data_9EEY # _entry.id 9EEY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.410 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9EEY pdb_00009eey 10.2210/pdb9eey/pdb WWPDB D_1000279583 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2024-12-11 ? 2 'Structure model' 1 1 2025-03-12 ? 3 'Structure model' 1 2 2025-05-07 ? 4 'Structure model' 1 3 2026-02-04 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_related_exp_data_set 4 4 'Structure model' citation 5 4 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.year' 2 2 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9EEY _pdbx_database_status.recvd_initial_deposition_date 2024-11-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 5 _pdbx_contact_author.email dkeedy@gc.cuny.edu _pdbx_contact_author.name_first Daniel _pdbx_contact_author.name_last Keedy _pdbx_contact_author.name_mi A. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-9184-7586 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Guerrero, L.' 1 0000-0003-1742-577X 'Ebrahim, A.' 2 0000-0003-2661-381X 'Riley, B.T.' 3 0000-0003-2176-0503 'Keedy, D.A.' 4 0000-0002-9184-7586 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_patent _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary Proteins PSFGEY 0867 1097-0134 ? ? 93 ? 2112 2127 'Three STEPs Forward: A Trio of Unexpected Structures of PTPN5.' 2025 ? 10.1002/prot.70013 40616465 ? ? ? ? ? ? ? ? ? US ? ? 1 Biorxiv ? ? 2692-8205 ? ? ? ? ? ? 'Three STEPs forward: A trio of unexpected structures of PTPN5.' 2025 ? 10.1101/2024.11.20.624168 39605455 ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Guerrero, L.' 1 0000-0003-1742-577X primary 'Ebrahim, A.' 2 0000-0003-2661-381X primary 'Riley, B.T.' 3 0000-0003-2176-0503 primary 'Kim, S.H.' 4 0009-0002-7125-1280 primary 'Bishop, A.C.' 5 0000-0001-8394-280X primary 'Wu, J.' 6 0009-0004-5987-886X primary 'Han, Y.N.' 7 0000-0001-6264-9604 primary 'Tautz, L.' 8 0000-0002-4075-6238 primary 'Keedy, D.A.' 9 0000-0002-9184-7586 1 'Guerrero, L.' 10 ? 1 'Ebrahim, A.' 11 ? 1 'Riley, B.T.' 12 ? 1 'Kim, S.H.' 13 ? 1 'Bishop, A.C.' 14 ? 1 'Wu, J.' 15 ? 1 'Han, Y.N.' 16 ? 1 'Tautz, L.' 17 ? 1 'Keedy, D.A.' 18 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tyrosine-protein phosphatase non-receptor type 5' 35204.844 1 3.1.3.48 ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 3 water nat water 18.015 62 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Neural-specific protein-tyrosine phosphatase,Striatum-enriched protein-tyrosine phosphatase,STEP' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHSSGVDLGTENLYFQSMSRVLQAEELHEKALDPFLLQAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSR VCLTSPDPDDPLSSYINANYIRGYGGEEKVYIATQGPIVSTVADFWRMVWQEHTPIIVMITNIEEMNEKCTEYWPEEQVA YDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCAPIIVHCSA GIGRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLYEKQLSHQS ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHSSGVDLGTENLYFQSMSRVLQAEELHEKALDPFLLQAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSR VCLTSPDPDDPLSSYINANYIRGYGGEEKVYIATQGPIVSTVADFWRMVWQEHTPIIVMITNIEEMNEKCTEYWPEEQVA YDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCAPIIVHCSA GIGRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLYEKQLSHQS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 SER n 1 9 SER n 1 10 GLY n 1 11 VAL n 1 12 ASP n 1 13 LEU n 1 14 GLY n 1 15 THR n 1 16 GLU n 1 17 ASN n 1 18 LEU n 1 19 TYR n 1 20 PHE n 1 21 GLN n 1 22 SER n 1 23 MET n 1 24 SER n 1 25 ARG n 1 26 VAL n 1 27 LEU n 1 28 GLN n 1 29 ALA n 1 30 GLU n 1 31 GLU n 1 32 LEU n 1 33 HIS n 1 34 GLU n 1 35 LYS n 1 36 ALA n 1 37 LEU n 1 38 ASP n 1 39 PRO n 1 40 PHE n 1 41 LEU n 1 42 LEU n 1 43 GLN n 1 44 ALA n 1 45 GLU n 1 46 PHE n 1 47 PHE n 1 48 GLU n 1 49 ILE n 1 50 PRO n 1 51 MET n 1 52 ASN n 1 53 PHE n 1 54 VAL n 1 55 ASP n 1 56 PRO n 1 57 LYS n 1 58 GLU n 1 59 TYR n 1 60 ASP n 1 61 ILE n 1 62 PRO n 1 63 GLY n 1 64 LEU n 1 65 VAL n 1 66 ARG n 1 67 LYS n 1 68 ASN n 1 69 ARG n 1 70 TYR n 1 71 LYS n 1 72 THR n 1 73 ILE n 1 74 LEU n 1 75 PRO n 1 76 ASN n 1 77 PRO n 1 78 HIS n 1 79 SER n 1 80 ARG n 1 81 VAL n 1 82 CYS n 1 83 LEU n 1 84 THR n 1 85 SER n 1 86 PRO n 1 87 ASP n 1 88 PRO n 1 89 ASP n 1 90 ASP n 1 91 PRO n 1 92 LEU n 1 93 SER n 1 94 SER n 1 95 TYR n 1 96 ILE n 1 97 ASN n 1 98 ALA n 1 99 ASN n 1 100 TYR n 1 101 ILE n 1 102 ARG n 1 103 GLY n 1 104 TYR n 1 105 GLY n 1 106 GLY n 1 107 GLU n 1 108 GLU n 1 109 LYS n 1 110 VAL n 1 111 TYR n 1 112 ILE n 1 113 