339 MLE N N N N 340 MLE CN C N N 341 MLE CA C N S 342 MLE CB C N N 343 MLE CG C N N 344 MLE CD1 C N N 345 MLE CD2 C N N 346 MLE C C N N 347 MLE O O N N 348 MLE OXT O N N 349 MLE H H N N 350 MLE HN1 H N N 351 MLE HN2 H N N 352 MLE HN3 H N N 353 MLE HA H N N 354 MLE HB2 H N N 355 MLE HB3 H N N 356 MLE HG H N N 357 MLE HD11 H N N 358 MLE HD12 H N N 359 MLE HD13 H N N 360 MLE HD21 H N N 361 MLE HD22 H N N 362 MLE HD23 H N N 363 MLE HXT H N N 364 NIY N N N N 365 NIY CA C N S 366 NIY C C N N 367 NIY O O N N 368 NIY CB C N N 369 NIY CG C Y N 370 NIY CD1 C Y N 371 NIY CD2 C Y N 372 NIY CE1 C Y N 373 NIY CE2 C Y N 374 NIY CZ C Y N 375 NIY OH O N N 376 NIY NN N N N 377 NIY O1 O N N 378 NIY O2 O N N 379 NIY OXT O N N 380 NIY H H N N 381 NIY H2 H N N 382 NIY HA H N N 383 NIY HB2 H N N 384 NIY HB3 H N N 385 NIY HD1 H N N 386 NIY HD2 H N N 387 NIY HE2 H N N 388 NIY HH H N N 389 NIY HXT H N N 390 NLE N N N N 391 NLE CA C N S 392 NLE C C N N 393 NLE O O N N 394 NLE OXT O N N 395 NLE CB C N N 396 NLE CG C N N 397 NLE CD C N N 398 NLE CE C N N 399 NLE H H N N 400 NLE H2 H N N 401 NLE HA H N N 402 NLE HXT H N N 403 NLE HB2 H N N 404 NLE HB3 H N N 405 NLE HG2 H N N 406 NLE HG3 H N N 407 NLE HD2 H N N 408 NLE HD3 H N N 409 NLE HE1 H N N 410 NLE HE2 H N N 411 NLE HE3 H N N 412 PHE N N N N 413 PHE CA C N S 414 PHE C C N N 415 PHE O O N N 416 PHE CB C N N 417 PHE CG C Y N 418 PHE CD1 C Y N 419 PHE CD2 C Y N 420 PHE CE1 C Y N 421 PHE CE2 C Y N 422 PHE CZ C Y N 423 PHE OXT O N N 424 PHE H H N N 425 PHE H2 H N N 426 PHE HA H N N 427 PHE HB2 H N N 428 PHE HB3 H N N 429 PHE HD1 H N N 430 PHE HD2 H N N 431 PHE HE1 H N N 432 PHE HE2 H N N 433 PHE HZ H N N 434 PHE HXT H N N 435 PRO N N N N 436 PRO CA C N S 437 PRO C C N N 438 PRO O O N N 439 PRO CB C N N 440 PRO CG C N N 441 PRO CD C N N 442 PRO OXT O N N 443 PRO H H N N 444 PRO HA H N N 445 PRO HB2 H N N 446 PRO HB3 H N N 447 PRO HG2 H N N 448 PRO HG3 H N N 449 PRO HD2 H N N 450 PRO HD3 H N N 451 PRO HXT H N N 452 SER N N N N 453 SER CA C N S 454 SER C C N N 455 SER O O N N 456 SER CB C N N 457 SER OG O N N 458 SER OXT O N N 459 SER H H N N 460 SER H2 H N N 461 SER HA H N N 462 SER HB2 H N N 463 SER HB3 H N N 464 SER HG H N N 465 SER HXT H N N 466 THR N N N N 467 THR CA C N S 468 THR C C N N 469 THR O O N N 470 THR CB C N R 471 THR OG1 O N N 472 THR CG2 C N N 473 THR OXT O N N 474 THR H H N N 475 THR H2 H N N 476 THR HA H N N 477 THR HB H N N 478 THR HG1 H N N 479 THR HG21 H N N 480 THR HG22 H N N 481 THR HG23 H N N 482 THR HXT H N N 483 TYR N N N N 484 TYR CA C N S 485 TYR C C N N 486 TYR O O N N 487 TYR CB C N N 488 TYR CG C Y N 489 TYR CD1 C Y N 490 TYR CD2 C Y N 491 TYR CE1 C Y N 