data_9F64 # _entry.id 9F64 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.413 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9F64 pdb_00009f64 10.2210/pdb9f64/pdb WWPDB D_1292138266 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-05-14 ? 2 'Structure model' 1 1 2026-04-08 ? 3 'Structure model' 1 2 2026-04-22 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.pdbx_database_id_DOI' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' 8 2 'Structure model' '_citation.year' 9 3 'Structure model' '_citation.journal_volume' 10 3 'Structure model' '_citation.page_first' 11 3 'Structure model' '_citation.page_last' 12 3 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9F64 _pdbx_database_status.recvd_initial_deposition_date 2024-04-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'Crystal structure of thiol peroxidase from Helicobacter pylori (HpTx, reduced)' _pdbx_database_related.db_id 9F5V _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email michael.groll@tum.de _pdbx_contact_author.name_first Michael _pdbx_contact_author.name_last Groll _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-1660-340X # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Fiedler, M.K.' 1 ? 'Gong, R.' 2 ? 'Fuchs, S.' 3 ? 'Rox, K.' 4 ? 'Friedrich, V.' 5 ? 'Pfeiffer, D.' 6 ? 'Reinhardt, T.' 7 ? 'Mibus, C.' 8 ? 'Huber, M.' 9 ? 'Hess, C.' 10 ? 'Mejias-Luque, R.' 11 ? 'Gerhard, M.' 12 ? 'Groll, M.' 13 ? 'Sieber, S.A.' 14 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Microbiol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2058-5276 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 11 _citation.language ? _citation.page_first 1049 _citation.page_last 1063 _citation.title 'Metronidazole and ether derivatives target Helicobacter pylori via simultaneous stress induction and inhibition.' _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41564-026-02291-w _citation.pdbx_database_id_PubMed 41851492 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Fiedler, M.K.' 1 ? primary 'Pandler, M.S.I.' 2 ? primary 'Gong, R.' 3 ? primary 'Fuchs, S.' 4 ? primary 'Rox, K.' 5 ? primary 'Friedrich, V.' 6 ? primary 'Pfeiffer, D.' 7 ? primary 'Singh, D.' 8 ? primary 'Reinhardt, T.' 9 ? primary 'Mibus, C.' 10 ? primary 'Huber, M.' 11 ? primary 'Hess, C.R.' 12 ? primary 'Mejias-Luque, R.' 13 ? primary 'Gerhard, M.' 14 ? primary 'Groll, M.' 15 ? primary 'Sieber, S.A.' 16 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Thiol peroxidase' 20706.918 1 1.11.1.24 C94A ? ? 2 non-polymer syn '2-(5-azanyl-2-methyl-imidazol-1-yl)ethanol' 141.171 1 ? ? ? ? 3 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 4 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 5 water nat water 18.015 36 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Tpx,Peroxiredoxin tpx,Prx,Thioredoxin peroxidase,Thioredoxin-dependent peroxiredoxin' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MASWSHPQFEKGAVTSLYKKAGFQKVTFKEETYQLEGKALKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVVSALPSLTGS VCLLQAKHFNEQTGKLPSVSFSVISMDLPFSQGQIAGAEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLD DKGVVIYKEIVQNILEEPNYEALLKVLK ; _entity_poly.pdbx_seq_one_letter_code_can ;MASWSHPQFEKGAVTSLYKKAGFQKVTFKEETYQLEGKALKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVVSALPSLTGS VCLLQAKHFNEQTGKLPSVSFSVISMDLPFSQGQIAGAEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLD DKGVVIYKEIVQNILEEPNYEALLKVLK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '2-(5-azanyl-2-methyl-imidazol-1-yl)ethanol' A1IAQ 3 1,2-ETHANEDIOL EDO 4 'SODIUM ION' NA 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 SER n 1 4 TRP n 1 5 SER n 1 6 HIS n 1 7 PRO n 1 8 GLN n 1 9 PHE n 1 10 GLU n 1 11 LYS n 1 12 GLY n 1 13 ALA n 1 14 VAL n 1 15 THR n 1 16 SER n 1 17 LEU n 1 18 TYR n 1 19 LYS n 1 20 LYS n 1 21 ALA n 1 22 GLY n 1 23 PHE n 1 24 GLN n 1 25 LYS n 1 26 VAL n 1 27 THR n 1 28 PHE n 1 29 LYS n 1 30 GLU n 1 31 GLU n 1 32 THR n 1 33 TYR n 1 34 GLN n 1 35 LEU n 1 36 GLU n 1 37 GLY n 1 38 LYS n 1 39 ALA n 1 40 LEU n 1 41 LYS n 1 42 VAL n 1 43 GLY n 1 44 ASP n 1 45 LYS n 1 46 ALA n 1 47 PRO n 1 48 ASP n 1 49 VAL n 1 50 LYS n 1 51 LEU n 1 52 VAL n 1 53 ASN n 1 54 GLY n 1 55 ASP n 1 56 LEU n 1 57 GLN n 1 58 GLU n 1 59 VAL n 1 60 ASN n 1 61 LEU n 1 62 LEU n 1 63 LYS n 1 64 GLN n 1 65 GLY n 1 66 VAL n 1 67 ARG n 1 68 PHE n 1 69 GLN n 1 70 VAL n 1 71 VAL n 1 72 SER n 1 73 ALA n 1 74 LEU n 1 75 PRO n 1 76 SER n 1 77 LEU n 1 78 THR n 1 79 GLY n 1 80 SER n 1 81 VAL n 1 82 CYS n 1 83 LEU n 1 84 LEU n 1 85 GLN n 1 86 ALA n 1 87 LYS n 1 88 HIS n 1 89 PHE n 1 90 ASN n 1 91 GLU n 1 92 GLN n 1 93 THR n 1 94 GLY n 1 95 LYS n 1 96 LEU n 1 97 PRO n 1 98 SER n 1 99 VAL n 1 100 SER n 1 101 PHE n 1 102 SER n 1 103 VAL n 1 104 ILE n 1 105 SER n 1 106 MET n 1 107 ASP n 1 108 LEU n 1 109 PRO n 1 110 PHE n 1 111 SER n 1 112 GLN n 1 113 GLY n 1 114 GLN n 1 115 ILE n 1 116 ALA n 1 117 GLY n 1 118 ALA n 1 119 GLU n 1 120 GLY n 1 121 ILE n 1 122 LYS n 1 123 ASP n 1 124 LEU n 1 125 ARG n 1 126 ILE n 1 127 LEU n 1 128 SER n 1 129 ASP n 1 130 PHE n 1 131 ARG n 1 132 TYR n 1 133 LYS n 1 134 ALA n 1 135 PHE n 1 136 GLY n 1 137 GLU n 1 138 ASN n 1 139 TYR n 1 140 GLY n 1 141 VAL n 1 142 LEU n 1 143 LEU n 1 144 GLY n 1 145 LYS n 1 146 GLY n 1 147 SER n 1 148 LEU n 1 149 GLN n 1 150 GLY n 1 151 LEU n 1 152 LEU n 1 153 ALA n 1 154 ARG n 1 155 SER n 1 156 VAL n 1 157 PHE n 1 158 VAL n 1 159 LEU n 1 160 ASP n 1 161 ASP n 1 162 LYS n 1 163 GLY n 1 164 VAL n 1 165 VAL n 1 166 ILE n 1 167 TYR n 1 168 LYS n 1 169 GLU n 1 170 ILE n 1 171 VAL n 1 172 GLN n 1 173 ASN n 1 174 ILE n 1 175 LEU n 1 176 GLU n 1 177 GLU n 1 178 PRO n 1 179 ASN n 1 180 TYR n 1 181 GLU n 1 182 ALA n 1 183 LEU n 1 184 LEU n 1 185 LYS n 1 186 VAL n 1 187 LEU n 1 188 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 188 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'tpx, HP_0390' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Helicobacter pylori' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 210 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1IAQ non-polymer . '2-(5-azanyl-2-methyl-imidazol-1-yl)ethanol' ? 