ALA n 1 114 THR n 1 115 GLN n 1 116 GLY n 1 117 PRO n 1 118 ILE n 1 119 VAL n 1 120 SER n 1 121 THR n 1 122 VAL n 1 123 ALA n 1 124 ASP n 1 125 PHE n 1 126 TRP n 1 127 ARG n 1 128 MET n 1 129 VAL n 1 130 TRP n 1 131 GLN n 1 132 GLU n 1 133 HIS n 1 134 THR n 1 135 PRO n 1 136 ILE n 1 137 ILE n 1 138 VAL n 1 139 MET n 1 140 ILE n 1 141 THR n 1 142 ASN n 1 143 ILE n 1 144 GLU n 1 145 GLU n 1 146 MET n 1 147 ASN n 1 148 GLU n 1 149 LYS n 1 150 CYS n 1 151 THR n 1 152 GLU n 1 153 TYR n 1 154 TRP n 1 155 PRO n 1 156 GLU n 1 157 GLU n 1 158 GLN n 1 159 VAL n 1 160 ALA n 1 161 TYR n 1 162 ASP n 1 163 GLY n 1 164 VAL n 1 165 GLU n 1 166 ILE n 1 167 THR n 1 168 VAL n 1 169 GLN n 1 170 LYS n 1 171 VAL n 1 172 ILE n 1 173 HIS n 1 174 THR n 1 175 GLU n 1 176 ASP n 1 177 TYR n 1 178 ARG n 1 179 LEU n 1 180 ARG n 1 181 LEU n 1 182 ILE n 1 183 SER n 1 184 LEU n 1 185 LYS n 1 186 SER n 1 187 GLY n 1 188 THR n 1 189 GLU n 1 190 GLU n 1 191 ARG n 1 192 GLY n 1 193 LEU n 1 194 LYS n 1 195 HIS n 1 196 TYR n 1 197 TRP n 1 198 PHE n 1 199 THR n 1 200 SER n 1 201 TRP n 1 202 PRO n 1 203 ASP n 1 204 GLN n 1 205 LYS n 1 206 THR n 1 207 PRO n 1 208 ASP n 1 209 ARG n 1 210 ALA n 1 211 PRO n 1 212 PRO n 1 213 LEU n 1 214 LEU n 1 215 HIS n 1 216 LEU n 1 217 VAL n 1 218 ARG n 1 219 GLU n 1 220 VAL n 1 221 GLU n 1 222 GLU n 1 223 ALA n 1 224 ALA n 1 225 GLN n 1 226 GLN n 1 227 GLU n 1 228 GLY n 1 229 PRO n 1 230 HIS n 1 231 CYS n 1 232 ALA n 1 233 PRO n 1 234 ILE n 1 235 ILE n 1 236 VAL n 1 237 HIS n 1 238 CYS n 1 239 SER n 1 240 ALA n 1 241 GLY n 1 242 ILE n 1 243 GLY n 1 244 ARG n 1 245 THR n 1 246 GLY n 1 247 CYS n 1 248 PHE n 1 249 ILE n 1 250 ALA n 1 251 THR n 1 252 SER n 1 253 ILE n 1 254 CYS n 1 255 CYS n 1 256 GLN n 1 257 GLN n 1 258 LEU n 1 259 ARG n 1 260 GLN n 1 261 GLU n 1 262 GLY n 1 263 VAL n 1 264 VAL n 1 265 ASP n 1 266 ILE n 1 267 LEU n 1 268 LYS n 1 269 THR n 1 270 THR n 1 271 CYS n 1 272 GLN n 1 273 LEU n 1 274 ARG n 1 275 GLN n 1 276 ASP n 1 277 ARG n 1 278 GLY n 1 279 GLY n 1 280 MET n 1 281 ILE n 1 282 GLN n 1 283 THR n 1 284 CYS n 1 285 GLU n 1 286 GLN n 1 287 TYR n 1 288 GLN n 1 289 PHE n 1 290 VAL n 1 291 HIS n 1 292 HIS n 1 293 VAL n 1 294 MET n 1 295 SER n 1 296 LEU n 1 297 TYR n 1 298 GLU n 1 299 LYS n 1 300 GLN n 1 301 LEU n 1 302 SER n 1 303 HIS n 1 304 GLN n 1 305 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 305 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PTPN5 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 235 ? ? ? A . n A 1 2 HIS 2 236 ? ? ? A . n A 1 3 HIS 3 237 ? ? ? A . n A 1 4 HIS 4 238 ? ? ? A . n A 1 5 HIS 5 239 ? ? ? A . n A 1 6 HIS 6 240 ? ? ? A . n A 1 7 HIS 7 241 ? ? ? A . n A 1 8 SER 8 242 ? ? ? A . n A 1 9 SER 9 243 ? ? ? A . n A 1 10 GLY 10 244 ? ? ? A . n A 1 11 VAL 11 245 ? ? ? A . n A 1 12 ASP 12 246 ? ? ? A . n A 1 13 LEU 13 247 ? ? ? A . n A 1 14 GLY 14 248 ? ? ? A . n A 1 15 THR 15 249 ? ? ? A . n A 1 16 GLU 16 250 ? ? ? A . n A 1 17 ASN 17 251 ? ? ? A . n A 1 18 LEU 18 252 ? ? ? A . n A 1 19 TYR 19 253 ? ? ? A . n A 1 20 PHE 20 254 ? ? ? A . n A 1 21 GLN 21 255 ? ? ? A . n A 1 22 SER 22 256 ? ? ? A . n A 1 23 MET 23 257 257 MET MET A . n A 1 24 SER 24 258 258 SER SER A . n A 1 25 ARG 25 259 259 ARG ARG A . n A 1 26 VAL 26 260 260 VAL VAL A . n A 1 27 LEU 27 261 261 LEU LEU A . n A 1 28 GLN 28 262 262 GLN GLN A . n A 1 29 ALA 29 263 263 ALA ALA A . n A 1 30 GLU 30 264 264 GLU GLU A . n A 1 31 GLU 31 265 265 GLU GLU A . n A 1 32 LEU 32 266 266 LEU LEU A . n A 1 33 HIS 33 267 267 HIS HIS A . n A 1 34 GLU 34 268 268 GLU GLU A . n A 1 35 LYS 35 269 269 LYS LYS A . n A 1 36 ALA 36 270 270 ALA ALA A . n A 1 37 LEU 37 271 271 LEU LEU A . n A 1 38 ASP 38 272 272 ASP ASP A . n A 1 39 PRO 39 273 273 PRO PRO A . n A 1 40 PHE 40 274 274 PHE PHE A . n A 1 41 LEU 41 275 275 LEU LEU A . n A 1 42 LEU 42 276 276 LEU LEU A . n A 1 43 GLN 43 277 277 GLN GLN A . n A 1 44 ALA 44 278 278 ALA ALA A . n A 1 45 GLU 45 279 279 GLU GLU A . n A 1 46 PHE 46 280 280 PHE PHE A . n A 1 47 PHE 47 281 281 PHE PHE A . n A 1 48 GLU 48 282 282 GLU GLU A . n A 1 49 ILE 49 283 283 ILE ILE A . n A 1 50 PRO 50 284 284 PRO PRO A . n A 1 51 MET 51 285 285 MET MET A . n A 1 52 ASN 52 286 286 ASN ASN A . n A 1 53 PHE 53 287 287 PHE PHE A . n A 1 54 VAL 54 288 288 VAL VAL A . n A 1 55 ASP 55 289 289 ASP ASP A . n A 1 56 PRO 56 290 290 PRO PRO A . n A 1 57 LYS 57 291 291 LYS LYS A . n A 1 58 GLU 58 292 292 GLU GLU A . n A 1 59 TYR 59 293 293 TYR TYR A . n A 1 60 ASP 60 294 294 ASP ASP A . n A 1 61 ILE 61 295 295 ILE ILE A . n A 1 62 PRO 62 296 296 PRO PRO A . n A 1 63 GLY 63 297 297 GLY GLY A . n A 1 64 LEU 64 298 298 LEU LEU A . n A 1 65 VAL 65 299 299 VAL VAL A . n A 1 66 ARG 66 300 300 ARG ARG A . n A 1 67 LYS 67 301 301 LYS LYS A . n A 1 68 ASN 68 302 302 ASN ASN A . n A 1 69 ARG 69 303 303 ARG ARG A . n A 1 70 TYR 70 304 304 TYR TYR A . n A 1 71 LYS 71 305 305 LYS LYS A . n A 1 72 THR 72 306 306 THR THR A . n A 1 73 ILE 73 307 307 ILE ILE A . n A 1 74 LEU 74 308 308 LEU LEU A . n A 1 75 PRO 75 309 309 PRO PRO A . n A 1 76 ASN 76 310 310 ASN ASN A . n A 1 77 PRO 77 311 311 PRO PRO A . n A 1 78 HIS 78 312 312 HIS HIS A . n A 1 79 SER 79 313 313 SER SER A . n A 1 80 ARG 80 314 314 ARG ARG A . n A 1 81 VAL 81 315 315 VAL VAL A . n A 1 82 CYS 82 316 316 CYS CYS A . n A 1 83 LEU 83 317 317 LEU LEU A . n A 1 84 THR 84 318 318 THR THR A . n A 1 85 SER 85 319 ? ? ? A . n A 1 86 PRO 86 320 ? ? ? A . n A 1 87 ASP 87 321 ? ? ? A . n A 1 88 PRO 88 322 ? ? ? A . n A 1 89 ASP 89 323 ? ? ? A . n A 1 90 ASP 90 324 324 ASP ASP A . n A 1 91 PRO 91 325 325 PRO PRO A . n A 1 92 LEU 92 326 326 LEU LEU A . n A 1 93 SER 93 327 327 SER SER A . n A 1 94 SER 94 328 328 SER SER A . n A 1 95 TYR 95 329 329 TYR TYR A . n A 1 96 ILE 96 330 330 ILE ILE A . n A 1 97 ASN 97 331 331 ASN ASN A . n A 1 98 ALA 98 332 332 ALA ALA A . n A 1 99 ASN 99 333 333 ASN ASN A . n A 1 100 TYR 100 334 334 TYR TYR A . n A 1 101 ILE 101 335 335 ILE ILE A . n A 1 102 ARG 102 336 336 ARG ARG A . n A 1 103 GLY 103 337 337 GLY GLY A . n A 1 104 TYR 104 338 338 TYR TYR A . n A 1 105 GLY 105 339 339 GLY GLY A . n A 1 106 GLY 106 340 340 GLY GLY A . n A 1 107 GLU 107 341 341 GLU GLU A . n A 1 108 GLU 108 342 342 GLU GLU A . n A 1 109 LYS 109 343 343 LYS LYS A . n A 1 110 VAL 110 344 344 VAL VAL A . n A 1 111 TYR 111 345 345 TYR TYR A . n A 1 112 ILE 112 346 346 ILE ILE A . n A 1 113 ALA 113 347 347 ALA ALA A . n A 1 114 THR 114 348 348 THR THR A . n A 1 115 GLN 115 349 349 GLN GLN A . n A 1 116 GLY 116 350 350 GLY GLY A . n A 1 117 PRO 117 351 351 PRO PRO A . n A 1 118 ILE 118 352 352 ILE ILE A . n A 1 119 VAL 119 353 353 VAL VAL A . n A 1 120 SER 120 354 354 SER SER A . n A 1 121 THR 121 355 355 THR THR A . n A 1 122 VAL 122 356 356 VAL VAL A . n A 1 123 ALA 123 357 357 ALA ALA A . n A 1 124 ASP 124 358 358 ASP ASP A . n A 1 125 PHE 125 359 359 PHE PHE A . n A 1 126 TRP 126 360 360 TRP TRP A . n A 1 127 ARG 127 361 361 ARG ARG A . n A 1 128 MET 128 362 362 MET MET A . n A 1 129 VAL 129 363 363 VAL VAL A . n A 1 130 TRP 130 364 364 TRP TRP A . n A 1 131 GLN 131 365 365 GLN GLN A . n A 1 132 GLU 132 366 366 GLU GLU A . n A 1 133 HIS 133 367 367 HIS HIS A . n A 1 134 THR 134 368 368 THR THR A . n A 1 135 PRO 135 369 369 PRO PRO A . n A 1 136 ILE 136 370 370 ILE ILE A . n A 1 137 ILE 137 371 371 ILE ILE A . n A 1 138 VAL 138 372 372 VAL VAL A . n A 1 139 MET 139 373 373 MET MET A . n A 1 140 ILE 140 374 374 ILE ILE A . n A 1 141 THR 141 375 375 THR THR A . n A 1 142 ASN 142 376 376 ASN ASN A . n A 1 143 ILE 143 377 377 ILE ILE A . n A 1 144 GLU 144 378 378 GLU GLU A . n A 1 145 GLU 145 379 379 GLU GLU A . n A 1 146 MET 146 380 ? ? ? A . n A 1 147 ASN 147 381 ? ? ? A . n A 1 148 GLU 148 382 ? ? ? A . n A 1 149 LYS 149 383 ? ? ? A . n A 1 150 CYS 150 384 384 CYS CYS A . n A 1 151 THR 151 385 385 THR THR A . n A 1 152 GLU 152 386 386 GLU GLU A . n A 1 153 TYR 153 387 387 TYR TYR A . n A 1 154 TRP 154 388 388 TRP TRP A . n A 1 155 PRO 155 389 389 PRO PRO A . n A 1 156 GLU 156 390 390 GLU GLU A . n A 1 157 GLU 157 391 391 GLU GLU A . n A 1 158 GLN 158 392 392 GLN GLN A . n A 1 159 VAL 159 393 393 VAL VAL A . n A 1 160 ALA 160 394 394 ALA ALA A . n A 1 161 TYR 161 395 395 TYR TYR A . n A 1 162 ASP 162 396 396 ASP ASP A . n A 1 163 GLY 163 397 397 GLY GLY A . n A 1 164 VAL 164 398 398 VAL VAL A . n A 1 165 GLU 165 399 399 GLU GLU A . n A 1 166 ILE 166 400 400 ILE ILE A . n A 1 167 THR 167 401 401 THR THR A . n A 1 168 VAL 168 402 402 VAL VAL A . n A 1 169 GLN 169 403 403 GLN GLN A . n A 1 170 LYS 170 404 404 LYS LYS A . n A 1 171 VAL 171 405 405 VAL VAL A . n A 1 172 ILE 172 406 406 ILE ILE A . n A 1 173 HIS 173 407 407 HIS HIS A . n A 1 174 THR 174 408 408 THR THR A . n A 1 175 GLU 175 409 409 GLU GLU A . n A 1 176 ASP 176 410 410 ASP ASP A . n A 1 177 TYR 177 411 411 TYR TYR A . n A 1 178 ARG 178 412 412 ARG ARG A . n A 1 179 LEU 179 413 413 LEU LEU A . n A 1 180 ARG 180 414 414 ARG ARG A . n A 1 181 LEU 181 415 415 LEU LEU A . n A 1 182 ILE 182 416 416 ILE ILE A . n A 1 183 SER 183 417 417 SER SER A . n A 1 184 LEU 184 418 418 LEU LEU A . n A 1 185 LYS 185 419 419 LYS LYS A . n A 1 186 SER 186 420 420 SER SER A . n A 1 187 GLY 187 421 421 GLY GLY A . n A 1 188 THR 188 422 422 THR THR A . n A 1 189 GLU 189 423 423 GLU GLU A . n A 1 190 GLU 190 424 424 GLU GLU A . n A 1 191 ARG 191 425 425 ARG ARG A . n A 1 192 GLY 192 426 426 GLY GLY A . n A 1 193 LEU 193 427 427 LEU LEU A . n A 1 194 LYS 194 428 428 LYS LYS A . n A 1 195 HIS 195 429 429 HIS HIS A . n A 1 196 TYR 196 430 430 TYR TYR A . n A 1 197 TRP 197 431 431 TRP TRP A . n A 1 198 PHE 198 432 432 PHE PHE A . n A 1 199 THR 199 433 433 THR THR A . n A 1 200 SER 200 434 434 SER SER A . n A 1 201 TRP 201 435 435 TRP TRP A . n A 1 202 PRO 202 436 436 PRO PRO A . n A 1 203 ASP 203 437 437 ASP ASP A . n A 1 204 GLN 204 438 438 GLN GLN A . n A 1 205 LYS 205 439 439 LYS LYS A . n A 1 206 THR 206 440 440 THR THR A . n A 1 207 PRO 207 441 441 PRO PRO A . n A 1 208 ASP 208 442 442 ASP ASP A . n A 1 209 ARG 209 443 443 ARG ARG A . n A 1 210 ALA 210 444 444 ALA ALA A . n A 1 211 PRO 211 445 445 PRO PRO A . n A 1 212 PRO 212 446 446 PRO PRO A . n A 1 213 LEU 213 447 447 LEU LEU A . n A 1 214 LEU 214 448 448 LEU LEU A . n A 1 215 HIS 215 449 449 HIS HIS A . n A 1 216 LEU 216 450 450 LEU LEU A . n A 1 217 VAL 217 451 451 VAL VAL A . n A 1 218 ARG 218 452 452 ARG ARG A . n A 1 219 GLU 219 453 453 GLU GLU A . n A 1 220 VAL 220 454 454 VAL VAL A . n A 1 221 GLU 221 455 455 GLU GLU A . n A 1 222 GLU 222 456 456 GLU GLU A . n A 1 223 ALA 223 457 457 ALA ALA A . n A 1 224 ALA 224 458 458 ALA ALA A . n A 1 225 GLN 225 459 459 GLN GLN A . n A 1 226 GLN 226 460 460 GLN GLN A . n A 1 227 GLU 227 461 461 GLU GLU A . n A 1 228 GLY 228 462 462 GLY GLY A . n A 1 229 PRO 229 463 463 PRO PRO A . n A 1 230 HIS 230 464 464 HIS HIS A . n A 1 231 CYS 231 465 465 CYS CYS A . n A 1 232 ALA 232 466 466 ALA ALA A . n A 1 233 PRO 233 467 467 PRO PRO A . n A 1 234 ILE 234 468 468 ILE ILE A . n A 1 235 ILE 235 469 469 ILE ILE A . n A 1 236 VAL 236 470 470 VAL VAL A . n A 1 237 HIS 237 471 471 HIS HIS A . n A 1 238 CYS 238 472 472 CYS CYS A . n A 1 239 SER 239 473 473 SER SER A . n A 1 240 ALA 240 474 474 ALA ALA A . n A 1 241 GLY 241 475 475 GLY GLY A . n A 1 242 ILE 242 476 476 ILE ILE A . n A 1 243 GLY 243 477 477 GLY GLY A . n A 1 244 ARG 244 478 478 ARG ARG A . n A 1 245 THR 245 479 479 THR THR A . n A 1 246 GLY 246 480 480 GLY GLY A . n A 1 247 CYS 247 481 481 CYS CYS A . n A 1 248 PHE 248 482 482 PHE PHE A . n A 1 249 ILE 249 483 483 ILE ILE A . n A 1 250 ALA 250 484 484 ALA ALA A . n A 1 251 THR 251 485 485 THR THR A . n A 1 252 SER 252 486 486 SER SER A . n A 1 253 ILE 253 487 487 ILE ILE A . n A 1 254 CYS 254 488 488 CYS CYS A . n A 1 255 CYS 255 489 489 CYS CYS A . n A 1 256 GLN 256 490 490 GLN GLN A . n A 1 257 GLN 257 491 491 GLN GLN A . n A 1 258 LEU 258 492 492 LEU LEU A . n A 1 259 ARG 259 493 493 ARG ARG A . n A 1 260 GLN 260 494 494 GLN GLN A . n A 1 261 GLU 261 495 495 GLU GLU A . n A 1 262 GLY 262 496 496 GLY GLY A . n A 1 263 VAL 263 497 497 VAL VAL A . n A 1 264 VAL 264 498 498 VAL VAL A . n A 1 265 ASP 265 499 499 ASP ASP A . n A 1 266 ILE 266 500 500 ILE ILE A . n A 1 267 LEU 267 501 501 LEU LEU A . n A 1 268 LYS 268 502 502 LYS LYS A . n A 1 269 THR 269 503 503 THR THR A . n A 1 270 THR 270 504 504 THR THR A . n A 1 271 CYS 271 505 505 CYS CYS A . n A 1 272 GLN 272 506 506 GLN GLN A . n A 1 273 LEU 273 507 507 LEU LEU A . n A 1 274 ARG 274 508 508 ARG ARG A . n A 1 275 GLN 275 509 509 GLN GLN A . n A 1 276 ASP 276 510 510 ASP ASP A . n A 1 277 ARG 277 511 511 ARG ARG A . n A 1 278 GLY 278 512 512 GLY GLY A . n A 1 279 GLY 279 513 513 GLY GLY A . n A 1 280 MET 280 514 514 MET MET A . n A 1 281 ILE 281 515 515 ILE ILE A . n A 1 282 GLN 282 516 516 GLN GLN A . n A 1 283 THR 283 517 517 THR THR A . n A 1 284 CYS 284 518 518 CYS CYS A . n A 1 285 GLU 285 519 519 GLU GLU A . n A 1 286 GLN 286 520 520 GLN GLN A . n A 1 287 TYR 287 521 521 TYR TYR A . n A 1 288 GLN 288 522 522 GLN GLN A . n A 1 289 PHE 289 523 523 PHE PHE A . n A 1 290 VAL 290 524 524 VAL VAL A . n A 1 291 HIS 291 525 525 HIS HIS A . n A 1 292 HIS 292 526 526 HIS HIS A . n A 1 293 VAL 293 527 527 VAL VAL A . n A 1 294 MET 294 528 528 MET MET A . n A 1 295 SER 295 529 529 SER SER A . n A 1 296 LEU 296 530 530 LEU LEU A . n A 1 297 TYR 297 531 531 TYR TYR A . n A 1 298 GLU 298 532 532 GLU GLU A . n A 1 299 LYS 299 533 533 LYS LYS A . n A 1 300 GLN 300 534 534 GLN GLN A . n A 1 301 LEU 301 535 535 LEU LEU A . n A 1 302 SER 302 536 536 SER SER A . n A 1 303 HIS 303 537 537 HIS HIS A . n A 1 304 GLN 304 538 ? ? ? A . n A 1 305 SER 305 539 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 601 1 SO4 SO4 A . C 2 SO4 1 602 2 SO4 SO4 A . D 3 HOH 1 701 137 HOH HOH A . D 3 HOH 2 702 16 HOH HOH A . D 3 HOH 3 703 128 HOH HOH A . D 3 HOH 4 704 130 HOH HOH A . D 3 HOH 5 705 114 HOH HOH A . D 3 HOH 6 706 14 HOH HOH A . D 3 HOH 7 707 107 HOH HOH A . D 3 HOH 8 708 70 HOH HOH A . D 3 HOH 9 709 111 HOH HOH A . D 3 HOH 10 710 136 HOH HOH A . D 3 HOH 11 711 120 HOH HOH A . D 3 HOH 12 712 61 HOH HOH A . D 3 HOH 13 713 122 HOH HOH A . D 3 HOH 14 714 133 HOH HOH A . D 3 HOH 15 715 138 HOH HOH A . D 3 HOH 16 716 20 HOH HOH A . D 3 HOH 17 717 123 HOH HOH A . D 3 HOH 18 718 132 HOH HOH A . D 3 HOH 19 719 21 HOH HOH A . D 3 HOH 20 720 6 HOH HOH A . D 3 HOH 21 721 4 HOH HOH A . D 3 HOH 22 722 13 HOH HOH A . D 3 HOH 23 723 5 HOH HOH A . D 3 HOH 24 724 150 HOH HOH A . D 3 HOH 25 725 32 HOH HOH A . D 3 HOH 26 726 25 HOH HOH A . D 3 HOH 27 727 140 HOH HOH A . D 3 HOH 28 728 106 HOH HOH A . D 3 HOH 29 729 12 HOH HOH A . D 3 HOH 30 730 129 HOH HOH A . D 3 HOH 31 731 10 HOH HOH A . D 3 HOH 32 732 33 HOH HOH A . D 3 HOH 33 733 135 HOH HOH A . D 3 HOH 34 734 131 HOH HOH A . D 3 HOH 35 735 109 HOH HOH A . D 3 HOH 36 736 43 HOH HOH A . D 3 HOH 37 737 7 HOH HOH A . D 3 HOH 38 738 3 HOH HOH A . D 3 HOH 39 739 31 HOH HOH A . D 3 HOH 40 740 17 HOH HOH A . D 3 HOH 41 741 19 HOH HOH A . D 3 HOH 42 742 37 HOH HOH A . D 3 HOH 43 743 39 HOH HOH A . D 3 HOH 44 744 9 HOH HOH A . D 3 HOH 45 745 41 HOH HOH A . D 3 HOH 46 746 18 HOH HOH A . D 3 HOH 47 747 8 HOH HOH A . D 3 HOH 48 748 112 HOH HOH A . D 3 HOH 49 749 134 HOH HOH A . D 3 HOH 50 750 110 HOH HOH A . D 3 HOH 51 751 152 HOH HOH A . D 3 HOH 52 752 11 HOH HOH A . D 3 HOH 53 753 141 HOH HOH A . D 3 HOH 54 754 119 HOH HOH A . D 3 HOH 55 755 151 HOH HOH A . D 3 HOH 56 756 149 HOH HOH A . D 3 HOH 57 757 148 HOH HOH A . D 3 HOH 58 758 143 HOH HOH A . D 3 HOH 59 759 147 HOH HOH A . D 3 HOH 60 760 113 HOH HOH A . D 3 HOH 61 761 126 HOH HOH A . D 3 HOH 62 762 142 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? 3.7.1 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? 3.7.1-gfb34cbf01-release 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? '2.8.2 (svn 8393)' 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9EEY _cell.details ? _cell.formula_units_Z ? _cell.length_a 39.673 _cell.length_a_esd ? _cell.length_b 63.621 _cell.length_b_esd ? _cell.length_c 135.800 _cell.length_c_esd ? _cell.volume 342764.080 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9EEY _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall 'P 2ac 2ab' _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9EEY _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.64 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.36 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '30% PEG 3350, 0.2 M lithium sulfate, 0.1 M bis-tris pH 5.5' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 298.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-08-05 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.920105 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS-II BEAMLINE 17-ID-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.920105 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID-1 _diffrn_source.pdbx_synchrotron_site NSLS-II # _reflns.B_iso_Wilson_estimate 31.42 _reflns.entry_id 9EEY _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.75 _reflns.d_resolution_low 63.62 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 35607 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.164 _reflns.pdbx_Rpim_I_all 0.045 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.157 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.75 _reflns_shell.d_res_low 1.78 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.3 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1726 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 11.2 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 4.890 _reflns_shell.pdbx_Rpim_I_all 1.443 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.320 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 98.7 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 4.668 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 50.92 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9EEY _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.75 _refine.ls_d_res_low 57.61 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 35452 _refine.ls_number_reflns_R_free 1771 _refine.ls_number_reflns_R_work 33681 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.67 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2008 _refine.ls_R_factor_R_free 0.2377 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1988 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 25.7714 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2572 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.75 _refine_hist.d_res_low 57.61 _refine_hist.number_atoms_solvent 62 _refine_hist.number_atoms_total 2277 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2205 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0136 ? 2286 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.9988 ? 3106 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0646 ? 338 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0085 ? 400 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.0487 ? 854 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.75 1.80 . . 140 2504 98.44 . . . . 0.3806 . . . . . . . . . . . 0.3888 'X-RAY DIFFRACTION' 1.80 1.85 . . 113 2559 99.63 . . . . 0.3349 . . . . . . . . . . . 0.3114 'X-RAY DIFFRACTION' 1.85 1.91 . . 138 2541 99.30 . . . . 0.3655 . . . . . . . . . . . 0.4338 'X-RAY DIFFRACTION' 1.91 1.98 . . 129 2557 99.11 . . . . 0.2955 . . . . . . . . . . . 0.3531 'X-RAY DIFFRACTION' 1.98 2.06 . . 128 2539 99.85 . . . . 0.2359 . . . . . . . . . . . 0.2317 'X-RAY DIFFRACTION' 2.06 2.15 . . 140 2576 99.89 . . . . 0.2181 . . . . . . . . . . . 0.2892 'X-RAY DIFFRACTION' 2.15 2.26 . . 156 2550 99.78 . . . . 0.2165 . . . . . . . . . . . 0.2626 'X-RAY DIFFRACTION' 2.26 2.41 . . 150 2554 99.96 . . . . 0.2187 . . . . . . . . . . . 0.2388 'X-RAY DIFFRACTION' 2.41 2.59 . . 128 2611 99.96 . . . . 0.1830 . . . . . . . . . . . 0.2486 'X-RAY DIFFRACTION' 2.59 2.85 . . 140 2604 100.00 . . . . 0.1930 . . . . . . . . . . . 0.2274 'X-RAY DIFFRACTION' 2.85 3.27 . . 129 2626 99.89 . . . . 0.2053 . . . . . . . . . . . 0.2441 'X-RAY DIFFRACTION' 3.27 4.11 . . 137 2649 99.96 . . . . 0.1748 . . . . . . . . . . . 0.2076 'X-RAY DIFFRACTION' 4.11 57.61 . . 143 2811 99.97 . . . . 0.1759 . . . . . . . . . . . 0.2168 # _struct.entry_id 9EEY _struct.title 'STEP (PTPN5) with active-site disulfide bond and allosteric-site loop shift' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9EEY _struct_keywords.text 'STEP, PTPN5, allostery, disulfide, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PTN5_HUMAN _struct_ref.pdbx_db_accession P54829 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SRVLQAEELHEKALDPFLLQAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPLSSYINANYIRG YGGEEKVYIATQGPIVSTVADFWRMVWQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLIS LKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCAPIIVHCSAGIGRTGCFIATSICCQQLRQEGV VDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLYEKQLSHQS ; _struct_ref.pdbx_align_begin 282 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9EEY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 24 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 305 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P54829 _struct_ref_seq.db_align_beg 282 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 563 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 258 _struct_ref_seq.pdbx_auth_seq_align_end 539 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9EEY MET A 1 ? UNP P54829 ? ? 'initiating methionine' 235 1 1 9EEY HIS A 2 ? UNP P54829 ? ? 'expression tag' 236 2 1 9EEY HIS A 3 ? UNP P54829 ? ? 'expression tag' 237 3 1 9EEY HIS A 4 ? UNP P54829 ? ? 'expression tag' 238 4 1 9EEY HIS A 5 ? UNP P54829 ? ? 'expression tag' 239 5 1 9EEY HIS A 6 ? UNP P54829 ? ? 'expression tag' 240 6 1 9EEY HIS A 7 ? UNP P54829 ? ? 'expression tag' 241 7 1 9EEY SER A 8 ? UNP P54829 ? ? 'expression tag' 242 8 1 9EEY SER A 9 ? UNP P54829 ? ? 'expression tag' 243 9 1 9EEY GLY A 10 ? UNP P54829 ? ? 'expression tag' 244 10 1 9EEY VAL A 11 ? UNP P54829 ? ? 'expression tag' 245 11 1 9EEY ASP A 12 ? UNP P54829 ? ? 'expression tag' 246 12 1 9EEY LEU A 13 ? UNP P54829 ? ? 'expression tag' 247 13 1 9EEY GLY A 14 ? UNP P54829 ? ? 'expression tag' 248 14 1 9EEY THR A 15 ? UNP P54829 ? ? 'expression tag' 249 15 1 9EEY GLU A 16 ? UNP P54829 ? ? 'expression tag' 250 16 1 9EEY ASN A 17 ? UNP P54829 ? ? 'expression tag' 251 17 1 9EEY LEU A 18 ? UNP P54829 ? ? 'expression tag' 252 18 1 9EEY TYR A 19 ? UNP P54829 ? ? 'expression tag' 253 19 1 9EEY PHE A 20 ? UNP P54829 ? ? 'expression tag' 254 20 1 9EEY GLN A 21 ? UNP P54829 ? ? 'expression tag' 255 21 1 9EEY SER A 22 ? UNP P54829 ? ? 'expression tag' 256 22 1 9EEY MET A 23 ? UNP P54829 ? ? 'expression tag' 257 23 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLN A 28 ? LEU A 37 ? GLN A 262 LEU A 271 1 ? 10 HELX_P HELX_P2 AA2 ASP A 38 ? PHE A 47 ? ASP A 272 PHE A 281 1 ? 10 HELX_P HELX_P3 AA3 ASP A 55 ? TYR A 59 ? ASP A 289 TYR A 293 5 ? 5 HELX_P HELX_P4 AA4 GLY A 63 ? ASN A 68 ? GLY A 297 ASN A 302 5 ? 6 HELX_P HELX_P5 AA5 ASN A 76 ? ARG A 80 ? ASN A 310 ARG A 314 5 ? 5 HELX_P HELX_P6 AA6 GLY A 103 ? GLU A 107 ? GLY A 337 GLU A 341 5 ? 5 HELX_P HELX_P7 AA7 ILE A 118 ? SER A 120 ? ILE A 352 SER A 354 5 ? 3 HELX_P HELX_P8 AA8 THR A 121 ? HIS A 133 ? THR A 355 HIS A 367 1 ? 13 HELX_P HELX_P9 AA9 THR A 206 ? ASP A 208 ? THR A 440 ASP A 442 5 ? 3 HELX_P HELX_P10 AB1 ARG A 209 ? GLN A 226 ? ARG A 443 GLN A 460 1 ? 18 HELX_P HELX_P11 AB2 ILE A 242 ? GLY A 262 ? ILE A 476 GLY A 496 1 ? 21 HELX_P HELX_P12 AB3 ASP A 265 ? ARG A 277 ? ASP A 499 ARG A 511 1 ? 13 HELX_P HELX_P13 AB4 THR A 283 ? HIS A 303 ? THR A 517 HIS A 537 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 150 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 238 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 384 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 472 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.012 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 150 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 238 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 384 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 472 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 98 ? ILE A 101 ? ALA A 332 ILE A 335 AA1 2 TYR A 111 ? THR A 114 ? TYR A 345 THR A 348 AA1 3 ILE A 234 ? HIS A 237 ? ILE A 468 HIS A 471 AA1 4 ILE A 136 ? ILE A 140 ? ILE A 370 ILE A 374 AA1 5 GLU A 189 ? PHE A 198 ? GLU A 423 PHE A 432 AA1 6 TYR A 177 ? SER A 186 ? TYR A 411 SER A 420 AA1 7 VAL A 164 ? HIS A 173 ? VAL A 398 HIS A 407 AA1 8 GLN A 158 ? TYR A 161 ? GLN A 392 TYR A 395 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 101 ? N ILE A 335 O TYR A 111 ? O TYR A 345 AA1 2 3 N ILE A 112 ? N ILE A 346 O VAL A 236 ? O VAL A 470 AA1 3 4 O ILE A 235 ? O ILE A 469 N VAL A 138 ? N VAL A 372 AA1 4 5 N ILE A 137 ? N ILE A 371 O TYR A 196 ? O TYR A 430 AA1 5 6 O LEU A 193 ? O LEU A 427 N ILE A 182 ? N ILE A 416 AA1 6 7 O LEU A 179 ? O LEU A 413 N ILE A 172 ? N ILE A 406 AA1 7 8 O ILE A 166 ? O ILE A 400 N VAL A 159 ? N VAL A 393 # _pdbx_entry_details.entry_id 9EEY _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CB _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 CYS _pdbx_validate_rmsd_bond.auth_seq_id_1 472 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 SG _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 CYS _pdbx_validate_rmsd_bond.auth_seq_id_2 472 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.951 _pdbx_validate_rmsd_bond.bond_target_value 1.818 _pdbx_validate_rmsd_bond.bond_deviation 0.133 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.017 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 378 ? ? -59.67 -7.78 2 1 TYR A 387 ? ? -151.86 -2.46 3 1 CYS A 472 ? ? -134.71 -95.56 4 1 SER A 473 ? ? -101.29 -70.68 5 1 ILE A 476 ? ? -132.63 -35.19 6 1 ILE A 515 ? ? 69.81 93.60 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+1/2,-y+1/2,-z 3 -x,y+1/2,-z+1/2 4 -x+1/2,-y,z+1/2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 235 ? A MET 1 2 1 Y 1 A HIS 236 ? A HIS 2 3 1 Y 1 A HIS 237 ? A HIS 3 4 1 Y 1 A HIS 238 ? A HIS 4 5 1 Y 1 A HIS 239 ? A HIS 5 6 1 Y 1 A HIS 240 ? A HIS 6 7 1 Y 1 A HIS 241 ? A HIS 7 8 1 Y 1 A SER 242 ? A SER 8 9 1 Y 1 A SER 243 ? A SER 9 10 1 Y 1 A GLY 244 ? A GLY 10 11 1 Y 1 A VAL 245 ? A VAL 11 12 1 Y 1 A ASP 246 ? A ASP 12 13 1 Y 1 A LEU 247 ? A LEU 13 14 1 Y 1 A GLY 248 ? A GLY 14 15 1 Y 1 A THR 249 ? A THR 15 16 1 Y 1 A GLU 250 ? A GLU 16 17 1 Y 1 A ASN 251 ? A ASN 17 18 1 Y 1 A LEU 252 ? A LEU 18 19 1 Y 1 A TYR 253 ? A TYR 19 20 1 Y 1 A PHE 254 ? A PHE 20 21 1 Y 1 A GLN 255 ? A GLN 21 22 1 Y 1 A SER 256 ? A SER 22 23 1 Y 1 A SER 319 ? A SER 85 24 1 Y 1 A PRO 320 ? A PRO 86 25 1 Y 1 A ASP 321 ? A ASP 87 26 1 Y 1 A PRO 322 ? A PRO 88 27 1 Y 1 A ASP 323 ? A ASP 89 28 1 Y 1 A MET 380 ? A MET 146 29 1 Y 1 A ASN 381 ? A ASN 147 30 1 Y 1 A GLU 382 ? A GLU 148 31 1 Y 1 A LYS 383 ? A LYS 149 32 1 Y 1 A GLN 538 ? A GLN 304 33 1 Y 1 A SER 539 ? A SER 305 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 SO4 S S N N 304 SO4 O1 O N N 305 SO4 O2 O N N 306 SO4 O3 O N N 307 SO4 O4 O N N 308 THR N N N N 309 THR CA C N S 310 THR C C N N 311 THR O O N N 312 THR CB C N R 313 THR OG1 O N N 314 THR CG2 C N N 315 THR OXT O N N 316 THR H H N N 317 THR H2 H N N 318 THR HA H N N 319 THR HB H N N 320 THR HG1 H N N 321 THR HG21 H N N 322 THR HG22 H N N 323 THR HG23 H N N 324 THR HXT H N N 325 TRP N N N N 326 TRP CA C N S 327 TRP C C N N 328 TRP O O N N 329 TRP CB C N N 330 TRP CG C Y N 331 TRP CD1 C Y N 332 TRP CD2 C Y N 333 TRP NE1 N Y N 334 TRP CE2 C Y N 335 TRP CE3 C Y N 336 TRP CZ2 C Y N 337 TRP CZ3 C Y N 338 TRP CH2 C Y N 339 TRP OXT O N N 340 TRP H H N N 341 TRP H2 H N N 342 TRP HA H N N 343 TRP HB2 H N N 344 TRP HB3 H N N 345 TRP HD1 H N N 346 TRP HE1 H N N 347 TRP HE3 H N N 348 TRP HZ2 H N N 349 TRP HZ3 H N N 350 TRP HH2 H N N 351 TRP HXT H N N 352 TYR N N N N 353 TYR CA C N S 354 TYR C C N N 355 TYR O O N N 356 TYR CB C N N 357 TYR CG C Y N 358 TYR CD1 C Y N 359 TYR CD2 C Y N 360 TYR CE1 C Y N 361 TYR CE2 C Y N 362 TYR CZ C Y N 363 TYR OH O N N 364 TYR OXT O N N 365 TYR H H N N 366 TYR H2 H N N 367 TYR HA H N N 368 TYR HB2 H N N 369 TYR HB3 H N N 370 TYR HD1 H N N 371 TYR HD2 H N N 372 TYR HE1 H N N 373 TYR HE2 H N N 374 TYR HH H N N 375 TYR HXT H N N 376 VAL N N N N 377 VAL CA C N S 378 VAL C C N N 379 VAL O O N N 380 VAL CB C N N 381 VAL CG1 C N N 382 VAL CG2 C N N 383 VAL OXT O N N 384 VAL H H N N 385 VAL H2 H N N 386 VAL HA H N N 387 VAL HB H N N 388 VAL HG11 H N N 389 VAL HG12 H N N 390 VAL HG13 H N N 391 VAL HG21 H N N 392 VAL HG22 H N N 393 VAL HG23 H N N 394 VAL HXT H N N 395 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 SO4 S O1 doub N N 290 SO4 S O2 doub N N 291 SO4 S O3 sing N N 292 SO4 S O4 sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TRP N CA sing N N 310 TRP N H sing N N 311 TRP N H2 sing N N 312 TRP CA C sing N N 313 TRP CA CB sing N N 314 TRP CA HA sing N N 315 TRP C O doub N N 316 TRP C OXT sing N N 317 TRP CB CG sing N N 318 TRP CB HB2 sing N N 319 TRP CB HB3 sing N N 320 TRP CG CD1 doub Y N 321 TRP CG CD2 sing Y N 322 TRP CD1 NE1 sing Y N 323 TRP CD1 HD1 sing N N 324 TRP CD2 CE2 doub Y N 325 TRP CD2 CE3 sing Y N 326 TRP NE1 CE2 sing Y N 327 TRP NE1 HE1 sing N N 328 TRP CE2 CZ2 sing Y N 329 TRP CE3 CZ3 doub Y N 330 TRP CE3 HE3 sing N N 331 TRP CZ2 CH2 doub Y N 332 TRP CZ2 HZ2 sing N N 333 TRP CZ3 CH2 sing Y N 334 TRP CZ3 HZ3 sing N N 335 TRP CH2 HH2 sing N N 336 TRP OXT HXT sing N N 337 TYR N CA sing N N 338 TYR N H sing N N 339 TYR N H2 sing N N 340 TYR CA C sing N N 341 TYR CA CB sing N N 342 TYR CA HA sing N N 343 TYR C O doub N N 344 TYR C OXT sing N N 345 TYR CB CG sing N N 346 TYR CB HB2 sing N N 347 TYR CB HB3 sing N N 348 TYR CG CD1 doub Y N 349 TYR CG CD2 sing Y N 350 TYR CD1 CE1 sing Y N 351 TYR CD1 HD1 sing N N 352 TYR CD2 CE2 doub Y N 353 TYR CD2 HD2 sing N N 354 TYR CE1 CZ doub Y N 355 TYR CE1 HE1 sing N N 356 TYR CE2 CZ sing Y N 357 TYR CE2 HE2 sing N N 358 TYR CZ OH sing N N 359 TYR OH HH sing N N 360 TYR OXT HXT sing N N 361 VAL N CA sing N N 362 VAL N H sing N N 363 VAL N H2 sing N N 364 VAL CA C sing N N 365 VAL CA CB sing N N 366 VAL CA HA sing N N 367 VAL C O doub N N 368 VAL C OXT sing N N 369 VAL CB CG1 sing N N 370 VAL CB CG2 sing N N 371 VAL CB HB sing N N 372 VAL CG1 HG11 sing N N 373 VAL CG1 HG12 sing N N 374 VAL CG1 HG13 sing N N 375 VAL CG2 HG21 sing N N 376 VAL CG2 HG22 sing N N 377 VAL CG2 HG23 sing N N 378 VAL OXT HXT sing N N 379 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number R35GM133769 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2bv5 _pdbx_initial_refinement_model.details ? # _pdbx_related_exp_data_set.data_reference 10.18430/M39EEY _pdbx_related_exp_data_set.data_set_type 'diffraction image data' _pdbx_related_exp_data_set.details ? _pdbx_related_exp_data_set.metadata_reference ? _pdbx_related_exp_data_set.ordinal 1 # _space_group.name_H-M_alt 'P 21 21 21' _space_group.name_Hall 'P 2ac 2ab' _space_group.IT_number 19 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 9EEY _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.025206 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015718 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007364 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #