data_9DY4 # _entry.id 9DY4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.406 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9DY4 pdb_00009dy4 10.2210/pdb9dy4/pdb WWPDB D_1000289068 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-09-24 ? 2 'Structure model' 1 1 2025-10-29 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9DY4 _pdbx_database_status.recvd_initial_deposition_date 2024-10-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 2 _pdbx_contact_author.email aimin.liu@utsa.edu _pdbx_contact_author.name_first Aimin _pdbx_contact_author.name_last Liu _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-4182-8176 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Liu, A.' 1 0000-0002-4182-8176 'Li, J.' 2 0000-0003-0341-2038 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Adv' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2375-2548 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 11 _citation.language ? _citation.page_first eadx7687 _citation.page_last eadx7687 _citation.title 'Hydralazine inhibits cysteamine dioxygenase to treat preeclampsia and senesce glioblastoma.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/sciadv.adx7687 _citation.pdbx_database_id_PubMed 41091880 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Shishikura, K.' 1 0000-0001-8192-2485 primary 'Li, J.' 2 0000-0003-0341-2038 primary 'Chen, Y.' 3 0000-0002-1311-7166 primary 'McKnight, N.R.' 4 ? primary 'Keeley, T.P.' 5 0000-0002-0334-7144 primary 'Bustin, K.A.' 6 0000-0001-8933-9825 primary 'Barr, E.W.' 7 ? primary 'Chilkamari, S.R.' 8 0009-0009-5427-0683 primary 'Ayub, M.' 9 ? primary 'Kim, S.W.' 10 ? primary 'Lin, Z.' 11 0000-0002-6017-338X primary 'Hu, R.M.' 12 ? primary 'Hicks, K.' 13 0009-0003-4736-3861 primary 'Wang, X.' 14 ? primary ;O'Rourke, D.M. ; 15 0000-0002-8479-7314 primary 'Martin Bollinger Jr., J.' 16 0000-0003-0751-8585 primary 'Binder, Z.A.' 17 0000-0003-1158-231X primary 'Parsons, W.H.' 18 0000-0001-6065-2340 primary 'Martemyanov, K.A.' 19 0000-0002-9925-7599 primary 'Liu, A.' 20 0000-0002-4182-8176 primary 'Matthews, M.L.' 21 0000-0003-1178-4616 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '2-aminoethanethiol dioxygenase' 30108.080 1 ? ? ? ? 2 non-polymer syn 'FE (II) ION' 55.845 1 ? ? ? ? 3 non-polymer syn 1-hydrazinophthalazine 160.176 1 ? ? ? ? 4 non-polymer syn GLYCEROL 92.094 2 ? ? ? ? 5 water nat water 18.015 19 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cysteamine dioxygenase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GHMASPRDNMASLIQRIARQASLTFRGSGGGRGASDRDAASGPEAPMQPGFPENLSKLKSLLTQLRAEDLNIAPRKATLQ PLPPNLPPVTYMHIYETDGFSLGVFLLKSGTSIPLHDHPGMHGMLKVLYGTVRISCMDKLDAGGGQRPRALPPEQQFEPP LQPREREAVRPGVLRSRAEYTEASGPCILTPHRDNLHQIDAVEGPAAFLDILAPPYDPDDGRDCHYYRVLEPVRPKEASS SASDLPREVWLLETPQADDFWCEGEPYPGPKVFP ; _entity_poly.pdbx_seq_one_letter_code_can ;GHMASPRDNMASLIQRIARQASLTFRGSGGGRGASDRDAASGPEAPMQPGFPENLSKLKSLLTQLRAEDLNIAPRKATLQ PLPPNLPPVTYMHIYETDGFSLGVFLLKSGTSIPLHDHPGMHGMLKVLYGTVRISCMDKLDAGGGQRPRALPPEQQFEPP LQPREREAVRPGVLRSRAEYTEASGPCILTPHRDNLHQIDAVEGPAAFLDILAPPYDPDDGRDCHYYRVLEPVRPKEASS SASDLPREVWLLETPQADDFWCEGEPYPGPKVFP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FE (II) ION' FE2 3 1-hydrazinophthalazine HLZ 4 GLYCEROL GOL 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 ALA n 1 5 SER n 1 6 PRO n 1 7 ARG n 1 8 ASP n 1 9 ASN n 1 10 MET n 1 11 ALA n 1 12 SER n 1 13 LEU n 1 14 ILE n 1 15 GLN n 1 16 ARG n 1 17 ILE n 1 18 ALA n 1 19 ARG n 1 20 GLN n 1 21 ALA n 1 22 SER n 1 23 LEU n 1 24 THR n 1 25 PHE n 1 26 ARG n 1 27 GLY n 1 28 SER n 1 29 GLY n 1 30 GLY n 1 31 GLY n 1 32 ARG n 1 33 GLY n 1 34 ALA n 1 35 SER n 1 36 ASP n 1 37 ARG n 1 38 ASP n 1 39 ALA n 1 40 ALA n 1 41 SER n 1 42 GLY n 1 43 PRO n 1 44 GLU n 1 45 ALA n 1 46 PRO n 1 47 MET n 1 48 GLN n 1 49 PRO n 1 50 GLY n 1 51 PHE n 1 52 PRO n 1 53 GLU n 1 54 ASN n 1 55 LEU n 1 56 SER n 1 57 LYS n 1 58 LEU n 1 59 LYS n 1 60 SER n 1 61 LEU n 1 62 LEU n 1 63 THR n 1 64 GLN n 1 65 LEU n 1 66 ARG n 1 67 ALA n 1 68 GLU n 1 69 ASP n 1 70 LEU n 1 71 ASN n 1 72 ILE n 1 73 ALA n 1 74 PRO n 1 75 ARG n 1 76 LYS n 1 77 ALA n 1 78 THR n 1 79 LEU n 1 80 GLN n 1 81 PRO n 1 82 LEU n 1 83 PRO n 1 84 PRO n 1 85 ASN n 1 86 LEU n 1 87 PRO n 1 88 PRO n 1 89 VAL n 1 90 THR n 1 91 TYR n 1 92 MET n 1 93 HIS n 1 94 ILE n 1 95 TYR n 1 96 GLU n 1 97 THR n 1 98 ASP n 1 99 GLY n 1 100 PHE n 1 101 SER n 1 102 LEU n 1 103 GLY n 1 104 VAL n 1 105 PHE n 1 106 LEU n 1 107 LEU n 1 108 LYS n 1 109 SER n 1 110 GLY n 1 111 THR n 1 112 SER n 1 113 ILE n 1 114 PRO n 1 115 LEU n 1 116 HIS n 1 117 ASP n 1 118 HIS n 1 119 PRO n 1 120 GLY n 1 121 MET n 1 122 HIS n 1 123 GLY n 1 124 MET n 1 125 LEU n 1 126 LYS n 1 127 VAL n 1 128 LEU n 1 129 TYR n 1 130 GLY n 1 131 THR n 1 132 VAL n 1 133 ARG n 1 134 ILE n 1 135 SER n 1 136 CYS n 1 137 MET n 1 138 ASP n 1 139 LYS n 1 140 LEU n 1 141 ASP n 1 142 ALA n 1 143 GLY n 1 144 GLY n 1 145 GLY n 1 146 GLN n 1 147 ARG n 1 148 PRO n 1 149 ARG n 1 150 ALA n 1 151 LEU n 1 152 PRO n 1 153 PRO n 1 154 GLU n 1 155 GLN n 1 156 GLN n 1 157 PHE n 1 158 GLU n 1 159 PRO n 1 160 PRO n 1 161 LEU n 1 162 GLN n 1 163 PRO n 1 164 ARG n 1 165 GLU n 1 166 ARG n 1 167 GLU n 1 168 ALA n 1 169 VAL n 1 170 ARG n 1 171 PRO n 1 172 GLY n 1 173 VAL n 1 174 LEU n 1 175 ARG n 1 176 SER n 1 177 ARG n 1 178 ALA n 1 179 GLU n 1 180 TYR n 1 181 THR n 1 182 GLU n 1 183 ALA n 1 184 SER n 1 185 GLY n 1 186 PRO n 1 187 CYS n 1 188 ILE n 1 189 LEU n 1 190 THR n 1 191 PRO n 1 192 HIS n 1 193 ARG n 1 194 ASP n 1 195 ASN n 1 196 LEU n 1 197 HIS n 1 198 GLN n 1 199 ILE n 1 200 ASP n 1 201 ALA n 1 202 VAL n 1 203 GLU n 1 204 GLY n 1 205 PRO n 1 206 ALA n 1 207 ALA n 1 208 PHE n 1 209 LEU n 1 210 ASP n 1 211 ILE n 1 212 LEU n 1 213 ALA n 1 214 PRO n 1 215 PRO n 1 216 TYR n 1 217 ASP n 1 218 PRO n 1 219 ASP n 1 220 ASP n 1 221 GLY n 1 222 ARG n 1 223 ASP n 1 224 CYS n 1 225 HIS n 1 226 TYR n 1 227 TYR n 1 228 ARG n 1 229 VAL n 1 230 LEU n 1 231 GLU n 1 232 PRO n 1 233 VAL n 1 234 ARG n 1 235 PRO n 1 236 LYS n 1 237 GLU n 1 238 ALA n 1 239 SER n 1 240 SER n 1 241 SER n 1 242 ALA n 1 243 SER n 1 244 ASP n 1 245 LEU n 1 246 PRO n 1 247 ARG n 1 248 GLU n 1 249 VAL n 1 250 TRP n 1 251 LEU n 1 252 LEU n 1 253 GLU n 1 254 THR n 1 255 PRO n 1 256 GLN n 1 257 ALA n 1 258 ASP n 1 259 ASP n 1 260 PHE n 1 261 TRP n 1 262 CYS n 1 263 GLU n 1 264 GLY n 1 265 GLU n 1 266 PRO n 1 267 TYR n 1 268 PRO n 1 269 GLY n 1 270 PRO n 1 271 LYS n 1 272 VAL n 1 273 PHE n 1 274 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 274 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ADO _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE2 non-polymer . 'FE (II) ION' ? 'Fe 2' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HLZ non-polymer . 1-hydrazinophthalazine 'Hydralazine; phthalazin-1-ylhydrazine' 'C8 H8 N4' 160.176 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -3 ? ? ? A . n A 1 2 HIS 2 -2 ? ? ? A . n A 1 3 MET 3 -1 ? ? ? A . n A 1 4 ALA 4 0 ? ? ? A . n A 1 5 SER 5 1 ? ? ? A . n A 1 6 PRO 6 2 ? ? ? A . n A 1 7 ARG 7 3 ? ? ? A . n A 1 8 ASP 8 4 4 ASP ASP A . n A 1 9 ASN 9 5 5 ASN ASN A . n A 1 10 MET 10 6 6 MET MET A . n A 1 11 ALA 11 7 7 ALA ALA A . n A 1 12 SER 12 8 8 SER SER A . n A 1 13 LEU 13 9 9 LEU LEU A . n A 1 14 ILE 14 10 10 ILE ILE A . n A 1 15 GLN 15 11 11 GLN GLN A . n A 1 16 ARG 16 12 12 ARG ARG A . n A 1 17 ILE 17 13 13 ILE ILE A . n A 1 18 ALA 18 14 14 ALA ALA A . n A 1 19 ARG 19 15 15 ARG ARG A . n A 1 20 GLN 20 16 16 GLN GLN A . n A 1 21 ALA 21 17 17 ALA ALA A . n A 1 22 SER 22 18 18 SER SER A . n A 1 23 LEU 23 19 19 LEU LEU A . n A 1 24 THR 24 20 20 THR THR A . n A 1 25 PHE 25 21 21 PHE PHE A . n A 1 26 ARG 26 22 22 ARG ARG A . n A 1 27 GLY 27 23 ? ? ? A . n A 1 28 SER 28 24 ? ? ? A . n A 1 29 GLY 29 25 ? ? ? A . n A 1 30 GLY 30 26 ? ? ? A . n A 1 31 GLY 31 27 ? ? ? A . n A 1 32 ARG 32 28 ? ? ? A . n A 1 33 GLY 33 29 ? ? ? A . n A 1 34 ALA 34 30 ? ? ? A . n A 1 35 SER 35 31 ? ? ? A . n A 1 36 ASP 36 32 ? ? ? A . n A 1 37 ARG 37 33 ? ? ? A . n A 1 38 ASP 38 34 ? ? ? A . n A 1 39 ALA 39 35 ? ? ? A . n A 1 40 ALA 40 36 ? ? ? A . n A 1 41 SER 41 37 ? ? ? A . n A 1 42 GLY 42 38 ? ? ? A . n A 1 43 PRO 43 39 ? ? ? A . n A 1 44 GLU 44 40 ? ? ? A . n A 1 45 ALA 45 41 41 ALA ALA A . n A 1 46 PRO 46 42 42 PRO PRO A . n A 1 47 MET 47 43 43 MET MET A . n A 1 48 GLN 48 44 44 GLN GLN A . n A 1 49 PRO 49 45 45 PRO PRO A . n A 1 50 GLY 50 46 46 GLY GLY A . n A 1 51 PHE 51 47 47 PHE PHE A . n A 1 52 PRO 52 48 48 PRO PRO A . n A 1 53 GLU 53 49 49 GLU GLU A . n A 1 54 ASN 54 50 50 ASN ASN A . n A 1 55 LEU 55 51 51 LEU LEU A . n A 1 56 SER 56 52 52 SER SER A . n A 1 57 LYS 57 53 53 LYS LYS A . n A 1 58 LEU 58 54 54 LEU LEU A . n A 1 59 LYS 59 55 55 LYS LYS A . n A 1 60 SER 60 56 56 SER SER A . n A 1 61 LEU 61 57 57 LEU LEU A . n A 1 62 LEU 62 58 58 LEU LEU A . n A 1 63 THR 63 59 59 THR THR A . n A 1 64 GLN 64 60 60 GLN GLN A . n A 1 65 LEU 65 61 61 LEU LEU A . n A 1 66 ARG 66 62 62 ARG ARG A . n A 1 67 ALA 67 63 63 ALA ALA A . n A 1 68 GLU 68 64 64 GLU GLU A . n A 1 69 ASP 69 65 65 ASP ASP A . n A 1 70 LEU 70 66 66 LEU LEU A . n A 1 71 ASN 71 67 67 ASN ASN A . n A 1 72 ILE 72 68 68 ILE ILE A . n A 1 73 ALA 73 69 69 ALA ALA A . n A 1 74 PRO 74 70 70 PRO PRO A . n A 1 75 ARG 75 71 71 ARG ARG A . n A 1 76 LYS 76 72 72 LYS LYS A . n A 1 77 ALA 77 73 73 ALA ALA A . n A 1 78 THR 78 74 ? ? ? A . n A 1 79 LEU 79 75 ? ? ? A . n A 1 80 GLN 80 76 ? ? ? A . n A 1 81 PRO 81 77 77 PRO PRO A . n A 1 82 LEU 82 78 78 LEU LEU A . n A 1 83 PRO 83 79 79 PRO PRO A . n A 1 84 PRO 84 80 80 PRO PRO A . n A 1 85 ASN 85 81 81 ASN ASN A . n A 1 86 LEU 86 82 82 LEU LEU A . n A 1 87 PRO 87 83 83 PRO PRO A . n A 1 88 PRO 88 84 84 PRO PRO A . n A 1 89 VAL 89 85 85 VAL VAL A . n A 1 90 THR 90 86 86 THR THR A . n A 1 91 TYR 91 87 87 TYR TYR A . n A 1 92 MET 92 88 88 MET MET A . n A 1 93 HIS 93 89 89 HIS HIS A . n A 1 94 ILE 94 90 90 ILE ILE A . n A 1 95 TYR 95 91 91 TYR TYR A . n A 1 96 GLU 96 92 92 GLU GLU A . n A 1 97 THR 97 93 93 THR THR A . n A 1 98 ASP 98 94 94 ASP ASP A . n A 1 99 GLY 99 95 95 GLY GLY A . n A 1 100 PHE 100 96 96 PHE PHE A . n A 1 101 SER 101 97 97 SER SER A . n A 1 102 LEU 102 98 98 LEU LEU A . n A 1 103 GLY 103 99 99 GLY GLY A . n A 1 104 VAL 104 100 100 VAL VAL A . n A 1 105 PHE 105 101 101 PHE PHE A . n A 1 106 LEU 106 102 102 LEU LEU A . n A 1 107 LEU 107 103 103 LEU LEU A . n A 1 108 LYS 108 104 104 LYS LYS A . n A 1 109 SER 109 105 105 SER SER A . n A 1 110 GLY 110 106 106 GLY GLY A . n A 1 111 THR 111 107 107 THR THR A . n A 1 112 SER 112 108 108 SER SER A . n A 1 113 ILE 113 109 109 ILE ILE A . n A 1 114 PRO 114 110 110 PRO PRO A . n A 1 115 LEU 115 111 111 LEU LEU A . n A 1 116 HIS 116 112 112 HIS HIS A . n A 1 117 ASP 117 113 113 ASP ASP A . n A 1 118 HIS 118 114 114 HIS HIS A . n A 1 119 PRO 119 115 115 PRO PRO A . n A 1 120 GLY 120 116 116 GLY GLY A . n A 1 121 MET 121 117 117 MET MET A . n A 1 122 HIS 122 118 118 HIS HIS A . n A 1 123 GLY 123 119 119 GLY GLY A . n A 1 124 MET 124 120 120 MET MET A . n A 1 125 LEU 125 121 121 LEU LEU A . n A 1 126 LYS 126 122 122 LYS LYS A . n A 1 127 VAL 127 123 123 VAL VAL A . n A 1 128 LEU 128 124 124 LEU LEU A . n A 1 129 TYR 129 125 125 TYR TYR A . n A 1 130 GLY 130 126 126 GLY GLY A . n A 1 131 THR 131 127 127 THR THR A . n A 1 132 VAL 132 128 128 VAL VAL A . n A 1 133 ARG 133 129 129 ARG ARG A . n A 1 134 ILE 134 130 130 ILE ILE A . n A 1 135 SER 135 131 131 SER SER A . n A 1 136 CYS 136 132 132 CYS CYS A . n A 1 137 MET 137 133 133 MET MET A . n A 1 138 ASP 138 134 134 ASP ASP A . n A 1 139 LYS 139 135 135 LYS LYS A . n A 1 140 LEU 140 136 136 LEU LEU A . n A 1 141 ASP 141 137 137 ASP ASP A . n A 1 142 ALA 142 138 138 ALA ALA A . n A 1 143 GLY 143 139 139 GLY GLY A . n A 1 144 GLY 144 140 140 GLY GLY A . n A 1 145 GLY 145 141 141 GLY GLY A . n A 1 146 GLN 146 142 142 GLN GLN A . n A 1 147 ARG 147 143 143 ARG ARG A . n A 1 148 PRO 148 144 144 PRO PRO A . n A 1 149 ARG 149 145 ? ? ? A . n A 1 150 ALA 150 146 146 ALA ALA A . n A 1 151 LEU 151 147 147 LEU LEU A . n A 1 152 PRO 152 148 148 PRO PRO A . n A 1 153 PRO 153 149 149 PRO PRO A . n A 1 154 GLU 154 150 150 GLU GLU A . n A 1 155 GLN 155 151 151 GLN GLN A . n A 1 156 GLN 156 152 152 GLN GLN A . n A 1 157 PHE 157 153 153 PHE PHE A . n A 1 158 GLU 158 154 154 GLU GLU A . n A 1 159 PRO 159 155 155 PRO PRO A . n A 1 160 PRO 160 156 156 PRO PRO A . n A 1 161 LEU 161 157 157 LEU LEU A . n A 1 162 GLN 162 158 158 GLN GLN A . n A 1 163 PRO 163 159 159 PRO PRO A . n A 1 164 ARG 164 160 160 ARG ARG A . n A 1 165 GLU 165 161 161 GLU GLU A . n A 1 166 ARG 166 162 162 ARG ARG A . n A 1 167 GLU 167 163 163 GLU GLU A . n A 1 168 ALA 168 164 164 ALA ALA A . n A 1 169 VAL 169 165 165 VAL VAL A . n A 1 170 ARG 170 166 166 ARG ARG A . n A 1 171 PRO 171 167 167 PRO PRO A . n A 1 172 GLY 172 168 168 GLY GLY A . n A 1 173 VAL 173 169 169 VAL VAL A . n A 1 174 LEU 174 170 170 LEU LEU A . n A 1 175 ARG 175 171 171 ARG ARG A . n A 1 176 SER 176 172 172 SER SER A . n A 1 177 ARG 177 173 173 ARG ARG A . n A 1 178 ALA 178 174 174 ALA ALA A . n A 1 179 GLU 179 175 175 GLU GLU A . n A 1 180 TYR 180 176 176 TYR TYR A . n A 1 181 THR 181 177 177 THR THR A . n A 1 182 GLU 182 178 178 GLU GLU A . n A 1 183 ALA 183 179 179 ALA ALA A . n A 1 184 SER 184 180 180 SER SER A . n A 1 185 GLY 185 181 181 GLY GLY A . n A 1 186 PRO 186 182 182 PRO PRO A . n A 1 187 CYS 187 183 183 CYS CYS A . n A 1 188 ILE 188 184 184 ILE ILE A . n A 1 189 LEU 189 185 185 LEU LEU A . n A 1 190 THR 190 186 186 THR THR A . n A 1 191 PRO 191 187 187 PRO PRO A . n A 1 192 HIS 192 188 188 HIS HIS A . n A 1 193 ARG 193 189 189 ARG ARG A . n A 1 194 ASP 194 190 190 ASP ASP A . n A 1 195 ASN 195 191 191 ASN ASN A . n A 1 196 LEU 196 192 192 LEU LEU A . n A 1 197 HIS 197 193 193 HIS HIS A . n A 1 198 GLN 198 194 194 GLN GLN A . n A 1 199 ILE 199 195 195 ILE ILE A . n A 1 200 ASP 200 196 196 ASP ASP A . n A 1 201 ALA 201 197 197 ALA ALA A . n A 1 202 VAL 202 198 198 VAL VAL A . n A 1 203 GLU 203 199 199 GLU GLU A . n A 1 204 GLY 204 200 200 GLY GLY A . n A 1 205 PRO 205 201 201 PRO PRO A . n A 1 206 ALA 206 202 202 ALA ALA A . n A 1 207 ALA 207 203 203 ALA ALA A . n A 1 208 PHE 208 204 204 PHE PHE A . n A 1 209 LEU 209 205 205 LEU LEU A . n A 1 210 ASP 210 206 206 ASP ASP A . n A 1 211 ILE 211 207 207 ILE ILE A . n A 1 212 LEU 212 208 208 LEU LEU A . n A 1 213 ALA 213 209 209 ALA ALA A . n A 1 214 PRO 214 210 210 PRO PRO A . n A 1 215 PRO 215 211 211 PRO PRO A . n A 1 216 TYR 216 212 212 TYR TYR A . n A 1 217 ASP 217 213 213 ASP ASP A . n A 1 218 PRO 218 214 214 PRO PRO A . n A 1 219 ASP 219 215 215 ASP ASP A . n A 1 220 ASP 220 216 216 ASP ASP A . n A 1 221 GLY 221 217 217 GLY GLY A . n A 1 222 ARG 222 218 218 ARG ARG A . n A 1 223 ASP 223 219 219 ASP ASP A . n A 1 224 CYS 224 220 220 CYS CYS A . n A 1 225 HIS 225 221 221 HIS HIS A . n A 1 226 TYR 226 222 222 TYR TYR A . n A 1 227 TYR 227 223 223 TYR TYR A . n A 1 228 ARG 228 224 224 ARG ARG A . n A 1 229 VAL 229 225 225 VAL VAL A . n A 1 230 LEU 230 226 226 LEU LEU A . n A 1 231 GLU 231 227 227 GLU GLU A . n A 1 232 PRO 232 228 228 PRO PRO A . n A 1 233 VAL 233 229 ? ? ? A . n A 1 234 ARG 234 230 ? ? ? A . n A 1 235 PRO 235 231 ? ? ? A . n A 1 236 LYS 236 232 ? ? ? A . n A 1 237 GLU 237 233 ? ? ? A . n A 1 238 ALA 238 234 ? ? ? A . n A 1 239 SER 239 235 ? ? ? A . n A 1 240 SER 240 236 ? ? ? A . n A 1 241 SER 241 237 ? ? ? A . n A 1 242 ALA 242 238 ? ? ? A . n A 1 243 SER 243 239 ? ? ? A . n A 1 244 ASP 244 240 ? ? ? A . n A 1 245 LEU 245 241 241 LEU LEU A . n A 1 246 PRO 246 242 242 PRO PRO A . n A 1 247 ARG 247 243 243 ARG ARG A . n A 1 248 GLU 248 244 244 GLU GLU A . n A 1 249 VAL 249 245 245 VAL VAL A . n A 1 250 TRP 250 246 246 TRP TRP A . n A 1 251 LEU 251 247 247 LEU LEU A . n A 1 252 LEU 252 248 248 LEU LEU A . n A 1 253 GLU 253 249 249 GLU GLU A . n A 1 254 THR 254 250 250 THR THR A . n A 1 255 PRO 255 251 251 PRO PRO A . n A 1 256 GLN 256 252 252 GLN GLN A . n A 1 257 ALA 257 253 253 ALA ALA A . n A 1 258 ASP 258 254 254 ASP ASP A . n A 1 259 ASP 259 255 255 ASP ASP A . n A 1 260 PHE 260 256 256 PHE PHE A . n A 1 261 TRP 261 257 257 TRP TRP A . n A 1 262 CYS 262 258 258 CYS CYS A . n A 1 263 GLU 263 259 259 GLU GLU A . n A 1 264 GLY 264 260 260 GLY GLY A . n A 1 265 GLU 265 261 261 GLU GLU A . n A 1 266 PRO 266 262 262 PRO PRO A . n A 1 267 TYR 267 263 263 TYR TYR A . n A 1 268 PRO 268 264 264 PRO PRO A . n A 1 269 GLY 269 265 265 GLY GLY A . n A 1 270 PRO 270 266 266 PRO PRO A . n A 1 271 LYS 271 267 267 LYS LYS A . n A 1 272 VAL 272 268 268 VAL VAL A . n A 1 273 PHE 273 269 269 PHE PHE A . n A 1 274 PRO 274 270 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FE2 1 301 301 FE2 FE A . C 3 HLZ 1 302 401 HLZ HLZ A . D 4 GOL 1 303 501 GOL GOL A . E 4 GOL 1 304 601 GOL GOL A . F 5 HOH 1 401 8 HOH HOH A . F 5 HOH 2 402 2 HOH HOH A . F 5 HOH 3 403 4 HOH HOH A . F 5 HOH 4 404 25 HOH HOH A . F 5 HOH 5 405 21 HOH HOH A . F 5 HOH 6 406 9 HOH HOH A . F 5 HOH 7 407 16 HOH HOH A . F 5 HOH 8 408 15 HOH HOH A . F 5 HOH 9 409 7 HOH HOH A . F 5 HOH 10 410 5 HOH HOH A . F 5 HOH 11 411 11 HOH HOH A . F 5 HOH 12 412 22 HOH HOH A . F 5 HOH 13 413 23 HOH HOH A . F 5 HOH 14 414 17 HOH HOH A . F 5 HOH 15 415 1 HOH HOH A . F 5 HOH 16 416 6 HOH HOH A . F 5 HOH 17 417 24 HOH HOH A . F 5 HOH 18 418 19 HOH HOH A . F 5 HOH 19 419 18 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.21_5207: ???)' ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? 1.21 ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 # _cell.entry_id 9DY4 _cell.length_a 56.203 _cell.length_b 95.175 _cell.length_c 117.797 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 9DY4 _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9DY4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.56 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.9 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M (NH4)2SO4, 0.1 M Bis-Tris pH 5.5, 20% w/v PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 289 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-05-21 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97946 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL9-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97946 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL9-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9DY4 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.39 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12657 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.6 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 4.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.981 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.194 _reflns.pdbx_Rpim_I_all 0.069 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 95946 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.951 _reflns.pdbx_CC_star 0.987 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.181 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.39 2.43 ? ? ? ? ? ? 586 ? ? ? ? ? ? ? ? ? ? ? 5.4 0.559 ? ? 0.884 0.351 ? 1 1 0.876 0.966 ? 94.1 ? 0.805 ? ? ? ? ? ? ? ? ? 2.43 2.48 ? ? ? ? ? ? 609 ? ? ? ? ? ? ? ? ? ? ? 5.5 0.626 ? ? 0.750 0.295 ? 2 1 0.910 0.976 ? 97.0 ? 0.684 ? ? ? ? ? ? ? ? ? 2.48 2.52 ? ? ? ? ? ? 604 ? ? ? ? ? ? ? ? ? ? ? 5.6 0.606 ? ? 0.798 0.313 ? 3 1 0.827 0.951 ? 93.6 ? 0.728 ? ? ? ? ? ? ? ? ? 2.52 2.57 ? ? ? ? ? ? 588 ? ? ? ? ? ? ? ? ? ? ? 5.9 0.644 ? ? 0.587 0.221 ? 4 1 0.960 0.990 ? 93.6 ? 0.541 ? ? ? ? ? ? ? ? ? 2.57 2.63 ? ? ? ? ? ? 612 ? ? ? ? ? ? ? ? ? ? ? 5.9 0.654 ? ? 0.614 0.234 ? 5 1 0.920 0.979 ? 95.3 ? 0.564 ? ? ? ? ? ? ? ? ? 2.63 2.69 ? ? ? ? ? ? 600 ? ? ? ? ? ? ? ? ? ? ? 6.4 0.972 ? ? 0.643 0.244 ? 6 1 0.877 0.967 ? 95.5 ? 0.592 ? ? ? ? ? ? ? ? ? 2.69 2.76 ? ? ? ? ? ? 628 ? ? ? ? ? ? ? ? ? ? ? 6.3 0.689 ? ? 0.597 0.225 ? 7 1 0.921 0.979 ? 97.5 ? 0.551 ? ? ? ? ? ? ? ? ? 2.76 2.83 ? ? ? ? ? ? 620 ? ? ? ? ? ? ? ? ? ? ? 6.4 0.729 ? ? 0.471 0.179 ? 8 1 0.971 0.993 ? 98.7 ? 0.434 ? ? ? ? ? ? ? ? ? 2.83 2.92 ? ? ? ? ? ? 637 ? ? ? ? ? ? ? ? ? ? ? 7.8 0.705 ? ? 0.440 0.155 ? 9 1 0.973 0.993 ? 99.4 ? 0.411 ? ? ? ? ? ? ? ? ? 2.92 3.01 ? ? ? ? ? ? 616 ? ? ? ? ? ? ? ? ? ? ? 8.3 0.763 ? ? 0.392 0.137 ? 10 1 0.973 0.993 ? 99.5 ? 0.367 ? ? ? ? ? ? ? ? ? 3.01 3.12 ? ? ? ? ? ? 651 ? ? ? ? ? ? ? ? ? ? ? 8.6 0.767 ? ? 0.373 0.128 ? 11 1 0.978 0.994 ? 99.8 ? 0.350 ? ? ? ? ? ? ? ? ? 3.12 3.24 ? ? ? ? ? ? 646 ? ? ? ? ? ? ? ? ? ? ? 9.1 0.833 ? ? 0.337 0.115 ? 12 1 0.943 0.985 ? 99.8 ? 0.316 ? ? ? ? ? ? ? ? ? 3.24 3.39 ? ? ? ? ? ? 631 ? ? ? ? ? ? ? ? ? ? ? 8.9 0.896 ? ? 0.265 0.090 ? 13 1 0.983 0.996 ? 100.0 ? 0.249 ? ? ? ? ? ? ? ? ? 3.39 3.57 ? ? ? ? ? ? 640 ? ? ? ? ? ? ? ? ? ? ? 8.7 1.166 ? ? 0.249 0.088 ? 14 1 0.980 0.995 ? 100.0 ? 0.232 ? ? ? ? ? ? ? ? ? 3.57 3.79 ? ? ? ? ? ? 646 ? ? ? ? ? ? ? ? ? ? ? 8.3 1.246 ? ? 0.210 0.076 ? 15 1 0.970 0.992 ? 99.8 ? 0.195 ? ? ? ? ? ? ? ? ? 3.79 4.09 ? ? ? ? ? ? 648 ? ? ? ? ? ? ? ? ? ? ? 9.2 1.395 ? ? 0.206 0.070 ? 16 1 0.985 0.996 ? 99.8 ? 0.193 ? ? ? ? ? ? ? ? ? 4.09 4.50 ? ? ? ? ? ? 653 ? ? ? ? ? ? ? ? ? ? ? 9.1 1.240 ? ? 0.171 0.060 ? 17 1 0.983 0.996 ? 100.0 ? 0.160 ? ? ? ? ? ? ? ? ? 4.50 5.15 ? ? ? ? ? ? 656 ? ? ? ? ? ? ? ? ? ? ? 8.7 1.294 ? ? 0.168 0.058 ? 18 1 0.977 0.994 ? 99.8 ? 0.157 ? ? ? ? ? ? ? ? ? 5.15 6.48 ? ? ? ? ? ? 668 ? ? ? ? ? ? ? ? ? ? ? 8.3 1.320 ? ? 0.161 0.057 ? 19 1 0.980 0.995 ? 99.7 ? 0.150 ? ? ? ? ? ? ? ? ? 6.48 50.00 ? ? ? ? ? ? 718 ? ? ? ? ? ? ? ? ? ? ? 8.1 1.450 ? ? 0.142 0.050 ? 20 1 0.988 0.997 ? 99.9 ? 0.132 ? ? ? ? ? ? ? ? ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 9DY4 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 12504 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.370 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 48.39 _refine.ls_d_res_high 2.39 _refine.ls_percent_reflns_obs 97.1 _refine.ls_R_factor_obs 0.258 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.253 _refine.ls_R_factor_R_free 0.308 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.880 _refine.ls_number_reflns_R_free 1235 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.400 _refine.pdbx_overall_phase_error 44.750 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1826 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 25 _refine_hist.number_atoms_solvent 19 _refine_hist.number_atoms_total 1870 _refine_hist.d_res_high 2.39 _refine_hist.d_res_low 48.39 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.008 ? ? 1901 'X-RAY DIFFRACTION' ? f_angle_d 1.065 ? ? 2583 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 20.459 ? ? 727 'X-RAY DIFFRACTION' ? f_chiral_restr 0.048 ? ? 272 'X-RAY DIFFRACTION' ? f_plane_restr 0.010 ? ? 343 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all 'X-RAY DIFFRACTION' . 2.3900 2.4900 1180 0.5106 93.00 0.5294 . . 126 . . 'X-RAY DIFFRACTION' . 2.4900 2.6000 1175 0.4267 93.00 0.4782 . . 135 . . 'X-RAY DIFFRACTION' . 2.6000 2.7400 1213 0.3935 95.00 0.4548 . . 125 . . 'X-RAY DIFFRACTION' . 2.7400 2.9100 1229 0.3783 96.00 0.4402 . . 143 . . 'X-RAY DIFFRACTION' . 2.9100 3.1300 1243 0.3020 98.00 0.4148 . . 134 . . 'X-RAY DIFFRACTION' . 3.1300 3.4500 1284 0.2494 99.00 0.3351 . . 140 . . 'X-RAY DIFFRACTION' . 3.4500 3.9500 1281 0.2205 99.00 0.2984 . . 142 . . 'X-RAY DIFFRACTION' . 3.9500 4.9700 1292 0.1931 100.00 0.2482 . . 141 . . 'X-RAY DIFFRACTION' . 4.9700 48.3900 1372 0.2174 100.00 0.2443 . . 149 . . # _struct.entry_id 9DY4 _struct.title 'Crystal structure of iron-bound human ADO C18S/C239S variant soaked in hydralazine at 2.39 Angstrom resolution' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9DY4 _struct_keywords.text 'cysteamine dioxygenase, cobalt-bound human ADO, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AEDO_HUMAN _struct_ref.pdbx_db_accession Q96SZ5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PRDNMASLIQRIARQACLTFRGSGGGRGASDRDAASGPEAPMQPGFPENLSKLKSLLTQLRAEDLNIAPRKATLQPLPPN LPPVTYMHIYETDGFSLGVFLLKSGTSIPLHDHPGMHGMLKVLYGTVRISCMDKLDAGGGQRPRALPPEQQFEPPLQPRE REAVRPGVLRSRAEYTEASGPCILTPHRDNLHQIDAVEGPAAFLDILAPPYDPDDGRDCHYYRVLEPVRPKEASSSACDL PREVWLLETPQADDFWCEGEPYPGPKVFP ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9DY4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 274 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q96SZ5 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 270 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 270 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9DY4 GLY A 1 ? UNP Q96SZ5 ? ? 'expression tag' -3 1 1 9DY4 HIS A 2 ? UNP Q96SZ5 ? ? 'expression tag' -2 2 1 9DY4 MET A 3 ? UNP Q96SZ5 ? ? 'expression tag' -1 3 1 9DY4 ALA A 4 ? UNP Q96SZ5 ? ? 'expression tag' 0 4 1 9DY4 SER A 5 ? UNP Q96SZ5 ? ? 'expression tag' 1 5 1 9DY4 SER A 22 ? UNP Q96SZ5 CYS 18 'engineered mutation' 18 6 1 9DY4 SER A 243 ? UNP Q96SZ5 CYS 239 'engineered mutation' 239 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 12 ? ARG A 26 ? SER A 8 ARG A 22 1 ? 15 HELX_P HELX_P2 AA2 GLY A 50 ? GLN A 64 ? GLY A 46 GLN A 60 1 ? 15 HELX_P HELX_P3 AA3 ARG A 66 ? ASN A 71 ? ARG A 62 ASN A 67 5 ? 6 HELX_P HELX_P4 AA4 ASP A 141 ? GLY A 145 ? ASP A 137 GLY A 141 5 ? 5 HELX_P HELX_P5 AA5 GLN A 162 ? GLU A 167 ? GLN A 158 GLU A 163 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 116 NE2 ? ? ? 1_555 B FE2 . FE ? ? A HIS 112 A FE2 301 1_555 ? ? ? ? ? ? ? 2.476 ? ? metalc2 metalc ? ? A HIS 118 NE2 ? ? ? 1_555 B FE2 . FE ? ? A HIS 114 A FE2 301 1_555 ? ? ? ? ? ? ? 2.269 ? ? metalc3 metalc ? ? A HIS 197 NE2 ? ? ? 1_555 B FE2 . FE ? ? A HIS 193 A FE2 301 1_555 ? ? ? ? ? ? ? 2.413 ? ? metalc4 metalc ? ? B FE2 . FE ? ? ? 1_555 F HOH . O ? ? A FE2 301 A HOH 402 1_555 ? ? ? ? ? ? ? 2.212 ? ? metalc5 metalc ? ? B FE2 . FE ? ? ? 1_555 F HOH . O ? ? A FE2 301 A HOH 410 1_555 ? ? ? ? ? ? ? 2.304 ? ? metalc6 metalc ? ? B FE2 . FE ? ? ? 1_555 F HOH . O ? ? A FE2 301 A HOH 415 1_555 ? ? ? ? ? ? ? 2.536 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 116 ? A HIS 112 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 NE2 ? A HIS 118 ? A HIS 114 ? 1_555 93.1 ? 2 NE2 ? A HIS 116 ? A HIS 112 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 NE2 ? A HIS 197 ? A HIS 193 ? 1_555 85.6 ? 3 NE2 ? A HIS 118 ? A HIS 114 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 NE2 ? A HIS 197 ? A HIS 193 ? 1_555 83.8 ? 4 NE2 ? A HIS 116 ? A HIS 112 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? F HOH . ? A HOH 402 ? 1_555 160.1 ? 5 NE2 ? A HIS 118 ? A HIS 114 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? F HOH . ? A HOH 402 ? 1_555 105.7 ? 6 NE2 ? A HIS 197 ? A HIS 193 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? F HOH . ? A HOH 402 ? 1_555 102.8 ? 7 NE2 ? A HIS 116 ? A HIS 112 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? F HOH . ? A HOH 410 ? 1_555 78.0 ? 8 NE2 ? A HIS 118 ? A HIS 114 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? F HOH . ? A HOH 410 ? 1_555 107.8 ? 9 NE2 ? A HIS 197 ? A HIS 193 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? F HOH . ? A HOH 410 ? 1_555 160.3 ? 10 O ? F HOH . ? A HOH 402 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? F HOH . ? A HOH 410 ? 1_555 89.6 ? 11 NE2 ? A HIS 116 ? A HIS 112 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? F HOH . ? A HOH 415 ? 1_555 86.3 ? 12 NE2 ? A HIS 118 ? A HIS 114 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? F HOH . ? A HOH 415 ? 1_555 171.6 ? 13 NE2 ? A HIS 197 ? A HIS 193 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? F HOH . ? A HOH 415 ? 1_555 87.8 ? 14 O ? F HOH . ? A HOH 402 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? F HOH . ? A HOH 415 ? 1_555 76.1 ? 15 O ? F HOH . ? A HOH 410 ? 1_555 FE ? B FE2 . ? A FE2 301 ? 1_555 O ? F HOH . ? A HOH 415 ? 1_555 80.3 ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLU 158 A . ? GLU 154 A PRO 159 A ? PRO 155 A 1 -6.24 2 ALA 213 A . ? ALA 209 A PRO 214 A ? PRO 210 A 1 -9.06 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 11 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 1 11 ? parallel AA1 2 8 ? anti-parallel AA1 3 8 ? anti-parallel AA1 3 9 ? anti-parallel AA1 4 5 ? anti-parallel AA1 4 6 ? anti-parallel AA1 4 7 ? anti-parallel AA1 4 8 ? anti-parallel AA1 5 10 ? anti-parallel AA1 9 10 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 89 ? GLU A 96 ? VAL A 85 GLU A 92 AA1 2 SER A 101 ? LEU A 107 ? SER A 97 LEU A 103 AA1 3 SER A 112 ? HIS A 116 ? SER A 108 HIS A 112 AA1 4 HIS A 122 ? LYS A 139 ? HIS A 118 LYS A 135 AA1 5 ARG A 170 ? SER A 176 ? ARG A 166 SER A 172 AA1 6 GLU A 179 ? THR A 181 ? GLU A 175 THR A 177 AA1 7 CYS A 187 ? LEU A 189 ? CYS A 183 LEU A 185 AA1 8 LEU A 196 ? ALA A 213 ? LEU A 192 ALA A 209 AA1 9 TYR A 226 ? VAL A 229 ? TYR A 222 VAL A 225 AA1 10 ARG A 247 ? THR A 254 ? ARG A 243 THR A 250 AA1 11 CYS A 262 ? GLY A 264 ? CYS A 258 GLY A 260 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 90 ? N THR A 86 O LEU A 106 ? O LEU A 102 AA1 1 11 N TYR A 91 ? N TYR A 87 O GLU A 263 ? O GLU A 259 AA1 2 8 N GLY A 103 ? N GLY A 99 O ASP A 210 ? O ASP A 206 AA1 3 8 N ILE A 113 ? N ILE A 109 O ILE A 199 ? O ILE A 195 AA1 3 9 N LEU A 115 ? N LEU A 111 O TYR A 227 ? O TYR A 223 AA1 4 5 N CYS A 136 ? N CYS A 132 O ARG A 175 ? O ARG A 171 AA1 4 6 N VAL A 132 ? N VAL A 128 O TYR A 180 ? O TYR A 176 AA1 4 7 N GLY A 123 ? N GLY A 119 O LEU A 189 ? O LEU A 185 AA1 4 8 N LEU A 128 ? N LEU A 124 O ALA A 207 ? O ALA A 203 AA1 5 10 N GLY A 172 ? N GLY A 168 O VAL A 249 ? O VAL A 245 AA1 9 10 N ARG A 228 ? N ARG A 224 O LEU A 252 ? O LEU A 248 # _pdbx_entry_details.entry_id 9DY4 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 80 ? ? -56.89 -9.10 2 1 SER A 108 ? ? -174.65 145.50 3 1 PRO A 115 ? ? -49.46 102.11 4 1 ARG A 173 ? ? -153.25 31.32 5 1 ASP A 190 ? ? 47.00 25.84 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -3 ? A GLY 1 2 1 Y 1 A HIS -2 ? A HIS 2 3 1 Y 1 A MET -1 ? A MET 3 4 1 Y 1 A ALA 0 ? A ALA 4 5 1 Y 1 A SER 1 ? A SER 5 6 1 Y 1 A PRO 2 ? A PRO 6 7 1 Y 1 A ARG 3 ? A ARG 7 8 1 Y 1 A GLY 23 ? A GLY 27 9 1 Y 1 A SER 24 ? A SER 28 10 1 Y 1 A GLY 25 ? A GLY 29 11 1 Y 1 A GLY 26 ? A GLY 30 12 1 Y 1 A GLY 27 ? A GLY 31 13 1 Y 1 A ARG 28 ? A ARG 32 14 1 Y 1 A GLY 29 ? A GLY 33 15 1 Y 1 A ALA 30 ? A ALA 34 16 1 Y 1 A SER 31 ? A SER 35 17 1 Y 1 A ASP 32 ? A ASP 36 18 1 Y 1 A ARG 33 ? A ARG 37 19 1 Y 1 A ASP 34 ? A ASP 38 20 1 Y 1 A ALA 35 ? A ALA 39 21 1 Y 1 A ALA 36 ? A ALA 40 22 1 Y 1 A SER 37 ? A SER 41 23 1 Y 1 A GLY 38 ? A GLY 42 24 1 Y 1 A PRO 39 ? A PRO 43 25 1 Y 1 A GLU 40 ? A GLU 44 26 1 Y 1 A THR 74 ? A THR 78 27 1 Y 1 A LEU 75 ? A LEU 79 28 1 Y 1 A GLN 76 ? A GLN 80 29 1 Y 1 A ARG 145 ? A ARG 149 30 1 Y 1 A VAL 229 ? A VAL 233 31 1 Y 1 A ARG 230 ? A ARG 234 32 1 Y 1 A PRO 231 ? A PRO 235 33 1 Y 1 A LYS 232 ? A LYS 236 34 1 Y 1 A GLU 233 ? A GLU 237 35 1 Y 1 A ALA 234 ? A ALA 238 36 1 Y 1 A SER 235 ? A SER 239 37 1 Y 1 A SER 236 ? A SER 240 38 1 Y 1 A SER 237 ? A SER 241 39 1 Y 1 A ALA 238 ? A ALA 242 40 1 Y 1 A SER 239 ? A SER 243 41 1 Y 1 A ASP 240 ? A ASP 244 42 1 Y 1 A PRO 270 ? A PRO 274 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FE2 FE FE N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 GOL C1 C N N 138 GOL O1 O N N 139 GOL C2 C N N 140 GOL O2 O N N 141 GOL C3 C N N 142 GOL O3 O N N 143 GOL H11 H N N 144 GOL H12 H N N 145 GOL HO1 H N N 146 GOL H2 H N N 147 GOL HO2 H N N 148 GOL H31 H N N 149 GOL H32 H N N 150 GOL HO3 H N N 151 HIS N N N N 152 HIS CA C N S 153 HIS C C N N 154 HIS O O N N 155 HIS CB C N N 156 HIS CG C Y N 157 HIS ND1 N Y N 158 HIS CD2 C Y N 159 HIS CE1 C Y N 160 HIS NE2 N Y N 161 HIS OXT O N N 162 HIS H H N N 163 HIS H2 H N N 164 HIS HA H N N 165 HIS HB2 H N N 166 HIS HB3 H N N 167 HIS HD1 H N N 168 HIS HD2 H N N 169 HIS HE1 H N N 170 HIS HE2 H N N 171 HIS HXT H N N 172 HLZ C1 C Y N 173 HLZ N2 N Y N 174 HLZ N3 N Y N 175 HLZ C4 C Y N 176 HLZ C5 C Y N 177 HLZ C6 C Y N 178 HLZ C7 C Y N 179 HLZ C8 C Y N 180 HLZ C9 C Y N 181 HLZ C10 C Y N 182 HLZ N11 N N N 183 HLZ N12 N N N 184 HLZ H4 H N N 185 HLZ H7 H N N 186 HLZ H8 H N N 187 HLZ H9 H N N 188 HLZ H10 H N N 189 HLZ HN11 H N N 190 HLZ HN12 H N N 191 HLZ HN1A H N N 192 HOH O O N N 193 HOH H1 H N N 194 HOH H2 H N N 195 ILE N N N N 196 ILE CA C N S 197 ILE C C N N 198 ILE O O N N 199 ILE CB C N S 200 ILE CG1 C N N 201 ILE CG2 C N N 202 ILE CD1 C N N 203 ILE OXT O N N 204 ILE H H N N 205 ILE H2 H N N 206 ILE HA H N N 207 ILE HB H N N 208 ILE HG12 H N N 209 ILE HG13 H N N 210 ILE HG21 H N N 211 ILE HG22 H N N 212 ILE HG23 H N N 213 ILE HD11 H N N 214 ILE HD12 H N N 215 ILE HD13 H N N 216 ILE HXT H N N 217 LEU N N N N 218 LEU CA C N S 219 LEU C C N N 220 LEU O O N N 221 LEU CB C N N 222 LEU CG C N N 223 LEU CD1 C N N 224 LEU CD2 C N N 225 LEU OXT O N N 226 LEU H H N N 227 LEU H2 H N N 228 LEU HA H N N 229 LEU HB2 H N N 230 LEU HB3 H N N 231 LEU HG H N N 232 LEU HD11 H N N 233 LEU HD12 H N N 234 LEU HD13 H N N 235 LEU HD21 H N N 236 LEU HD22 H N N 237 LEU HD23 H N N 238 LEU HXT H N N 239 LYS N N N N 240 LYS CA C N S 241 LYS C C N N 242 LYS O O N N 243 LYS CB C N N 244 LYS CG C N N 245 LYS CD C N N 246 LYS CE C N N 247 LYS NZ N N N 248 LYS OXT O N N 249 LYS H H N N 250 LYS H2 H N N 251 LYS HA H N N 252 LYS HB2 H N N 253 LYS HB3 H N N 254 LYS HG2 H N N 255 LYS HG3 H N N 256 LYS HD2 H N N 257 LYS HD3 H N N 258 LYS HE2 H N N 259 LYS HE3 H N N 260 LYS HZ1 H N N 261 LYS HZ2 H N N 262 LYS HZ3 H N N 263 LYS HXT H N N 264 MET N N N N 265 MET CA C N S 266 MET C C N N 267 MET O O N N 268 MET CB C N N 269 MET CG C N N 270 MET SD S N N 271 MET CE C N N 272 MET OXT O N N 273 MET H H N N 274 MET H2 H N N 275 MET HA H N N 276 MET HB2 H N N 277 MET HB3 H N N 278 MET HG2 H N N 279 MET HG3 H N N 280 MET HE1 H N N 281 MET HE2 H N N 282 MET HE3 H N N 283 MET HXT H N N 284 PHE N N N N 285 PHE CA C N S 286 PHE C C N N 287 PHE O O N N 288 PHE CB C N N 289 PHE CG C Y N 290 PHE CD1 C Y N 291 PHE CD2 C Y N 292 PHE CE1 C Y N 293 PHE CE2 C Y N 294 PHE CZ C Y N 295 PHE OXT O N N 296 PHE H H N N 297 PHE H2 H N N 298 PHE HA H N N 299 PHE HB2 H N N 300 PHE HB3 H N N 301 PHE HD1 H N N 302 PHE HD2 H N N 303 PHE HE1 H N N 304 PHE HE2 H N N 305 PHE HZ H N N 306 PHE HXT H N N 307 PRO N N N N 308 PRO CA C N S 309 PRO C C N N 310 PRO O O N N 311 PRO CB C N N 312 PRO CG C N N 313 PRO CD C N N 314 PRO OXT O N N 315 PRO H H N N 316 PRO HA H N N 317 PRO HB2 H N N 318 PRO HB3 H N N 319 PRO HG2 H N N 320 PRO HG3 H N N 321 PRO HD2 H N N 322 PRO HD3 H N N 323 PRO HXT H N N 324 SER N N N N 325 SER CA C N S 326 SER C C N N 327 SER O O N N 328 SER CB C N N 329 SER OG O N N 330 SER OXT O N N 331 SER H H N N 332 SER H2 H N N 333 SER HA H N N 334 SER HB2 H N N 335 SER HB3 H N N 336 SER HG H N N 337 SER HXT H N N 338 THR N N N N 339 THR CA C N S 340 THR C C N N 341 THR O O N N 342 THR CB C N R 343 THR OG1 O N N 344 THR CG2 C N N 345 THR OXT O N N 346 THR H H N N 347 THR H2 H N N 348 THR HA H N N 349 THR HB H N N 350 THR HG1 H N N 351 THR HG21 H N N 352 THR HG22 H N N 353 THR HG23 H N N 354 THR HXT H N N 355 TRP N N N N 356 TRP CA C N S 357 TRP C C N N 358 TRP O O N N 359 TRP CB C N N 360 TRP CG C Y N 361 TRP CD1 C Y N 362 TRP CD2 C Y N 363 TRP NE1 N Y N 364 TRP CE2 C Y N 365 TRP CE3 C Y N 366 TRP CZ2 C Y N 367 TRP CZ3 C Y N 368 TRP CH2 C Y N 369 TRP OXT O N N 370 TRP H H N N 371 TRP H2 H N N 372 TRP HA H N N 373 TRP HB2 H N N 374 TRP HB3 H N N 375 TRP HD1 H N N 376 TRP HE1 H N N 377 TRP HE3 H N N 378 TRP HZ2 H N N 379 TRP HZ3 H N N 380 TRP HH2 H N N 381 TRP HXT H N N 382 TYR N N N N 383 TYR CA C N S 384 TYR C C N N 385 TYR O O N N 386 TYR CB C N N 387 TYR CG C Y N 388 TYR CD1 C Y N 389 TYR CD2 C Y N 390 TYR CE1 C Y N 391 TYR CE2 C Y N 392 TYR CZ C Y N 393 TYR OH O N N 394 TYR OXT O N N 395 TYR H H N N 396 TYR H2 H N N 397 TYR HA H N N 398 TYR HB2 H N N 399 TYR HB3 H N N 400 TYR HD1 H N N 401 TYR HD2 H N N 402 TYR HE1 H N N 403 TYR HE2 H N N 404 TYR HH H N N 405 TYR HXT H N N 406 VAL N N N N 407 VAL CA C N S 408 VAL C C N N 409 VAL O O N N 410 VAL CB C N N 411 VAL CG1 C N N 412 VAL CG2 C N N 413 VAL OXT O N N 414 VAL H H N N 415 VAL H2 H N N 416 VAL HA H N N 417 VAL HB H N N 418 VAL HG11 H N N 419 VAL HG12 H N N 420 VAL HG13 H N N 421 VAL HG21 H N N 422 VAL HG22 H N N 423 VAL HG23 H N N 424 VAL HXT H N N 425 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 GOL C1 O1 sing N N 129 GOL C1 C2 sing N N 130 GOL C1 H11 sing N N 131 GOL C1 H12 sing N N 132 GOL O1 HO1 sing N N 133 GOL C2 O2 sing N N 134 GOL C2 C3 sing N N 135 GOL C2 H2 sing N N 136 GOL O2 HO2 sing N N 137 GOL C3 O3 sing N N 138 GOL C3 H31 sing N N 139 GOL C3 H32 sing N N 140 GOL O3 HO3 sing N N 141 HIS N CA sing N N 142 HIS N H sing N N 143 HIS N H2 sing N N 144 HIS CA C sing N N 145 HIS CA CB sing N N 146 HIS CA HA sing N N 147 HIS C O doub N N 148 HIS C OXT sing N N 149 HIS CB CG sing N N 150 HIS CB HB2 sing N N 151 HIS CB HB3 sing N N 152 HIS CG ND1 sing Y N 153 HIS CG CD2 doub Y N 154 HIS ND1 CE1 doub Y N 155 HIS ND1 HD1 sing N N 156 HIS CD2 NE2 sing Y N 157 HIS CD2 HD2 sing N N 158 HIS CE1 NE2 sing Y N 159 HIS CE1 HE1 sing N N 160 HIS NE2 HE2 sing N N 161 HIS OXT HXT sing N N 162 HLZ C1 N2 doub Y N 163 HLZ C1 C6 sing Y N 164 HLZ C1 N11 sing N N 165 HLZ N2 N3 sing Y N 166 HLZ N3 C4 doub Y N 167 HLZ C4 C5 sing Y N 168 HLZ C5 C6 doub Y N 169 HLZ C5 C10 sing Y N 170 HLZ C6 C7 sing Y N 171 HLZ C7 C8 doub Y N 172 HLZ C8 C9 sing Y N 173 HLZ C9 C10 doub Y N 174 HLZ N11 N12 sing N N 175 HLZ C4 H4 sing N N 176 HLZ C7 H7 sing N N 177 HLZ C8 H8 sing N N 178 HLZ C9 H9 sing N N 179 HLZ C10 H10 sing N N 180 HLZ N11 HN11 sing N N 181 HLZ N12 HN12 sing N N 182 HLZ N12 HN1A sing N N 183 HOH O H1 sing N N 184 HOH O H2 sing N N 185 ILE N CA sing N N 186 ILE N H sing N N 187 ILE N H2 sing N N 188 ILE CA C sing N N 189 ILE CA CB sing N N 190 ILE CA HA sing N N 191 ILE C O doub N N 192 ILE C OXT sing N N 193 ILE CB CG1 sing N N 194 ILE CB CG2 sing N N 195 ILE CB HB sing N N 196 ILE CG1 CD1 sing N N 197 ILE CG1 HG12 sing N N 198 ILE CG1 HG13 sing N N 199 ILE CG2 HG21 sing N N 200 ILE CG2 HG22 sing N N 201 ILE CG2 HG23 sing N N 202 ILE CD1 HD11 sing N N 203 ILE CD1 HD12 sing N N 204 ILE CD1 HD13 sing N N 205 ILE OXT HXT sing N N 206 LEU N CA sing N N 207 LEU N H sing N N 208 LEU N H2 sing N N 209 LEU CA C sing N N 210 LEU CA CB sing N N 211 LEU CA HA sing N N 212 LEU C O doub N N 213 LEU C OXT sing N N 214 LEU CB CG sing N N 215 LEU CB HB2 sing N N 216 LEU CB HB3 sing N N 217 LEU CG CD1 sing N N 218 LEU CG CD2 sing N N 219 LEU CG HG sing N N 220 LEU CD1 HD11 sing N N 221 LEU CD1 HD12 sing N N 222 LEU CD1 HD13 sing N N 223 LEU CD2 HD21 sing N N 224 LEU CD2 HD22 sing N N 225 LEU CD2 HD23 sing N N 226 LEU OXT HXT sing N N 227 LYS N CA sing N N 228 LYS N H sing N N 229 LYS N H2 sing N N 230 LYS CA C sing N N 231 LYS CA CB sing N N 232 LYS CA HA sing N N 233 LYS C O doub N N 234 LYS C OXT sing N N 235 LYS CB CG sing N N 236 LYS CB HB2 sing N N 237 LYS CB HB3 sing N N 238 LYS CG CD sing N N 239 LYS CG HG2 sing N N 240 LYS CG HG3 sing N N 241 LYS CD CE sing N N 242 LYS CD HD2 sing N N 243 LYS CD HD3 sing N N 244 LYS CE NZ sing N N 245 LYS CE HE2 sing N N 246 LYS CE HE3 sing N N 247 LYS NZ HZ1 sing N N 248 LYS NZ HZ2 sing N N 249 LYS NZ HZ3 sing N N 250 LYS OXT HXT sing N N 251 MET N CA sing N N 252 MET N H sing N N 253 MET N H2 sing N N 254 MET CA C sing N N 255 MET CA CB sing N N 256 MET CA HA sing N N 257 MET C O doub N N 258 MET C OXT sing N N 259 MET CB CG sing N N 260 MET CB HB2 sing N N 261 MET CB HB3 sing N N 262 MET CG SD sing N N 263 MET CG HG2 sing N N 264 MET CG HG3 sing N N 265 MET SD CE sing N N 266 MET CE HE1 sing N N 267 MET CE HE2 sing N N 268 MET CE HE3 sing N N 269 MET OXT HXT sing N N 270 PHE N CA sing N N 271 PHE N H sing N N 272 PHE N H2 sing N N 273 PHE CA C sing N N 274 PHE CA CB sing N N 275 PHE CA HA sing N N 276 PHE C O doub N N 277 PHE C OXT sing N N 278 PHE CB CG sing N N 279 PHE CB HB2 sing N N 280 PHE CB HB3 sing N N 281 PHE CG CD1 doub Y N 282 PHE CG CD2 sing Y N 283 PHE CD1 CE1 sing Y N 284 PHE CD1 HD1 sing N N 285 PHE CD2 CE2 doub Y N 286 PHE CD2 HD2 sing N N 287 PHE CE1 CZ doub Y N 288 PHE CE1 HE1 sing N N 289 PHE CE2 CZ sing Y N 290 PHE CE2 HE2 sing N N 291 PHE CZ HZ sing N N 292 PHE OXT HXT sing N N 293 PRO N CA sing N N 294 PRO N CD sing N N 295 PRO N H sing N N 296 PRO CA C sing N N 297 PRO CA CB sing N N 298 PRO CA HA sing N N 299 PRO C O doub N N 300 PRO C OXT sing N N 301 PRO CB CG sing N N 302 PRO CB HB2 sing N N 303 PRO CB HB3 sing N N 304 PRO CG CD sing N N 305 PRO CG HG2 sing N N 306 PRO CG HG3 sing N N 307 PRO CD HD2 sing N N 308 PRO CD HD3 sing N N 309 PRO OXT HXT sing N N 310 SER N CA sing N N 311 SER N H sing N N 312 SER N H2 sing N N 313 SER CA C sing N N 314 SER CA CB sing N N 315 SER CA HA sing N N 316 SER C O doub N N 317 SER C OXT sing N N 318 SER CB OG sing N N 319 SER CB HB2 sing N N 320 SER CB HB3 sing N N 321 SER OG HG sing N N 322 SER OXT HXT sing N N 323 THR N CA sing N N 324 THR N H sing N N 325 THR N H2 sing N N 326 THR CA C sing N N 327 THR CA CB sing N N 328 THR CA HA sing N N 329 THR C O doub N N 330 THR C OXT sing N N 331 THR CB OG1 sing N N 332 THR CB CG2 sing N N 333 THR CB HB sing N N 334 THR OG1 HG1 sing N N 335 THR CG2 HG21 sing N N 336 THR CG2 HG22 sing N N 337 THR CG2 HG23 sing N N 338 THR OXT HXT sing N N 339 TRP N CA sing N N 340 TRP N H sing N N 341 TRP N H2 sing N N 342 TRP CA C sing N N 343 TRP CA CB sing N N 344 TRP CA HA sing N N 345 TRP C O doub N N 346 TRP C OXT sing N N 347 TRP CB CG sing N N 348 TRP CB HB2 sing N N 349 TRP CB HB3 sing N N 350 TRP CG CD1 doub Y N 351 TRP CG CD2 sing Y N 352 TRP CD1 NE1 sing Y N 353 TRP CD1 HD1 sing N N 354 TRP CD2 CE2 doub Y N 355 TRP CD2 CE3 sing Y N 356 TRP NE1 CE2 sing Y N 357 TRP NE1 HE1 sing N N 358 TRP CE2 CZ2 sing Y N 359 TRP CE3 CZ3 doub Y N 360 TRP CE3 HE3 sing N N 361 TRP CZ2 CH2 doub Y N 362 TRP CZ2 HZ2 sing N N 363 TRP CZ3 CH2 sing Y N 364 TRP CZ3 HZ3 sing N N 365 TRP CH2 HH2 sing N N 366 TRP OXT HXT sing N N 367 TYR N CA sing N N 368 TYR N H sing N N 369 TYR N H2 sing N N 370 TYR CA C sing N N 371 TYR CA CB sing N N 372 TYR CA HA sing N N 373 TYR C O doub N N 374 TYR C OXT sing N N 375 TYR CB CG sing N N 376 TYR CB HB2 sing N N 377 TYR CB HB3 sing N N 378 TYR CG CD1 doub Y N 379 TYR CG CD2 sing Y N 380 TYR CD1 CE1 sing Y N 381 TYR CD1 HD1 sing N N 382 TYR CD2 CE2 doub Y N 383 TYR CD2 HD2 sing N N 384 TYR CE1 CZ doub Y N 385 TYR CE1 HE1 sing N N 386 TYR CE2 CZ sing Y N 387 TYR CE2 HE2 sing N N 388 TYR CZ OH sing N N 389 TYR OH HH sing N N 390 TYR OXT HXT sing N N 391 VAL N CA sing N N 392 VAL N H sing N N 393 VAL N H2 sing N N 394 VAL CA C sing N N 395 VAL CA CB sing N N 396 VAL CA HA sing N N 397 VAL C O doub N N 398 VAL C OXT sing N N 399 VAL CB CG1 sing N N 400 VAL CB CG2 sing N N 401 VAL CB HB sing N N 402 VAL CG1 HG11 sing N N 403 VAL CG1 HG12 sing N N 404 VAL CG1 HG13 sing N N 405 VAL CG2 HG21 sing N N 406 VAL CG2 HG22 sing N N 407 VAL CG2 HG23 sing N N 408 VAL OXT HXT sing N N 409 # _pdbx_audit_support.funding_organization 'National Science Foundation (NSF, United States)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number CHE-2204225 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7rei _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9DY4 _atom_sites.fract_transf_matrix[1][1] 0.017793 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010507 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008489 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE N O S # loop_ #