'C6 H11 N3 O' 141.171 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -21 ? ? ? A . n A 1 2 ALA 2 -20 ? ? ? A . n A 1 3 SER 3 -19 ? ? ? A . n A 1 4 TRP 4 -18 ? ? ? A . n A 1 5 SER 5 -17 ? ? ? A . n A 1 6 HIS 6 -16 ? ? ? A . n A 1 7 PRO 7 -15 ? ? ? A . n A 1 8 GLN 8 -14 ? ? ? A . n A 1 9 PHE 9 -13 ? ? ? A . n A 1 10 GLU 10 -12 ? ? ? A . n A 1 11 LYS 11 -11 ? ? ? A . n A 1 12 GLY 12 -10 ? ? ? A . n A 1 13 ALA 13 -9 ? ? ? A . n A 1 14 VAL 14 -8 ? ? ? A . n A 1 15 THR 15 -7 ? ? ? A . n A 1 16 SER 16 -6 ? ? ? A . n A 1 17 LEU 17 -5 ? ? ? A . n A 1 18 TYR 18 -4 ? ? ? A . n A 1 19 LYS 19 -3 ? ? ? A . n A 1 20 LYS 20 -2 ? ? ? A . n A 1 21 ALA 21 -1 ? ? ? A . n A 1 22 GLY 22 0 ? ? ? A . n A 1 23 PHE 23 1 ? ? ? A . n A 1 24 GLN 24 2 2 GLN GLN A . n A 1 25 LYS 25 3 3 LYS LYS A . n A 1 26 VAL 26 4 4 VAL VAL A . n A 1 27 THR 27 5 5 THR THR A . n A 1 28 PHE 28 6 6 PHE PHE A . n A 1 29 LYS 29 7 7 LYS LYS A . n A 1 30 GLU 30 8 8 GLU GLU A . n A 1 31 GLU 31 9 9 GLU GLU A . n A 1 32 THR 32 10 10 THR THR A . n A 1 33 TYR 33 11 11 TYR TYR A . n A 1 34 GLN 34 12 12 GLN GLN A . n A 1 35 LEU 35 13 13 LEU LEU A . n A 1 36 GLU 36 14 14 GLU GLU A . n A 1 37 GLY 37 15 15 GLY GLY A . n A 1 38 LYS 38 16 16 LYS LYS A . n A 1 39 ALA 39 17 17 ALA ALA A . n A 1 40 LEU 40 18 18 LEU LEU A . n A 1 41 LYS 41 19 19 LYS LYS A . n A 1 42 VAL 42 20 20 VAL VAL A . n A 1 43 GLY 43 21 21 GLY GLY A . n A 1 44 ASP 44 22 22 ASP ASP A . n A 1 45 LYS 45 23 23 LYS LYS A . n A 1 46 ALA 46 24 24 ALA ALA A . n A 1 47 PRO 47 25 25 PRO PRO A . n A 1 48 ASP 48 26 26 ASP ASP A . n A 1 49 VAL 49 27 27 VAL VAL A . n A 1 50 LYS 50 28 28 LYS LYS A . n A 1 51 LEU 51 29 29 LEU LEU A . n A 1 52 VAL 52 30 30 VAL VAL A . n A 1 53 ASN 53 31 31 ASN ASN A . n A 1 54 GLY 54 32 32 GLY GLY A . n A 1 55 ASP 55 33 33 ASP ASP A . n A 1 56 LEU 56 34 34 LEU LEU A . n A 1 57 GLN 57 35 35 GLN GLN A . n A 1 58 GLU 58 36 36 GLU GLU A . n A 1 59 VAL 59 37 37 VAL VAL A . n A 1 60 ASN 60 38 38 ASN ASN A . n A 1 61 LEU 61 39 39 LEU LEU A . n A 1 62 LEU 62 40 40 LEU LEU A . n A 1 63 LYS 63 41 41 LYS LYS A . n A 1 64 GLN 64 42 42 GLN GLN A . n A 1 65 GLY 65 43 43 GLY GLY A . n A 1 66 VAL 66 44 44 VAL VAL A . n A 1 67 ARG 67 45 45 ARG ARG A . n A 1 68 PHE 68 46 46 PHE PHE A . n A 1 69 GLN 69 47 47 GLN GLN A . n A 1 70 VAL 70 48 48 VAL VAL A . n A 1 71 VAL 71 49 49 VAL VAL A . n A 1 72 SER 72 50 50 SER SER A . n A 1 73 ALA 73 51 51 ALA ALA A . n A 1 74 LEU 74 52 52 LEU LEU A . n A 1 75 PRO 75 53 53 PRO PRO A . n A 1 76 SER 76 54 54 SER SER A . n A 1 77 LEU 77 55 55 LEU LEU A . n A 1 78 THR 78 56 56 THR THR A . n A 1 79 GLY 79 57 57 GLY GLY A . n A 1 80 SER 80 58 58 SER SER A . n A 1 81 VAL 81 59 59 VAL VAL A . n A 1 82 CYS 82 60 60 CYS LIG A A n A 1 83 LEU 83 61 61 LEU LEU A . n A 1 84 LEU 84 62 62 LEU LEU A . n A 1 85 GLN 85 63 63 GLN GLN A . n A 1 86 ALA 86 64 64 ALA ALA A . n A 1 87 LYS 87 65 65 LYS LYS A . n A 1 88 HIS 88 66 66 HIS HIS A . n A 1 89 PHE 89 67 67 PHE PHE A . n A 1 90 ASN 90 68 68 ASN ASN A . n A 1 91 GLU 91 69 69 GLU GLU A . n A 1 92 GLN 92 70 70 GLN GLN A . n A 1 93 THR 93 71 71 THR THR A . n A 1 94 GLY 94 72 72 GLY GLY A . n A 1 95 LYS 95 73 73 LYS LYS A . n A 1 96 LEU 96 74 74 LEU LEU A . n A 1 97 PRO 97 75 75 PRO PRO A . n A 1 98 SER 98 76 76 SER SER A . n A 1 99 VAL 99 77 77 VAL VAL A . n A 1 100 SER 100 78 78 SER SER A . n A 1 101 PHE 101 79 79 PHE PHE A . n A 1 102 SER 102 80 80 SER SER A . n A 1 103 VAL 103 81 81 VAL VAL A . n A 1 104 ILE 104 82 82 ILE ILE A . n A 1 105 SER 105 83 83 SER SER A . n A 1 106 MET 106 84 84 MET MET A . n A 1 107 ASP 107 85 85 ASP ASP A . n A 1 108 LEU 108 86 86 LEU LEU A . n A 1 109 PRO 109 87 87 PRO PRO A . n A 1 110 PHE 110 88 88 PHE PHE A . n A 1 111 SER 111 89 89 SER SER A . n A 1 112 GLN 112 90 90 GLN GLN A . n A 1 113 GLY 113 91 91 GLY GLY A . n A 1 114 GLN 114 92 92 GLN GLN A . n A 1 115 ILE 115 93 93 ILE ILE A . n A 1 116 ALA 116 94 94 ALA ALA A . n A 1 117 GLY 117 95 95 GLY GLY A . n A 1 118 ALA 118 96 96 ALA ALA A . n A 1 119 GLU 119 97 97 GLU GLU A . n A 1 120 GLY 120 98 98 GLY GLY A . n A 1 121 ILE 121 99 99 ILE ILE A . n A 1 122 LYS 122 100 100 LYS LYS A . n A 1 123 ASP 123 101 101 ASP ASP A . n A 1 124 LEU 124 102 102 LEU LEU A . n A 1 125 ARG 125 103 103 ARG ARG A . n A 1 126 ILE 126 104 104 ILE ILE A . n A 1 127 LEU 127 105 105 LEU LEU A . n A 1 128 SER 128 106 106 SER SER A . n A 1 129 ASP 129 107 107 ASP ASP A . n A 1 130 PHE 130 108 108 PHE PHE A . n A 1 131 ARG 131 109 109 ARG ARG A . n A 1 132 TYR 132 110 110 TYR TYR A . n A 1 133 LYS 133 111 111 LYS LYS A . n A 1 134 ALA 134 112 112 ALA ALA A . n A 1 135 PHE 135 113 113 PHE PHE A . n A 1 136 GLY 136 114 114 GLY GLY A . n A 1 137 GLU 137 115 115 GLU GLU A . n A 1 138 ASN 138 116 116 ASN ASN A . n A 1 139 TYR 139 117 117 TYR TYR A . n A 1 140 GLY 140 118 118 GLY GLY A . n A 1 141 VAL 141 119 119 VAL VAL A . n A 1 142 LEU 142 120 120 LEU LEU A . n A 1 143 LEU 143 121 121 LEU LEU A . n A 1 144 GLY 144 122 122 GLY GLY A . n A 1 145 LYS 145 123 123 LYS LYS A . n A 1 146 GLY 146 124 124 GLY GLY A . n A 1 147 SER 147 125 125 SER SER A . n A 1 148 LEU 148 126 126 LEU LEU A . n A 1 149 GLN 149 127 127 GLN GLN A . n A 1 150 GLY 150 128 128 GLY GLY A . n A 1 151 LEU 151 129 129 LEU LEU A . n A 1 152 LEU 152 130 130 LEU LEU A . n A 1 153 ALA 153 131 131 ALA ALA A . n A 1 154 ARG 154 132 132 ARG ARG A . n A 1 155 SER 155 133 133 SER SER A . n A 1 156 VAL 156 134 134 VAL VAL A . n A 1 157 PHE 157 135 135 PHE PHE A . n A 1 158 VAL 158 136 136 VAL VAL A . n A 1 159 LEU 159 137 137 LEU LEU A . n A 1 160 ASP 160 138 138 ASP ASP A . n A 1 161 ASP 161 139 139 ASP ASP A . n A 1 162 LYS 162 140 140 LYS LYS A . n A 1 163 GLY 163 141 141 GLY GLY A . n A 1 164 VAL 164 142 142 VAL VAL A . n A 1 165 VAL 165 143 143 VAL VAL A . n A 1 166 ILE 166 144 144 ILE ILE A . n A 1 167 TYR 167 145 145 TYR TYR A . n A 1 168 LYS 168 146 146 LYS LYS A . n A 1 169 GLU 169 147 147 GLU GLU A . n A 1 170 ILE 170 148 148 ILE ILE A . n A 1 171 VAL 171 149 149 VAL VAL A . n A 1 172 GLN 172 150 150 GLN GLN A . n A 1 173 ASN 173 151 151 ASN ASN A . n A 1 174 ILE 174 152 152 ILE ILE A . n A 1 175 LEU 175 153 153 LEU LEU A . n A 1 176 GLU 176 154 154 GLU GLU A . n A 1 177 GLU 177 155 155 GLU GLU A . n A 1 178 PRO 178 156 156 PRO PRO A . n A 1 179 ASN 179 157 157 ASN ASN A . n A 1 180 TYR 180 158 158 TYR TYR A . n A 1 181 GLU 181 159 159 GLU GLU A . n A 1 182 ALA 182 160 160 ALA ALA A . n A 1 183 LEU 183 161 161 LEU LEU A . n A 1 184 LEU 184 162 162 LEU LEU A . n A 1 185 LYS 185 163 163 LYS LYS A . n A 1 186 VAL 186 164 164 VAL VAL A . n A 1 187 LEU 187 165 165 LEU LEU A . n A 1 188 LYS 188 166 166 LYS LYS A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1IAQ _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1IAQ _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 A1IAQ 1 201 60 A1IAQ LIG A . C 3 EDO 1 202 1 EDO EDO A . D 4 NA 1 203 2 NA NA A . E 5 HOH 1 301 16 HOH HOH A . E 5 HOH 2 302 32 HOH HOH A . E 5 HOH 3 303 37 HOH HOH A . E 5 HOH 4 304 15 HOH HOH A . E 5 HOH 5 305 36 HOH HOH A . E 5 HOH 6 306 27 HOH HOH A . E 5 HOH 7 307 11 HOH HOH A . E 5 HOH 8 308 13 HOH HOH A . E 5 HOH 9 309 21 HOH HOH A . E 5 HOH 10 310 10 HOH HOH A . E 5 HOH 11 311 24 HOH HOH A . E 5 HOH 12 312 17 HOH HOH A . E 5 HOH 13 313 5 HOH HOH A . E 5 HOH 14 314 3 HOH HOH A . E 5 HOH 15 315 4 HOH HOH A . E 5 HOH 16 316 47 HOH HOH A . E 5 HOH 17 317 14 HOH HOH A . E 5 HOH 18 318 19 HOH HOH A . E 5 HOH 19 319 46 HOH HOH A . E 5 HOH 20 320 45 HOH HOH A . E 5 HOH 21 321 12 HOH HOH A . E 5 HOH 22 322 25 HOH HOH A . E 5 HOH 23 323 26 HOH HOH A . E 5 HOH 24 324 8 HOH HOH A . E 5 HOH 25 325 6 HOH HOH A . E 5 HOH 26 326 23 HOH HOH A . E 5 HOH 27 327 31 HOH HOH A . E 5 HOH 28 328 28 HOH HOH A . E 5 HOH 29 329 9 HOH HOH A . E 5 HOH 30 331 33 HOH HOH A . E 5 HOH 31 333 41 HOH HOH A . E 5 HOH 32 334 38 HOH HOH A . E 5 HOH 33 335 34 HOH HOH A . E 5 HOH 34 337 30 HOH HOH A . E 5 HOH 35 338 22 HOH HOH A . E 5 HOH 36 339 42 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 115.91 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9F64 _cell.details ? _cell.formula_units_Z ? _cell.length_a 67.370 _cell.length_a_esd ? _cell.length_b 71.480 _cell.length_b_esd ? _cell.length_c 40.770 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9F64 _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9F64 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.12 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.00 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M TRIS, 0.01 M CoCl2, 20% PVP K15' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-07-02 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9F64 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.75 _reflns.d_resolution_low 30 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 16754 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 95.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.034 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.75 _reflns_shell.d_res_low 1.85 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.1 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2627 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.8 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 95.0 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.673 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 5.39 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 3.95 _refine.aniso_B[2][2] -6.20 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] -2.06 _refine.B_iso_max ? _refine.B_iso_mean 56.965 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.971 _refine.correlation_coeff_Fo_to_Fc_free 0.960 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9F64 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.75 _refine.ls_d_res_low 30.00 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15911 _refine.ls_number_reflns_R_free 837 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.31 _refine.ls_percent_reflns_R_free 5.0 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.19764 _refine.ls_R_factor_R_free 0.22370 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.19694 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.209 _refine.pdbx_overall_ESU_R_Free 0.121 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 13.316 _refine.overall_SU_ML 0.164 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 1.75 _refine_hist.d_res_low 30.00 _refine_hist.number_atoms_solvent 39 _refine_hist.number_atoms_total 1333 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1289 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 0.013 1311 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.008 0.016 1326 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.253 1.648 1765 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.225 1.602 3054 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.292 5.000 164 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 32.399 24.828 58 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 16.053 15.000 246 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 15.541 15.000 4 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.047 0.200 161 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.008 0.020 1472 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.005 0.020 277 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 3.346 5.190 659 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 3.342 5.184 658 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 4.441 7.792 822 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 4.439 7.797 823 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 3.334 5.629 651 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 3.332 5.631 652 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 4.321 8.241 944 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 5.658 62.149 1405 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 5.659 62.026 1399 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? 7.792 3.000 2632 ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.750 _refine_ls_shell.d_res_low 1.795 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 62 _refine_ls_shell.number_reflns_R_work 1172 _refine_ls_shell.percent_reflns_obs 97.70 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.556 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.481 # _struct.entry_id 9F64 _struct.title 'Crystal structure of thiol peroxidase mutant (C94A) in complex with Metro* (H. pylori' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9F64 _struct_keywords.text 'Stress Response, Detoxification, Active Site Analysis, Protein Inhibitor Interactions, Catalysis, Drug Target, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TPX_HELPY _struct_ref.pdbx_db_accession O25151 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QKVTFKEETYQLEGKALKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVVSALPSLTGSVCLLQAKHFNEQTGKLPSVSFSV ISMDLPFSQGQICGAEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEAL LKVLK ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9F64 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 24 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 188 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O25151 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 166 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 166 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9F64 MET A 1 ? UNP O25151 ? ? 'initiating methionine' -21 1 1 9F64 ALA A 2 ? UNP O25151 ? ? 'expression tag' -20 2 1 9F64 SER A 3 ? UNP O25151 ? ? 'expression tag' -19 3 1 9F64 TRP A 4 ? UNP O25151 ? ? 'expression tag' -18 4 1 9F64 SER A 5 ? UNP O25151 ? ? 'expression tag' -17 5 1 9F64 HIS A 6 ? UNP O25151 ? ? 'expression tag' -16 6 1 9F64 PRO A 7 ? UNP O25151 ? ? 'expression tag' -15 7 1 9F64 GLN A 8 ? UNP O25151 ? ? 'expression tag' -14 8 1 9F64 PHE A 9 ? UNP O25151 ? ? 'expression tag' -13 9 1 9F64 GLU A 10 ? UNP O25151 ? ? 'expression tag' -12 10 1 9F64 LYS A 11 ? UNP O25151 ? ? 'expression tag' -11 11 1 9F64 GLY A 12 ? UNP O25151 ? ? 'expression tag' -10 12 1 9F64 ALA A 13 ? UNP O25151 ? ? 'expression tag' -9 13 1 9F64 VAL A 14 ? UNP O25151 ? ? 'expression tag' -8 14 1 9F64 THR A 15 ? UNP O25151 ? ? 'expression tag' -7 15 1 9F64 SER A 16 ? UNP O25151 ? ? 'expression tag' -6 16 1 9F64 LEU A 17 ? UNP O25151 ? ? 'expression tag' -5 17 1 9F64 TYR A 18 ? UNP O25151 ? ? 'expression tag' -4 18 1 9F64 LYS A 19 ? UNP O25151 ? ? 'expression tag' -3 19 1 9F64 LYS A 20 ? UNP O25151 ? ? 'expression tag' -2 20 1 9F64 ALA A 21 ? UNP O25151 ? ? 'expression tag' -1 21 1 9F64 GLY A 22 ? UNP O25151 ? ? 'expression tag' 0 22 1 9F64 PHE A 23 ? UNP O25151 ? ? 'expression tag' 1 23 1 9F64 ALA A 116 ? UNP O25151 CYS 94 'engineered mutation' 94 24 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 190 ? 1 MORE 2 ? 1 'SSA (A^2)' 8510 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 80 ? LEU A 96 ? SER A 58 LEU A 74 1 ? 17 HELX_P HELX_P2 AA2 LEU A 108 ? GLU A 119 ? LEU A 86 GLU A 97 1 ? 12 HELX_P HELX_P3 AA3 LYS A 133 ? TYR A 139 ? LYS A 111 TYR A 117 1 ? 7 HELX_P HELX_P4 AA4 ASN A 179 ? LEU A 187 ? ASN A 157 LEU A 165 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A CYS 82 SG ? A ? 1_555 B A1IAQ . CC5 ? ? A CYS 60 A A1IAQ 201 1_555 ? ? ? ? ? ? ? 1.779 ? ? metalc1 metalc ? ? A TYR 167 OH ? ? ? 1_555 D NA . NA ? ? A TYR 145 A NA 203 1_555 ? ? ? ? ? ? ? 2.565 ? ? metalc2 metalc ? ? A GLU 169 OE2 ? ? ? 1_555 D NA . NA ? ? A GLU 147 A NA 203 1_555 ? ? ? ? ? ? ? 1.958 ? ? metalc3 metalc ? ? A ASN 179 O ? ? ? 1_555 D NA . NA ? ? A ASN 157 A NA 203 1_555 ? ? ? ? ? ? ? 2.678 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OH ? A TYR 167 ? A TYR 145 ? 1_555 NA ? D NA . ? A NA 203 ? 1_555 OE2 ? A GLU 169 ? A GLU 147 ? 1_555 89.8 ? 2 OH ? A TYR 167 ? A TYR 145 ? 1_555 NA ? D NA . ? A NA 203 ? 1_555 O ? A ASN 179 ? A ASN 157 ? 1_555 108.4 ? 3 OE2 ? A GLU 169 ? A GLU 147 ? 1_555 NA ? D NA . ? A NA 203 ? 1_555 O ? A ASN 179 ? A ASN 157 ? 1_555 113.2 ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id A1IAQ _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 82 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id A1IAQ _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 201 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 60 _pdbx_modification_feature.modified_residue_PDB_ins_code A _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom CC5 _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id A1IAQ _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Covalent chemical modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 2 ? AA3 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 25 ? PHE A 28 ? LYS A 3 PHE A 6 AA1 2 GLU A 31 ? GLU A 36 ? GLU A 9 GLU A 14 AA1 3 LEU A 142 ? LEU A 143 ? LEU A 120 LEU A 121 AA2 1 LYS A 50 ? VAL A 52 ? LYS A 28 VAL A 30 AA2 2 GLU A 58 ? ASN A 60 ? GLU A 36 ASN A 38 AA3 1 ARG A 125 ? SER A 128 ? ARG A 103 SER A 106 AA3 2 VAL A 99 ? SER A 105 ? VAL A 77 SER A 83 AA3 3 PHE A 68 ? ALA A 73 ? PHE A 46 ALA A 51 AA3 4 SER A 155 ? LEU A 159 ? SER A 133 LEU A 137 AA3 5 VAL A 165 ? ILE A 170 ? VAL A 143 ILE A 148 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 26 ? N VAL A 4 O TYR A 33 ? O TYR A 11 AA1 2 3 N GLU A 36 ? N GLU A 14 O LEU A 142 ? O LEU A 120 AA2 1 2 N LEU A 51 ? N LEU A 29 O VAL A 59 ? O VAL A 37 AA3 1 2 O LEU A 127 ? O LEU A 105 N VAL A 103 ? N VAL A 81 AA3 2 3 O SER A 100 ? O SER A 78 N VAL A 70 ? N VAL A 48 AA3 3 4 N GLN A 69 ? N GLN A 47 O LEU A 159 ? O LEU A 137 AA3 4 5 N VAL A 156 ? N VAL A 134 O GLU A 169 ? O GLU A 147 # _pdbx_entry_details.entry_id 9F64 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id LYS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 7 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 49.93 _pdbx_validate_torsion.psi -116.21 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 14.6489 _pdbx_refine_tls.origin_y -0.9508 _pdbx_refine_tls.origin_z 4.5385 _pdbx_refine_tls.T[1][1] 0.0249 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0041 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0404 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.0673 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0024 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.0739 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 0.4122 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.0302 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.2681 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.0120 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.0714 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 0.5226 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.0125 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.0051 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.0133 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.0028 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.0019 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.0087 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.0117 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.0364 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.0106 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 2 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 166 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -21 ? A MET 1 2 1 Y 1 A ALA -20 ? A ALA 2 3 1 Y 1 A SER -19 ? A SER 3 4 1 Y 1 A TRP -18 ? A TRP 4 5 1 Y 1 A SER -17 ? A SER 5 6 1 Y 1 A HIS -16 ? A HIS 6 7 1 Y 1 A PRO -15 ? A PRO 7 8 1 Y 1 A GLN -14 ? A GLN 8 9 1 Y 1 A PHE -13 ? A PHE 9 10 1 Y 1 A GLU -12 ? A GLU 10 11 1 Y 1 A LYS -11 ? A LYS 11 12 1 Y 1 A GLY -10 ? A GLY 12 13 1 Y 1 A ALA -9 ? A ALA 13 14 1 Y 1 A VAL -8 ? A VAL 14 15 1 Y 1 A THR -7 ? A THR 15 16 1 Y 1 A SER -6 ? A SER 16 17 1 Y 1 A LEU -5 ? A LEU 17 18 1 Y 1 A TYR -4 ? A TYR 18 19 1 Y 1 A LYS -3 ? A LYS 19 20 1 Y 1 A LYS -2 ? A LYS 20 21 1 Y 1 A ALA -1 ? A ALA 21 22 1 Y 1 A GLY 0 ? A GLY 22 23 1 Y 1 A PHE 1 ? A PHE 23 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1IAQ OHD O N N 1 A1IAQ CB6 C N N 2 A1IAQ CB5 C N N 3 A1IAQ NC1 N Y N 4 A1IAQ CC3 C Y N 5 A1IAQ CA5 C N N 6 A1IAQ NC4 N Y N 7 A1IAQ CC5 C Y N 8 A1IAQ CC2 C Y N 9 A1IAQ NO N N N 10 A1IAQ H1 H N N 11 A1IAQ H2 H N N 12 A1IAQ H3 H N N 13 A1IAQ H4 H N N 14 A1IAQ H5 H N N 15 A1IAQ H6 H N N 16 A1IAQ H7 H N N 17 A1IAQ H8 H N N 18 A1IAQ H9 H N N 19 A1IAQ H10 H N N 20 A1IAQ H11 H N N 21 ALA N N N N 22 ALA CA C N S 23 ALA C C N N 24 ALA O O N N 25 ALA CB C N N 26 ALA OXT O N N 27 ALA H H N N 28 ALA H2 H N N 29 ALA HA H N N 30 ALA HB1 H N N 31 ALA HB2 H N N 32 ALA HB3 H N N 33 ALA HXT H N N 34 ARG N N N N 35 ARG CA C N S 36 ARG C C N N 37 ARG O O N N 38 ARG CB C N N 39 ARG CG C N N 40 ARG CD C N N 41 ARG NE N N N 42 ARG CZ C N N 43 ARG NH1 N N N 44 ARG NH2 N N N 45 ARG OXT O N N 46 ARG H H N N 47 ARG H2 H N N 48 ARG HA H N N 49 ARG HB2 H N N 50 ARG HB3 H N N 51 ARG HG2 H N N 52 ARG HG3 H N N 53 ARG HD2 H N N 54 ARG HD3 H N N 55 ARG HE H N N 56 ARG HH11 H N N 57 ARG HH12 H N N 58 ARG HH21 H N N 59 ARG HH22 H N N 60 ARG HXT H N N 61 ASN N N N N 62 ASN CA C N S 63 ASN C C N N 64 ASN O O N N 65 ASN CB C N N 66 ASN CG C N N 67 ASN OD1 O N N 68 ASN ND2 N N N 69 ASN OXT O N N 70 ASN H H N N 71 ASN H2 H N N 72 ASN HA H N N 73 ASN HB2 H N N 74 ASN HB3 H N N 75 ASN HD21 H N N 76 ASN HD22 H N N 77 ASN HXT H N N 78 ASP N N N N 79 ASP CA C N S 80 ASP C C N N 81 ASP O O N N 82 ASP CB C N N 83 ASP CG C N N 84 ASP OD1 O N N 85 ASP OD2 O N N 86 ASP OXT O N N 87 ASP H H N N 88 ASP H2 H N N 89 ASP HA H N N 90 ASP HB2 H N N 91 ASP HB3 H N N 92 ASP HD2 H N N 93 ASP HXT H N N 94 CYS N N N N 95 CYS CA C N R 96 CYS C C N N 97 CYS O O N N 98 CYS CB C N N 99 CYS SG S N N 100 CYS OXT O N N 101 CYS H H N N 102 CYS H2 H N N 103 CYS HA H N N 104 CYS HB2 H N N 105 CYS HB3 H N N 106 CYS HG H N N 107 CYS HXT H N N 108 EDO C1 C N N 109 EDO O1 O N N 110 EDO C2 C N N 111 EDO O2 O N N 112 EDO H11 H N N 113 EDO H12 H N N 114 EDO HO1 H N N 115 EDO H21 H N N 116 EDO H22 H N N 117 EDO HO2 H N N 118 GLN N N N N 119 GLN CA C N S 120 GLN C C N N 121 GLN O O N N 122 GLN CB C N N 123 GLN CG C N N 124 GLN CD C N N 125 GLN OE1 O N N 126 GLN NE2 N N N 127 GLN OXT O N N 128 GLN H H N N 129 GLN H2 H N N 130 GLN HA H N N 131 GLN HB2 H N N 132 GLN HB3 H N N 133 GLN HG2 H N N 134 GLN HG3 H N N 135 GLN HE21 H N N 136 GLN HE22 H N N 137 GLN HXT H N N 138 GLU N N N N 139 GLU CA C N S 140 GLU C C N N 141 GLU O O N N 142 GLU CB C N N 143 GLU CG C N N 144 GLU CD C N N 145 GLU OE1 O N N 146 GLU OE2 O N N 147 GLU OXT O N N 148 GLU H H N N 149 GLU H2 H N N 150 GLU HA H N N 151 GLU HB2 H N N 152 GLU HB3 H N N 153 GLU HG2 H N N 154 GLU HG3 H N N 155 GLU HE2 H N N 156 GLU HXT H N N 157 GLY N N N N 158 GLY CA C N N 159 GLY C C N N 160 GLY O O N N 161 GLY OXT O N N 162 GLY H H N N 163 GLY H2 H N N 164 GLY HA2 H N N 165 GLY HA3 H N N 166 GLY HXT H N N 167 HIS N N N N 168 HIS CA C N S 169 HIS C C N N 170 HIS O O N N 171 HIS CB C N N 172 HIS CG C Y N 173 HIS ND1 N Y N 174 HIS CD2 C Y N 175 HIS CE1 C Y N 176 HIS NE2 N Y N 177 HIS OXT O N N 178 HIS H H N N 179 HIS H2 H N N 180 HIS HA H N N 181 HIS HB2 H N N 182 HIS HB3 H N N 183 HIS HD1 H N N 184 HIS HD2 H N N 185 HIS HE1 H N N 186 HIS HE2 H N N 187 HIS HXT H N N 188 HOH O O N N 189 HOH H1 H N N 190 HOH H2 H N N 191 ILE N N N N 192 ILE CA C N S 193 ILE C C N N 194 ILE O O N N 195 ILE CB C N S 196 ILE CG1 C N N 197 ILE CG2 C N N 198 ILE CD1 C N N 199 ILE OXT O N N 200 ILE H H N N 201 ILE H2 H N N 202 ILE HA H N N 203 ILE HB H N N 204 ILE HG12 H N N 205 ILE HG13 H N N 206 ILE HG21 H N N 207 ILE HG22 H N N 208 ILE HG23 H N N 209 ILE HD11 H N N 210 ILE HD12 H N N 211 ILE HD13 H N N 212 ILE HXT H N N 213 LEU N N N N 214 LEU CA C N S 215 LEU C C N N 216 LEU O O N N 217 LEU CB C N N 218 LEU CG C N N 219 LEU CD1 C N N 220 LEU CD2 C N N 221 LEU OXT O N N 222 LEU H H N N 223 LEU H2 H N N 224 LEU HA H N N 225 LEU HB2 H N N 226 LEU HB3 H N N 227 LEU HG H N N 228 LEU HD11 H N N 229 LEU HD12 H N N 230 LEU HD13 H N N 231 LEU HD21 H N N 232 LEU HD22 H N N 233 LEU HD23 H N N 234 LEU HXT H N N 235 LYS N N N N 236 LYS CA C N S 237 LYS C C N N 238 LYS O O N N 239 LYS CB C N N 240 LYS CG C N N 241 LYS CD C N N 242 LYS CE C N N 243 LYS NZ N N N 244 LYS OXT O N N 245 LYS H H N N 246 LYS H2 H N N 247 LYS HA H N N 248 LYS HB2 H N N 249 LYS HB3 H N N 250 LYS HG2 H N N 251 LYS HG3 H N N 252 LYS HD2 H N N 253 LYS HD3 H N N 254 LYS HE2 H N N 255 LYS HE3 H N N 256 LYS HZ1 H N N 257 LYS HZ2 H N N 258 LYS HZ3 H N N 259 LYS HXT H N N 260 MET N N N N 261 MET CA C N S 262 MET C C N N 263 MET O O N N 264 MET CB C N N 265 MET CG C N N 266 MET SD S N N 267 MET CE C N N 268 MET OXT O N N 269 MET H H N N 270 MET H2 H N N 271 MET HA H N N 272 MET HB2 H N N 273 MET HB3 H N N 274 MET HG2 H N N 275 MET HG3 H N N 276 MET HE1 H N N 277 MET HE2 H N N 278 MET HE3 H N N 279 MET HXT H N N 280 NA NA NA N N 281 PHE N N N N 282 PHE CA C N S 283 PHE C C N N 284 PHE O O N N 285 PHE CB C N N 286 PHE CG C Y N 287 PHE CD1 C Y N 288 PHE CD2 C Y N 289 PHE CE1 C Y N 290 PHE CE2 C Y N 291 PHE CZ C Y N 292 PHE OXT O N N 293 PHE H H N N 294 PHE H2 H N N 295 PHE HA H N N 296 PHE HB2 H N N 297 PHE HB3 H N N 298 PHE HD1 H N N 299 PHE HD2 H N N 300 PHE HE1 H N N 301 PHE HE2 H N N 302 PHE HZ H N N 303 PHE HXT H N N 304 PRO N N N N 305 PRO CA C N S 306 PRO C C N N 307 PRO O O N N 308 PRO CB C N N 309 PRO CG C N N 310 PRO CD C N N 311 PRO OXT O N N 312 PRO H H N N 313 PRO HA H N N 314 PRO HB2 H N N 315 PRO HB3 H N N 316 PRO HG2 H N N 317 PRO HG3 H N N 318 PRO HD2 H N N 319 PRO HD3 H N N 320 PRO HXT H N N 321 SER N N N N 322 SER CA C N S 323 SER C C N N 324 SER O O N N 325 SER CB C N N 326 SER OG O N N 327 SER OXT O N N 328 SER H H N N 329 SER H2 H N N 330 SER HA H N N 331 SER HB2 H N N 332 SER HB3 H N N 333 SER HG H N N 334 SER HXT H N N 335 THR N N N N 336 THR CA C N S 337 THR C C N N 338 THR O O N N 339 THR CB C N R 340 THR OG1 O N N 341 THR CG2 C N N 342 THR OXT O N N 343 THR H H N N 344 THR H2 H N N 345 THR HA H N N 346 THR HB H N N 347 THR HG1 H N N 348 THR HG21 H N N 349 THR HG22 H N N 350 THR HG23 H N N 351 THR HXT H N N 352 TRP N N N N 353 TRP CA C N S 354 TRP C C N N 355 TRP O O N N 356 TRP CB C N N 357 TRP CG C Y N 358 TRP CD1 C Y N 359 TRP CD2 C Y N 360 TRP NE1 N Y N 361 TRP CE2 C Y N 362 TRP CE3 C Y N 363 TRP CZ2 C Y N 364 TRP CZ3 C Y N 365 TRP CH2 C Y N 366 TRP OXT O N N 367 TRP H H N N 368 TRP H2 H N N 369 TRP HA H N N 370 TRP HB2 H N N 371 TRP HB3 H N N 372 TRP HD1 H N N 373 TRP HE1 H N N 374 TRP HE3 H N N 375 TRP HZ2 H N N 376 TRP HZ3 H N N 377 TRP HH2 H N N 378 TRP HXT H N N 379 TYR N N N N 380 TYR CA C N S 381 TYR C C N N 382 TYR O O N N 383 TYR CB C N N 384 TYR CG C Y N 385 TYR CD1 C Y N 386 TYR CD2 C Y N 387 TYR CE1 C Y N 388 TYR CE2 C Y N 389 TYR CZ C Y N 390 TYR OH O N N 391 TYR OXT O N N 392 TYR H H N N 393 TYR H2 H N N 394 TYR HA H N N 395 TYR HB2 H N N 396 TYR HB3 H N N 397 TYR HD1 H N N 398 TYR HD2 H N N 399 TYR HE1 H N N 400 TYR HE2 H N N 401 TYR HH H N N 402 TYR HXT H N N 403 VAL N N N N 404 VAL CA C N S 405 VAL C C N N 406 VAL O O N N 407 VAL CB C N N 408 VAL CG1 C N N 409 VAL CG2 C N N 410 VAL OXT O N N 411 VAL H H N N 412 VAL H2 H N N 413 VAL HA H N N 414 VAL HB H N N 415 VAL HG11 H N N 416 VAL HG12 H N N 417 VAL HG13 H N N 418 VAL HG21 H N N 419 VAL HG22 H N N 420 VAL HG23 H N N 421 VAL HXT H N N 422 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1IAQ NO CC2 sing N N 1 A1IAQ CC2 CC5 doub Y N 2 A1IAQ CC2 NC1 sing Y N 3 A1IAQ CC5 NC4 sing Y N 4 A1IAQ NC1 CB5 sing N N 5 A1IAQ NC1 CC3 sing Y N 6 A1IAQ CB5 CB6 sing N N 7 A1IAQ NC4 CC3 doub Y N 8 A1IAQ CC3 CA5 sing N N 9 A1IAQ OHD CB6 sing N N 10 A1IAQ OHD H1 sing N N 11 A1IAQ CB6 H2 sing N N 12 A1IAQ CB6 H3 sing N N 13 A1IAQ CB5 H4 sing N N 14 A1IAQ CB5 H5 sing N N 15 A1IAQ CA5 H6 sing N N 16 A1IAQ CA5 H7 sing N N 17 A1IAQ CA5 H8 sing N N 18 A1IAQ CC5 H9 sing N N 19 A1IAQ NO H10 sing N N 20 A1IAQ NO H11 sing N N 21 ALA N CA sing N N 22 ALA N H sing N N 23 ALA N H2 sing N N 24 ALA CA C sing N N 25 ALA CA CB sing N N 26 ALA CA HA sing N N 27 ALA C O doub N N 28 ALA C OXT sing N N 29 ALA CB HB1 sing N N 30 ALA CB HB2 sing N N 31 ALA CB HB3 sing N N 32 ALA OXT HXT sing N N 33 ARG N CA sing N N 34 ARG N H sing N N 35 ARG N H2 sing N N 36 ARG CA C sing N N 37 ARG CA CB sing N N 38 ARG CA HA sing N N 39 ARG C O doub N N 40 ARG C OXT sing N N 41 ARG CB CG sing N N 42 ARG CB HB2 sing N N 43 ARG CB HB3 sing N N 44 ARG CG CD sing N N 45 ARG CG HG2 sing N N 46 ARG CG HG3 sing N N 47 ARG CD NE sing N N 48 ARG CD HD2 sing N N 49 ARG CD HD3 sing N N 50 ARG NE CZ sing N N 51 ARG NE HE sing N N 52 ARG CZ NH1 sing N N 53 ARG CZ NH2 doub N N 54 ARG NH1 HH11 sing N N 55 ARG NH1 HH12 sing N N 56 ARG NH2 HH21 sing N N 57 ARG NH2 HH22 sing N N 58 ARG OXT HXT sing N N 59 ASN N CA sing N N 60 ASN N H sing N N 61 ASN N H2 sing N N 62 ASN CA C sing N N 63 ASN CA CB sing N N 64 ASN CA HA sing N N 65 ASN C O doub N N 66 ASN C OXT sing N N 67 ASN CB CG sing N N 68 ASN CB HB2 sing N N 69 ASN CB HB3 sing N N 70 ASN CG OD1 doub N N 71 ASN CG ND2 sing N N 72 ASN ND2 HD21 sing N N 73 ASN ND2 HD22 sing N N 74 ASN OXT HXT sing N N 75 ASP N CA sing N N 76 ASP N H sing N N 77 ASP N H2 sing N N 78 ASP CA C sing N N 79 ASP CA CB sing N N 80 ASP CA HA sing N N 81 ASP C O doub N N 82 ASP C OXT sing N N 83 ASP CB CG sing N N 84 ASP CB HB2 sing N N 85 ASP CB HB3 sing N N 86 ASP CG OD1 doub N N 87 ASP CG OD2 sing N N 88 ASP OD2 HD2 sing N N 89 ASP OXT HXT sing N N 90 CYS N CA sing N N 91 CYS N H sing N N 92 CYS N H2 sing N N 93 CYS CA C sing N N 94 CYS CA CB sing N N 95 CYS CA HA sing N N 96 CYS C O doub N N 97 CYS C OXT sing N N 98 CYS CB SG sing N N 99 CYS CB HB2 sing N N 100 CYS CB HB3 sing N N 101 CYS SG HG sing N N 102 CYS OXT HXT sing N N 103 EDO C1 O1 sing N N 104 EDO C1 C2 sing N N 105 EDO C1 H11 sing N N 106 EDO C1 H12 sing N N 107 EDO O1 HO1 sing N N 108 EDO C2 O2 sing N N 109 EDO C2 H21 sing N N 110 EDO C2 H22 sing N N 111 EDO O2 HO2 sing N N 112 GLN N CA sing N N 113 GLN N H sing N N 114 GLN N H2 sing N N 115 GLN CA C sing N N 116 GLN CA CB sing N N 117 GLN CA HA sing N N 118 GLN C O doub N N 119 GLN C OXT sing N N 120 GLN CB CG sing N N 121 GLN CB HB2 sing N N 122 GLN CB HB3 sing N N 123 GLN CG CD sing N N 124 GLN CG HG2 sing N N 125 GLN CG HG3 sing N N 126 GLN CD OE1 doub N N 127 GLN CD NE2 sing N N 128 GLN NE2 HE21 sing N N 129 GLN NE2 HE22 sing N N 130 GLN OXT HXT sing N N 131 GLU N CA sing N N 132 GLU N H sing N N 133 GLU N H2 sing N N 134 GLU CA C sing N N 135 GLU CA CB sing N N 136 GLU CA HA sing N N 137 GLU C O doub N N 138 GLU C OXT sing N N 139 GLU CB CG sing N N 140 GLU CB HB2 sing N N 141 GLU CB HB3 sing N N 142 GLU CG CD sing N N 143 GLU CG HG2 sing N N 144 GLU CG HG3 sing N N 145 GLU CD OE1 doub N N 146 GLU CD OE2 sing N N 147 GLU OE2 HE2 sing N N 148 GLU OXT HXT sing N N 149 GLY N CA sing N N 150 GLY N H sing N N 151 GLY N H2 sing N N 152 GLY CA C sing N N 153 GLY CA HA2 sing N N 154 GLY CA HA3 sing N N 155 GLY C O doub N N 156 GLY C OXT sing N N 157 GLY OXT HXT sing N N 158 HIS N CA sing N N 159 HIS N H sing N N 160 HIS N H2 sing N N 161 HIS CA C sing N N 162 HIS CA CB sing N N 163 HIS CA HA sing N N 164 HIS C O doub N N 165 HIS C OXT sing N N 166 HIS CB CG sing N N 167 HIS CB HB2 sing N N 168 HIS CB HB3 sing N N 169 HIS CG ND1 sing Y N 170 HIS CG CD2 doub Y N 171 HIS ND1 CE1 doub Y N 172 HIS ND1 HD1 sing N N 173 HIS CD2 NE2 sing Y N 174 HIS CD2 HD2 sing N N 175 HIS CE1 NE2 sing Y N 176 HIS CE1 HE1 sing N N 177 HIS NE2 HE2 sing N N 178 HIS OXT HXT sing N N 179 HOH O H1 sing N N 180 HOH O H2 sing N N 181 ILE N CA sing N N 182 ILE N H sing N N 183 ILE N H2 sing N N 184 ILE CA C sing N N 185 ILE CA CB sing N N 186 ILE CA HA sing N N 187 ILE C O doub N N 188 ILE C OXT sing N N 189 ILE CB CG1 sing N N 190 ILE CB CG2 sing N N 191 ILE CB HB sing N N 192 ILE CG1 CD1 sing N N 193 ILE CG1 HG12 sing N N 194 ILE CG1 HG13 sing N N 195 ILE CG2 HG21 sing N N 196 ILE CG2 HG22 sing N N 197 ILE CG2 HG23 sing N N 198 ILE CD1 HD11 sing N N 199 ILE CD1 HD12 sing N N 200 ILE CD1 HD13 sing N N 201 ILE OXT HXT sing N N 202 LEU N CA sing N N 203 LEU N H sing N N 204 LEU N H2 sing N N 205 LEU CA C sing N N 206 LEU CA CB sing N N 207 LEU CA HA sing N N 208 LEU C O doub N N 209 LEU C OXT sing N N 210 LEU CB CG sing N N 211 LEU CB HB2 sing N N 212 LEU CB HB3 sing N N 213 LEU CG CD1 sing N N 214 LEU CG CD2 sing N N 215 LEU CG HG sing N N 216 LEU CD1 HD11 sing N N 217 LEU CD1 HD12 sing N N 218 LEU CD1 HD13 sing N N 219 LEU CD2 HD21 sing N N 220 LEU CD2 HD22 sing N N 221 LEU CD2 HD23 sing N N 222 LEU OXT HXT sing N N 223 LYS N CA sing N N 224 LYS N H sing N N 225 LYS N H2 sing N N 226 LYS CA C sing N N 227 LYS CA CB sing N N 228 LYS CA HA sing N N 229 LYS C O doub N N 230 LYS C OXT sing N N 231 LYS CB CG sing N N 232 LYS CB HB2 sing N N 233 LYS CB HB3 sing N N 234 LYS CG CD sing N N 235 LYS CG HG2 sing N N 236 LYS CG HG3 sing N N 237 LYS CD CE sing N N 238 LYS CD HD2 sing N N 239 LYS CD HD3 sing N N 240 LYS CE NZ sing N N 241 LYS CE HE2 sing N N 242 LYS CE HE3 sing N N 243 LYS NZ HZ1 sing N N 244 LYS NZ HZ2 sing N N 245 LYS NZ HZ3 sing N N 246 LYS OXT HXT sing N N 247 MET N CA sing N N 248 MET N H sing N N 249 MET N H2 sing N N 250 MET CA C sing N N 251 MET CA CB sing N N 252 MET CA HA sing N N 253 MET C O doub N N 254 MET C OXT sing N N 255 MET CB CG sing N N 256 MET CB HB2 sing N N 257 MET CB HB3 sing N N 258 MET CG SD sing N N 259 MET CG HG2 sing N N 260 MET CG HG3 sing N N 261 MET SD CE sing N N 262 MET CE HE1 sing N N 263 MET CE HE2 sing N N 264 MET CE HE3 sing N N 265 MET OXT HXT sing N N 266 PHE N CA sing N N 267 PHE N H sing N N 268 PHE N H2 sing N N 269 PHE CA C sing N N 270 PHE CA CB sing N N 271 PHE CA HA sing N N 272 PHE C O doub N N 273 PHE C OXT sing N N 274 PHE CB CG sing N N 275 PHE CB HB2 sing N N 276 PHE CB HB3 sing N N 277 PHE CG CD1 doub Y N 278 PHE CG CD2 sing Y N 279 PHE CD1 CE1 sing Y N 280 PHE CD1 HD1 sing N N 281 PHE CD2 CE2 doub Y N 282 PHE CD2 HD2 sing N N 283 PHE CE1 CZ doub Y N 284 PHE CE1 HE1 sing N N 285 PHE CE2 CZ sing Y N 286 PHE CE2 HE2 sing N N 287 PHE CZ HZ sing N N 288 PHE OXT HXT sing N N 289 PRO N CA sing N N 290 PRO N CD sing N N 291 PRO N H sing N N 292 PRO CA C sing N N 293 PRO CA CB sing N N 294 PRO CA HA sing N N 295 PRO C O doub N N 296 PRO C OXT sing N N 297 PRO CB CG sing N N 298 PRO CB HB2 sing N N 299 PRO CB HB3 sing N N 300 PRO CG CD sing N N 301 PRO CG HG2 sing N N 302 PRO CG HG3 sing N N 303 PRO CD HD2 sing N N 304 PRO CD HD3 sing N N 305 PRO OXT HXT sing N N 306 SER N CA sing N N 307 SER N H sing N N 308 SER N H2 sing N N 309 SER CA C sing N N 310 SER CA CB sing N N 311 SER CA HA sing N N 312 SER C O doub N N 313 SER C OXT sing N N 314 SER CB OG sing N N 315 SER CB HB2 sing N N 316 SER CB HB3 sing N N 317 SER OG HG sing N N 318 SER OXT HXT sing N N 319 THR N CA sing N N 320 THR N H sing N N 321 THR N H2 sing N N 322 THR CA C sing N N 323 THR CA CB sing N N 324 THR CA HA sing N N 325 THR C O doub N N 326 THR C OXT sing N N 327 THR CB OG1 sing N N 328 THR CB CG2 sing N N 329 THR CB HB sing N N 330 THR OG1 HG1 sing N N 331 THR CG2 HG21 sing N N 332 THR CG2 HG22 sing N N 333 THR CG2 HG23 sing N N 334 THR OXT HXT sing N N 335 TRP N CA sing N N 336 TRP N H sing N N 337 TRP N H2 sing N N 338 TRP CA C sing N N 339 TRP CA CB sing N N 340 TRP CA HA sing N N 341 TRP C O doub N N 342 TRP C OXT sing N N 343 TRP CB CG sing N N 344 TRP CB HB2 sing N N 345 TRP CB HB3 sing N N 346 TRP CG CD1 doub Y N 347 TRP CG CD2 sing Y N 348 TRP CD1 NE1 sing Y N 349 TRP CD1 HD1 sing N N 350 TRP CD2 CE2 doub Y N 351 TRP CD2 CE3 sing Y N 352 TRP NE1 CE2 sing Y N 353 TRP NE1 HE1 sing N N 354 TRP CE2 CZ2 sing Y N 355 TRP CE3 CZ3 doub Y N 356 TRP CE3 HE3 sing N N 357 TRP CZ2 CH2 doub Y N 358 TRP CZ2 HZ2 sing N N 359 TRP CZ3 CH2 sing Y N 360 TRP CZ3 HZ3 sing N N 361 TRP CH2 HH2 sing N N 362 TRP OXT HXT sing N N 363 TYR N CA sing N N 364 TYR N H sing N N 365 TYR N H2 sing N N 366 TYR CA C sing N N 367 TYR CA CB sing N N 368 TYR CA HA sing N N 369 TYR C O doub N N 370 TYR C OXT sing N N 371 TYR CB CG sing N N 372 TYR CB HB2 sing N N 373 TYR CB HB3 sing N N 374 TYR CG CD1 doub Y N 375 TYR CG CD2 sing Y N 376 TYR CD1 CE1 sing Y N 377 TYR CD1 HD1 sing N N 378 TYR CD2 CE2 doub Y N 379 TYR CD2 HD2 sing N N 380 TYR CE1 CZ doub Y N 381 TYR CE1 HE1 sing N N 382 TYR CE2 CZ sing Y N 383 TYR CE2 HE2 sing N N 384 TYR CZ OH sing N N 385 TYR OH HH sing N N 386 TYR OXT HXT sing N N 387 VAL N CA sing N N 388 VAL N H sing N N 389 VAL N H2 sing N N 390 VAL CA C sing N N 391 VAL CA CB sing N N 392 VAL CA HA sing N N 393 VAL C O doub N N 394 VAL C OXT sing N N 395 VAL CB CG1 sing N N 396 VAL CB CG2 sing N N 397 VAL CB HB sing N N 398 VAL CG1 HG11 sing N N 399 VAL CG1 HG12 sing N N 400 VAL CG1 HG13 sing N N 401 VAL CG2 HG21 sing N N 402 VAL CG2 HG22 sing N N 403 VAL CG2 HG23 sing N N 404 VAL OXT HXT sing N N 405 # _pdbx_audit_support.funding_organization 'German Research Foundation (DFG)' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number 'SFB 1309 - 325871075' _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 9F5V _pdbx_initial_refinement_model.details 'Crystal structure of thiol peroxidase from Helicobacter pylori (HpTx, reduced)' # _atom_sites.entry_id 9F64 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.014843 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.007210 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013990 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.027268 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N NA O S # loop_ # loop_ #