492 TYR CE2 C Y N 493 TYR CZ C Y N 494 TYR OH O N N 495 TYR OXT O N N 496 TYR H H N N 497 TYR H2 H N N 498 TYR HA H N N 499 TYR HB2 H N N 500 TYR HB3 H N N 501 TYR HD1 H N N 502 TYR HD2 H N N 503 TYR HE1 H N N 504 TYR HE2 H N N 505 TYR HH H N N 506 TYR HXT H N N 507 VAL N N N N 508 VAL CA C N S 509 VAL C C N N 510 VAL O O N N 511 VAL CB C N N 512 VAL CG1 C N N 513 VAL CG2 C N N 514 VAL OXT O N N 515 VAL H H N N 516 VAL H2 H N N 517 VAL HA H N N 518 VAL HB H N N 519 VAL HG11 H N N 520 VAL HG12 H N N 521 VAL HG13 H N N 522 VAL HG21 H N N 523 VAL HG22 H N N 524 VAL HG23 H N N 525 VAL HXT H N N 526 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1A5S N CA sing N N 1 A1A5S CB CA sing N N 2 A1A5S CB CG sing N N 3 A1A5S CA C sing N N 4 A1A5S O C doub N N 5 A1A5S CG CD1 doub Y N 6 A1A5S CG CD2 sing Y N 7 A1A5S CE3 CD2 doub Y N 8 A1A5S CE3 CZ3 sing Y N 9 A1A5S CL1 C5 sing N N 10 A1A5S CD1 NE1 sing Y N 11 A1A5S CD2 CE2 sing Y N 12 A1A5S C5 C4 sing N N 13 A1A5S CZ3 CH2 doub Y N 14 A1A5S NE1 CE2 sing Y N 15 A1A5S NE1 C2 sing N N 16 A1A5S CE2 CZ2 doub Y N 17 A1A5S C3 C2 sing N N 18 A1A5S C4 C2 sing N N 19 A1A5S C4 O1 sing N N 20 A1A5S CH2 CZ2 sing Y N 21 A1A5S C2 C1 sing N N 22 A1A5S C1 H13 sing N N 23 A1A5S C1 H11 sing N N 24 A1A5S C1 H12 sing N N 25 A1A5S C3 H32 sing N N 26 A1A5S C3 H31 sing N N 27 A1A5S C3 H33 sing N N 28 A1A5S C4 H41 sing N N 29 A1A5S C5 H52 sing N N 30 A1A5S C5 H51 sing N N 31 A1A5S CD1 HD1 sing N N 32 A1A5S O1 H14 sing N N 33 A1A5S CB HB3 sing N N 34 A1A5S CB HB2 sing N N 35 A1A5S CA HA sing N N 36 A1A5S CE3 HE3 sing N N 37 A1A5S CZ3 HZ3 sing N N 38 A1A5S CH2 HH2 sing N N 39 A1A5S CZ2 HZ2 sing N N 40 A1A5S N H sing N N 41 A1A5S N H2 sing N N 42 A1A5S C OXT sing N N 43 A1A5S OXT HXT sing N N 44 A1A5T C31 C30 sing N N 45 A1A5T C29 C30 sing N N 46 A1A5T C29 C28 sing N N 47 A1A5T C28 O2 sing N N 48 A1A5T O2 CD2 sing N N 49 A1A5T CD2 CG sing N N 50 A1A5T CD1 CG sing N N 51 A1A5T CG CB sing N N 52 A1A5T CB CA sing N N 53 A1A5T C CA sing N N 54 A1A5T C O doub N N 55 A1A5T CA N sing N N 56 A1A5T N C40 sing N N 57 A1A5T CA HA sing N N 58 A1A5T CD1 HD11 sing N N 59 A1A5T CD1 HD12 sing N N 60 A1A5T CD1 HD13 sing N N 61 A1A5T CD2 HD21 sing N N 62 A1A5T CD2 HD22 sing N N 63 A1A5T CB HB2 sing N N 64 A1A5T CB HB3 sing N N 65 A1A5T CG HG sing N N 66 A1A5T C28 H281 sing N N 67 A1A5T C28 H282 sing N N 68 A1A5T C29 H292 sing N N 69 A1A5T C29 H291 sing N N 70 A1A5T C30 H301 sing N N 71 A1A5T C30 H302 sing N N 72 A1A5T C31 H312 sing N N 73 A1A5T C31 H311 sing N N 74 A1A5T C31 H313 sing N N 75 A1A5T C40 H401 sing N N 76 A1A5T C40 H403 sing N N 77 A1A5T C40 H402 sing N N 78 A1A5T N H sing N N 79 A1A5T C OXT sing N N 80 A1A5T OXT HXT sing N N 81 ACY C O doub N N 82 ACY C OXT sing N N 83 ACY C CH3 sing N N 84 ACY OXT HXT sing N N 85 ACY CH3 H1 sing N N 86 ACY CH3 H2 sing N N 87 ACY CH3 H3 sing N N 88 ALA N CA sing N N 89 ALA N H sing N N 90 ALA N H2 sing N N 91 ALA CA C sing N N 92 ALA CA CB sing N N 93 ALA CA HA sing N N 94 ALA C O doub N N 95 ALA C OXT sing N N 96 ALA CB HB1 sing N N 97 ALA CB HB2 sing N N 98 ALA CB HB3 sing N N 99 ALA OXT HXT sing N N 100 ARG N CA sing N N 101 ARG N H sing N N 102 ARG N H2 sing N N 103 ARG CA C sing N N 104 ARG CA CB sing N N 105 ARG CA HA sing N N 106 ARG C O doub N N 107 ARG C OXT sing N N 108 ARG CB CG sing N N 109 ARG CB HB2 sing N N 110 ARG CB HB3 sing N N 111 ARG CG CD sing N N 112 ARG CG HG2 sing N N 113 ARG CG HG3 sing N N 114 ARG CD NE sing N N 115 ARG CD HD2 sing N N 116 ARG CD HD3 sing N N 117 ARG NE CZ sing N N 118 ARG NE HE sing N N 119 ARG CZ NH1 sing N N 120 ARG CZ NH2 doub N N 121 ARG NH1 HH11 sing N N 122 ARG NH1 HH12 sing N N 123 ARG NH2 HH21 sing N N 124 ARG NH2 HH22 sing N N 125 ARG OXT HXT sing N N 126 ASN N CA sing N N 127 ASN N H sing N N 128 ASN N H2 sing N N 129 ASN CA C sing N N 130 ASN CA CB sing N N 131 ASN CA HA sing N N 132 ASN C O doub N N 133 ASN C OXT sing N N 134 ASN CB CG sing N N 135 ASN CB HB2 sing N N 136 ASN CB HB3 sing N N 137 ASN CG OD1 doub N N 138 ASN CG ND2 sing N N 139 ASN ND2 HD21 sing N N 140 ASN ND2 HD22 sing N N 141 ASN OXT HXT sing N N 142 ASP N CA sing N N 143 ASP N H sing N N 144 ASP N H2 sing N N 145 ASP CA C sing N N 146 ASP CA CB sing N N 147 ASP CA HA sing N N 148 ASP C O doub N N 149 ASP C OXT sing N N 150 ASP CB CG sing N N 151 ASP CB HB2 sing N N 152 ASP CB HB3 sing N N 153 ASP CG OD1 doub N N 154 ASP CG OD2 sing N N 155 ASP OD2 HD2 sing N N 156 ASP OXT HXT sing N N 157 GLN N CA sing N N 158 GLN N H sing N N 159 GLN N H2 sing N N 160 GLN CA C sing N N 161 GLN CA CB sing N N 162 GLN CA HA sing N N 163 GLN C O doub N N 164 GLN C OXT sing N N 165 GLN CB CG sing N N 166 GLN CB HB2 sing N N 167 GLN CB HB3 sing N N 168 GLN CG CD sing N N 169 GLN CG HG2 sing N N 170 GLN CG HG3 sing N N 171 GLN CD OE1 doub N N 172 GLN CD NE2 sing N N 173 GLN NE2 HE21 sing N N 174 GLN NE2 HE22 sing N N 175 GLN OXT HXT sing N N 176 GLU N CA sing N N 177 GLU N H sing N N 178 GLU N H2 sing N N 179 GLU CA C sing N N 180 GLU CA CB sing N N 181 GLU CA HA sing N N 182 GLU C O doub N N 183 GLU C OXT sing N N 184 GLU CB CG sing N N 185 GLU CB HB2 sing N N 186 GLU CB HB3 sing N N 187 GLU CG CD sing N N 188 GLU CG HG2 sing N N 189 GLU CG HG3 sing N N 190 GLU CD OE1 doub N N 191 GLU CD OE2 sing N N 192 GLU OE2 HE2 sing N N 193 GLU OXT HXT sing N N 194 GLY N CA sing N N 195 GLY N H sing N N 196 GLY N H2 sing N N 197 GLY CA C sing N N 198 GLY CA HA2 sing N N 199 GLY CA HA3 sing N N 200 GLY C O doub N N 201 GLY C OXT sing N N 202 GLY OXT HXT sing N N 203 GOL C1 O1 sing N N 204 GOL C1 C2 sing N N 205 GOL C1 H11 sing N N 206 GOL C1 H12 sing N N 207 GOL O1 HO1 sing N N 208 GOL C2 O2 sing N N 209 GOL C2 C3 sing N N 210 GOL C2 H2 sing N N 211 GOL O2 HO2 sing N N 212 GOL C3 O3 sing N N 213 GOL C3 H31 sing N N 214 GOL C3 H32 sing N N 215 GOL O3 HO3 sing N N 216 HIS N CA sing N N 217 HIS N H sing N N 218 HIS N H2 sing N N 219 HIS CA C sing N N 220 HIS CA CB sing N N 221 HIS CA HA sing N N 222 HIS C O doub N N 223 HIS C OXT sing N N 224 HIS CB CG sing N N 225 HIS CB HB2 sing N N 226 HIS CB HB3 sing N N 227 HIS CG ND1 sing Y N 228 HIS CG CD2 doub Y N 229 HIS ND1 CE1 doub Y N 230 HIS ND1 HD1 sing N N 231 HIS CD2 NE2 sing Y N 232 HIS CD2 HD2 sing N N 233 HIS CE1 NE2 sing Y N 234 HIS CE1 HE1 sing N N 235 HIS NE2 HE2 sing N N 236 HIS OXT HXT sing N N 237 HOH O H1 sing N N 238 HOH O H2 sing N N 239 ILE N CA sing N N 240 ILE N H sing N N 241 ILE N H2 sing N N 242 ILE CA C sing N N 243 ILE CA CB sing N N 244 ILE CA HA sing N N 245 ILE C O doub N N 246 ILE C OXT sing N N 247 ILE CB CG1 sing N N 248 ILE CB CG2 sing N N 249 ILE CB HB sing N N 250 ILE CG1 CD1 sing N N 251 ILE CG1 HG12 sing N N 252 ILE CG1 HG13 sing N N 253 ILE CG2 HG21 sing N N 254 ILE CG2 HG22 sing N N 255 ILE CG2 HG23 sing N N 256 ILE CD1 HD11 sing N N 257 ILE CD1 HD12 sing N N 258 ILE CD1 HD13 sing N N 259 ILE OXT HXT sing N N 260 LEU N CA sing N N 261 LEU N H sing N N 262 LEU N H2 sing N N 263 LEU CA C sing N N 264 LEU CA CB sing N N 265 LEU CA HA sing N N 266 LEU C O doub N N 267 LEU C OXT sing N N 268 LEU CB CG sing N N 269 LEU CB HB2 sing N N 270 LEU CB HB3 sing N N 271 LEU CG CD1 sing N N 272 LEU CG CD2 sing N N 273 LEU CG HG sing N N 274 LEU CD1 HD11 sing N N 275 LEU CD1 HD12 sing N N 276 LEU CD1 HD13 sing N N 277 LEU CD2 HD21 sing N N 278 LEU CD2 HD22 sing N N 279 LEU CD2 HD23 sing N N 280 LEU OXT HXT sing N N 281 LYS N CA sing N N 282 LYS N H sing N N 283 LYS N H2 sing N N 284 LYS CA C sing N N 285 LYS CA CB sing N N 286 LYS CA HA sing N N 287 LYS C O doub N N 288 LYS C OXT sing N N 289 LYS CB CG sing N N 290 LYS CB HB2 sing N N 291 LYS CB HB3 sing N N 292 LYS CG CD sing N N 293 LYS CG HG2 sing N N 294 LYS CG HG3 sing N N 295 LYS CD CE sing N N 296 LYS CD HD2 sing N N 297 LYS CD HD3 sing N N 298 LYS CE NZ sing N N 299 LYS CE HE2 sing N N 300 LYS CE HE3 sing N N 301 LYS NZ HZ1 sing N N 302 LYS NZ HZ2 sing N N 303 LYS NZ HZ3 sing N N 304 LYS OXT HXT sing N N 305 MET N CA sing N N 306 MET N H sing N N 307 MET N H2 sing N N 308 MET CA C sing N N 309 MET CA CB sing N N 310 MET CA HA sing N N 311 MET C O doub N N 312 MET C OXT sing N N 313 MET CB CG sing N N 314 MET CB HB2 sing N N 315 MET CB HB3 sing N N 316 MET CG SD sing N N 317 MET CG HG2 sing N N 318 MET CG HG3 sing N N 319 MET SD CE sing N N 320 MET CE HE1 sing N N 321 MET CE HE2 sing N N 322 MET CE HE3 sing N N 323 MET OXT HXT sing N N 324 MLE N CN sing N N 325 MLE N CA sing N N 326 MLE N H sing N N 327 MLE CN HN1 sing N N 328 MLE CN HN2 sing N N 329 MLE CN HN3 sing N N 330 MLE CA CB sing N N 331 MLE CA C sing N N 332 MLE CA HA sing N N 333 MLE CB CG sing N N 334 MLE CB HB2 sing N N 335 MLE CB HB3 sing N N 336 MLE CG CD1 sing N N 337 MLE CG CD2 sing N N 338 MLE CG HG sing N N 339 MLE CD1 HD11 sing N N 340 MLE CD1 HD12 sing N N 341 MLE CD1 HD13 sing N N 342 MLE CD2 HD21 sing N N 343 MLE CD2 HD22 sing N N 344 MLE CD2 HD23 sing N N 345 MLE C O doub N N 346 MLE C OXT sing N N 347 MLE OXT HXT sing N N 348 NIY N CA sing N N 349 NIY N H sing N N 350 NIY N H2 sing N N 351 NIY CA C sing N N 352 NIY CA CB sing N N 353 NIY CA HA sing N N 354 NIY C O doub N N 355 NIY C OXT sing N N 356 NIY CB CG sing N N 357 NIY CB HB2 sing N N 358 NIY CB HB3 sing N N 359 NIY CG CD1 doub Y N 360 NIY CG CD2 sing Y N 361 NIY CD1 CE1 sing Y N 362 NIY CD1 HD1 sing N N 363 NIY CD2 CE2 doub Y N 364 NIY CD2 HD2 sing N N 365 NIY CE1 CZ doub Y N 366 NIY CE1 NN sing N N 367 NIY CE2 CZ sing Y N 368 NIY CE2 HE2 sing N N 369 NIY CZ OH sing N N 370 NIY OH HH sing N N 371 NIY NN O1 sing N N 372 NIY NN O2 doub N N 373 NIY OXT HXT sing N N 374 NLE N CA sing N N 375 NLE N H sing N N 376 NLE N H2 sing N N 377 NLE CA C sing N N 378 NLE CA CB sing N N 379 NLE CA HA sing N N 380 NLE C O doub N N 381 NLE C OXT sing N N 382 NLE OXT HXT sing N N 383 NLE CB CG sing N N 384 NLE CB HB2 sing N N 385 NLE CB HB3 sing N N 386 NLE CG CD sing N N 387 NLE CG HG2 sing N N 388 NLE CG HG3 sing N N 389 NLE CD CE sing N N 390 NLE CD HD2 sing N N 391 NLE CD HD3 sing N N 392 NLE CE HE1 sing N N 393 NLE CE HE2 sing N N 394 NLE CE HE3 sing N N 395 PHE N CA sing N N 396 PHE N H sing N N 397 PHE N H2 sing N N 398 PHE CA C sing N N 399 PHE CA CB sing N N 400 PHE CA HA sing N N 401 PHE C O doub N N 402 PHE C OXT sing N N 403 PHE CB CG sing N N 404 PHE CB HB2 sing N N 405 PHE CB HB3 sing N N 406 PHE CG CD1 doub Y N 407 PHE CG CD2 sing Y N 408 PHE CD1 CE1 sing Y N 409 PHE CD1 HD1 sing N N 410 PHE CD2 CE2 doub Y N 411 PHE CD2 HD2 sing N N 412 PHE CE1 CZ doub Y N 413 PHE CE1 HE1 sing N N 414 PHE CE2 CZ sing Y N 415 PHE CE2 HE2 sing N N 416 PHE CZ HZ sing N N 417 PHE OXT HXT sing N N 418 PRO N CA sing N N 419 PRO N CD sing N N 420 PRO N H sing N N 421 PRO CA C sing N N 422 PRO CA CB sing N N 423 PRO CA HA sing N N 424 PRO C O doub N N 425 PRO C OXT sing N N 426 PRO CB CG sing N N 427 PRO CB HB2 sing N N 428 PRO CB HB3 sing N N 429 PRO CG CD sing N N 430 PRO CG HG2 sing N N 431 PRO CG HG3 sing N N 432 PRO CD HD2 sing N N 433 PRO CD HD3 sing N N 434 PRO OXT HXT sing N N 435 SER N CA sing N N 436 SER N H sing N N 437 SER N H2 sing N N 438 SER CA C sing N N 439 SER CA CB sing N N 440 SER CA HA sing N N 441 SER C O doub N N 442 SER C OXT sing N N 443 SER CB OG sing N N 444 SER CB HB2 sing N N 445 SER CB HB3 sing N N 446 SER OG HG sing N N 447 SER OXT HXT sing N N 448 THR N CA sing N N 449 THR N H sing N N 450 THR N H2 sing N N 451 THR CA C sing N N 452 THR CA CB sing N N 453 THR CA HA sing N N 454 THR C O doub N N 455 THR C OXT sing N N 456 THR CB OG1 sing N N 457 THR CB CG2 sing N N 458 THR CB HB sing N N 459 THR OG1 HG1 sing N N 460 THR CG2 HG21 sing N N 461 THR CG2 HG22 sing N N 462 THR CG2 HG23 sing N N 463 THR OXT HXT sing N N 464 TYR N CA sing N N 465 TYR N H sing N N 466 TYR N H2 sing N N 467 TYR CA C sing N N 468 TYR CA CB sing N N 469 TYR CA HA sing N N 470 TYR C O doub N N 471 TYR C OXT sing N N 472 TYR CB CG sing N N 473 TYR CB HB2 sing N N 474 TYR CB HB3 sing N N 475 TYR CG CD1 doub Y N 476 TYR CG CD2 sing Y N 477 TYR CD1 CE1 sing Y N 478 TYR CD1 HD1 sing N N 479 TYR CD2 CE2 doub Y N 480 TYR CD2 HD2 sing N N 481 TYR CE1 CZ doub Y N 482 TYR CE1 HE1 sing N N 483 TYR CE2 CZ sing Y N 484 TYR CE2 HE2 sing N N 485 TYR CZ OH sing N N 486 TYR OH HH sing N N 487 TYR OXT HXT sing N N 488 VAL N CA sing N N 489 VAL N H sing N N 490 VAL N H2 sing N N 491 VAL CA C sing N N 492 VAL CA CB sing N N 493 VAL CA HA sing N N 494 VAL C O doub N N 495 VAL C OXT sing N N 496 VAL CB CG1 sing N N 497 VAL CB CG2 sing N N 498 VAL CB HB sing N N 499 VAL CG1 HG11 sing N N 500 VAL CG1 HG12 sing N N 501 VAL CG1 HG13 sing N N 502 VAL CG2 HG21 sing N N 503 VAL CG2 HG22 sing N N 504 VAL CG2 HG23 sing N N 505 VAL OXT HXT sing N N 506 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number U19AI142735 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6cn8 _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 21 21 21' _space_group.name_Hall 'P 2ac 2ab' _space_group.IT_number 19 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 9DIN _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.029446 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017194 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016464 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? 9.50761 7.44341 ? ? 1.04373 23.83732 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #