data_9FOE # _entry.id 9FOE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.406 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9FOE pdb_00009foe 10.2210/pdb9foe/pdb WWPDB D_1292139347 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-09-03 ? 2 'Structure model' 1 1 2025-10-01 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9FOE _pdbx_database_status.recvd_initial_deposition_date 2024-06-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 9FOC _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email gavin.collie@astrazeneca.com _pdbx_contact_author.name_first Gavin _pdbx_contact_author.name_last Collie _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-0406-922X # _audit_author.name 'Collie, G.W.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Med.Chem.Lett.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1948-5875 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 16 _citation.language ? _citation.page_first 1703 _citation.page_last 1708 _citation.title ;Structural and Molecular Insight into the PWWP1 Domain of NSD2 from the Discovery of Novel Binders Via DNA-Encoded Library Screening. ; _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsmedchemlett.5c00396 _citation.pdbx_database_id_PubMed 40959233 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Collie, G.W.' 1 ? primary 'Ackroyd, B.' 2 ? primary 'Corbishley, C.' 3 ? primary ;O'Donovan, D.H. ; 4 ? primary 'Edwards, A.' 5 ? primary 'Gohlke, A.' 6 ? primary 'Guo, X.' 7 ? primary 'Howells, B.' 8 ? primary 'Li, Y.' 9 ? primary 'Madin, A.' 10 ? primary 'Milbradt, A.G.' 11 ? primary 'Rivers, E.L.' 12 ? primary 'Talapatra, S.K.' 13 ? primary 'Underwood, E.' 14 ? primary 'Webb, A.' 15 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Histone-lysine N-methyltransferase NSD2' 19085.719 1 2.1.1.357 'K256A, K257A, K304A, K312A, D351A, E285A, E291A' ? ? 2 non-polymer syn '1-[[(2~{S})-1-[4-[ethyl(pyridin-4-ylmethyl)amino]-6-methyl-pyrimidin-2-yl]pyrrolidin-2-yl]methyl]urea' 369.464 1 ? ? ? ? 3 water nat water 18.015 38 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Multiple myeloma SET domain-containing protein,MMSET,Nuclear SET domain-containing protein 2,Protein trithorax-5,Wolf-Hirschhorn syndrome candidate 1 protein ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGGGPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQAASARQYHVQFFGDAPERAWIFEKSLVA FAGEGQFAKLCQESAKQAPTAAEKIKLLAPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGAQLHLNPQVAKEA GIAAEGGGENLYFQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MGGGPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQAASARQYHVQFFGDAPERAWIFEKSLVA FAGEGQFAKLCQESAKQAPTAAEKIKLLAPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGAQLHLNPQVAKEA GIAAEGGGENLYFQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '1-[[(2~{S})-1-[4-[ethyl(pyridin-4-ylmethyl)amino]-6-methyl-pyrimidin-2-yl]pyrrolidin-2-yl]methyl]urea' A1IEF 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 GLY n 1 4 GLY n 1 5 PRO n 1 6 ASN n 1 7 THR n 1 8 GLY n 1 9 ARG n 1 10 ASP n 1 11 LYS n 1 12 ASP n 1 13 HIS n 1 14 LEU n 1 15 LEU n 1 16 LYS n 1 17 TYR n 1 18 ASN n 1 19 VAL n 1 20 GLY n 1 21 ASP n 1 22 LEU n 1 23 VAL n 1 24 TRP n 1 25 SER n 1 26 LYS n 1 27 VAL n 1 28 SER n 1 29 GLY n 1 30 TYR n 1 31 PRO n 1 32 TRP n 1 33 TRP n 1 34 PRO n 1 35 CYS n 1 36 MET n 1 37 VAL n 1 38 SER n 1 39 ALA n 1 40 ASP n 1 41 PRO n 1 42 LEU n 1 43 LEU n 1 44 HIS n 1 45 SER n 1 46 TYR n 1 47 THR n 1 48 LYS n 1 49 LEU n 1 50 LYS n 1 51 GLY n 1 52 GLN n 1 53 ALA n 1 54 ALA n 1 55 SER n 1 56 ALA n 1 57 ARG n 1 58 GLN n 1 59 TYR n 1 60 HIS n 1 61 VAL n 1 62 GLN n 1 63 PHE n 1 64 PHE n 1 65 GLY n 1 66 ASP n 1 67 ALA n 1 68 PRO n 1 69 GLU n 1 70 ARG n 1 71 ALA n 1 72 TRP n 1 73 ILE n 1 74 PHE n 1 75 GLU n 1 76 LYS n 1 77 SER n 1 78 LEU n 1 79 VAL n 1 80 ALA n 1 81 PHE n 1 82 ALA n 1 83 GLY n 1 84 GLU n 1 85 GLY n 1 86 GLN n 1 87 PHE n 1 88 ALA n 1 89 LYS n 1 90 LEU n 1 91 CYS n 1 92 GLN n 1 93 GLU n 1 94 SER n 1 95 ALA n 1 96 LYS n 1 97 GLN n 1 98 ALA n 1 99 PRO n 1 100 THR n 1 101 ALA n 1 102 ALA n 1 103 GLU n 1 104 LYS n 1 105 ILE n 1 106 LYS n 1 107 LEU n 1 108 LEU n 1 109 ALA n 1 110 PRO n 1 111 ILE n 1 112 SER n 1 113 GLY n 1 114 LYS n 1 115 LEU n 1 116 ARG n 1 117 ALA n 1 118 GLN n 1 119 TRP n 1 120 GLU n 1 121 MET n 1 122 GLY n 1 123 ILE n 1 124 VAL n 1 125 GLN n 1 126 ALA n 1 127 GLU n 1 128 GLU n 1 129 ALA n 1 130 ALA n 1 131 SER n 1 132 MET n 1 133 SER n 1 134 VAL n 1 135 GLU n 1 136 GLU n 1 137 ARG n 1 138 LYS n 1 139 ALA n 1 140 LYS n 1 141 PHE n 1 142 THR n 1 143 PHE n 1 144 LEU n 1 145 TYR n 1 146 VAL n 1 147 GLY n 1 148 ALA n 1 149 GLN n 1 150 LEU n 1 151 HIS n 1 152 LEU n 1 153 ASN n 1 154 PRO n 1 155 GLN n 1 156 VAL n 1 157 ALA n 1 158 LYS n 1 159 GLU n 1 160 ALA n 1 161 GLY n 1 162 ILE n 1 163 ALA n 1 164 ALA n 1 165 GLU n 1 166 GLY n 1 167 GLY n 1 168 GLY n 1 169 GLU n 1 170 ASN n 1 171 LEU n 1 172 TYR n 1 173 PHE n 1 174 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 174 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'NSD2, KIAA1090, MMSET, TRX5, WHSC1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1IEF non-polymer . '1-[[(2~{S})-1-[4-[ethyl(pyridin-4-ylmethyl)amino]-6-methyl-pyrimidin-2-yl]pyrrolidin-2-yl]methyl]urea' ? 'C19 H27 N7 O' 369.464 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 204 ? ? ? A . n A 1 2 GLY 2 205 ? ? ? A . n A 1 3 GLY 3 206 ? ? ? A . n A 1 4 GLY 4 207 ? ? ? A . n A 1 5 PRO 5 208 ? ? ? A . n A 1 6 ASN 6 209 ? ? ? A . n A 1 7 THR 7 210 ? ? ? A . n A 1 8 GLY 8 211 ? ? ? A . n A 1 9 ARG 9 212 ? ? ? A . n A 1 10 ASP 10 213 ? ? ? A . n A 1 11 LYS 11 214 ? ? ? A . n A 1 12 ASP 12 215 ? ? ? A . n A 1 13 HIS 13 216 ? ? ? A . n A 1 14 LEU 14 217 ? ? ? A . n A 1 15 LEU 15 218 218 LEU LEU A . n A 1 16 LYS 16 219 219 LYS LYS A . n A 1 17 TYR 17 220 220 TYR TYR A . n A 1 18 ASN 18 221 221 ASN ASN A . n A 1 19 VAL 19 222 222 VAL VAL A . n A 1 20 GLY 20 223 223 GLY GLY A . n A 1 21 ASP 21 224 224 ASP ASP A . n A 1 22 LEU 22 225 225 LEU LEU A . n A 1 23 VAL 23 226 226 VAL VAL A . n A 1 24 TRP 24 227 227 TRP TRP A . n A 1 25 SER 25 228 228 SER SER A . n A 1 26 LYS 26 229 229 LYS LYS A . n A 1 27 VAL 27 230 230 VAL VAL A . n A 1 28 SER 28 231 231 SER SER A . n A 1 29 GLY 29 232 232 GLY GLY A . n A 1 30 TYR 30 233 233 TYR TYR A . n A 1 31 PRO 31 234 234 PRO PRO A . n A 1 32 TRP 32 235 235 TRP TRP A . n A 1 33 TRP 33 236 236 TRP TRP A . n A 1 34 PRO 34 237 237 PRO PRO A . n A 1 35 CYS 35 238 238 CYS CYS A . n A 1 36 MET 36 239 239 MET MET A . n A 1 37 VAL 37 240 240 VAL VAL A . n A 1 38 SER 38 241 241 SER SER A . n A 1 39 ALA 39 242 242 ALA ALA A . n A 1 40 ASP 40 243 243 ASP ASP A . n A 1 41 PRO 41 244 244 PRO PRO A . n A 1 42 LEU 42 245 245 LEU LEU A . n A 1 43 LEU 43 246 246 LEU LEU A . n A 1 44 HIS 44 247 247 HIS HIS A . n A 1 45 SER 45 248 248 SER SER A . n A 1 46 TYR 46 249 249 TYR TYR A . n A 1 47 THR 47 250 250 THR THR A . n A 1 48 LYS 48 251 251 LYS LYS A . n A 1 49 LEU 49 252 252 LEU LEU A . n A 1 50 LYS 50 253 ? ? ? A . n A 1 51 GLY 51 254 ? ? ? A . n A 1 52 GLN 52 255 ? ? ? A . n A 1 53 ALA 53 256 ? ? ? A . n A 1 54 ALA 54 257 ? ? ? A . n A 1 55 SER 55 258 ? ? ? A . n A 1 56 ALA 56 259 259 ALA ALA A . n A 1 57 ARG 57 260 260 ARG ARG A . n A 1 58 GLN 58 261 261 GLN GLN A . n A 1 59 TYR 59 262 262 TYR TYR A . n A 1 60 HIS 60 263 263 HIS HIS A . n A 1 61 VAL 61 264 264 VAL VAL A . n A 1 62 GLN 62 265 265 GLN GLN A . n A 1 63 PHE 63 266 266 PHE PHE A . n A 1 64 PHE 64 267 267 PHE PHE A . n A 1 65 GLY 65 268 268 GLY GLY A . n A 1 66 ASP 66 269 269 ASP ASP A . n A 1 67 ALA 67 270 270 ALA ALA A . n A 1 68 PRO 68 271 271 PRO PRO A . n A 1 69 GLU 69 272 272 GLU GLU A . n A 1 70 ARG 70 273 273 ARG ARG A . n A 1 71 ALA 71 274 274 ALA ALA A . n A 1 72 TRP 72 275 275 TRP TRP A . n A 1 73 ILE 73 276 276 ILE ILE A . n A 1 74 PHE 74 277 277 PHE PHE A . n A 1 75 GLU 75 278 278 GLU GLU A . n A 1 76 LYS 76 279 279 LYS LYS A . n A 1 77 SER 77 280 280 SER SER A . n A 1 78 LEU 78 281 281 LEU LEU A . n A 1 79 VAL 79 282 282 VAL VAL A . n A 1 80 ALA 80 283 283 ALA ALA A . n A 1 81 PHE 81 284 284 PHE PHE A . n A 1 82 ALA 82 285 285 ALA ALA A . n A 1 83 GLY 83 286 ? ? ? A . n A 1 84 GLU 84 287 ? ? ? A . n A 1 85 GLY 85 288 ? ? ? A . n A 1 86 GLN 86 289 ? ? ? A . n A 1 87 PHE 87 290 ? ? ? A . n A 1 88 ALA 88 291 ? ? ? A . n A 1 89 LYS 89 292 ? ? ? A . n A 1 90 LEU 90 293 ? ? ? A . n A 1 91 CYS 91 294 ? ? ? A . n A 1 92 GLN 92 295 ? ? ? A . n A 1 93 GLU 93 296 ? ? ? A . n A 1 94 SER 94 297 ? ? ? A . n A 1 95 ALA 95 298 ? ? ? A . n A 1 96 LYS 96 299 ? ? ? A . n A 1 97 GLN 97 300 ? ? ? A . n A 1 98 ALA 98 301 ? ? ? A . n A 1 99 PRO 99 302 ? ? ? A . n A 1 100 THR 100 303 ? ? ? A . n A 1 101 ALA 101 304 304 ALA ALA A . n A 1 102 ALA 102 305 305 ALA ALA A . n A 1 103 GLU 103 306 306 GLU GLU A . n A 1 104 LYS 104 307 307 LYS LYS A . n A 1 105 ILE 105 308 308 ILE ILE A . n A 1 106 LYS 106 309 309 LYS LYS A . n A 1 107 LEU 107 310 310 LEU LEU A . n A 1 108 LEU 108 311 311 LEU LEU A . n A 1 109 ALA 109 312 312 ALA ALA A . n A 1 110 PRO 110 313 313 PRO PRO A . n A 1 111 ILE 111 314 314 ILE ILE A . n A 1 112 SER 112 315 315 SER SER A . n A 1 113 GLY 113 316 316 GLY GLY A . n A 1 114 LYS 114 317 317 LYS LYS A . n A 1 115 LEU 115 318 318 LEU LEU A . n A 1 116 ARG 116 319 319 ARG ARG A . n A 1 117 ALA 117 320 320 ALA ALA A . n A 1 118 GLN 118 321 321 GLN GLN A . n A 1 119 TRP 119 322 322 TRP TRP A . n A 1 120 GLU 120 323 323 GLU GLU A . n A 1 121 MET 121 324 324 MET MET A . n A 1 122 GLY 122 325 325 GLY GLY A . n A 1 123 ILE 123 326 326 ILE ILE A . n A 1 124 VAL 124 327 327 VAL VAL A . n A 1 125 GLN 125 328 328 GLN GLN A . n A 1 126 ALA 126 329 329 ALA ALA A . n A 1 127 GLU 127 330 330 GLU GLU A . n A 1 128 GLU 128 331 331 GLU GLU A . n A 1 129 ALA 129 332 332 ALA ALA A . n A 1 130 ALA 130 333 333 ALA ALA A . n A 1 131 SER 131 334 334 SER SER A . n A 1 132 MET 132 335 335 MET MET A . n A 1 133 SER 133 336 336 SER SER A . n A 1 134 VAL 134 337 337 VAL VAL A . n A 1 135 GLU 135 338 338 GLU GLU A . n A 1 136 GLU 136 339 339 GLU GLU A . n A 1 137 ARG 137 340 340 ARG ARG A . n A 1 138 LYS 138 341 341 LYS LYS A . n A 1 139 ALA 139 342 342 ALA ALA A . n A 1 140 LYS 140 343 343 LYS LYS A . n A 1 141 PHE 141 344 344 PHE PHE A . n A 1 142 THR 142 345 345 THR THR A . n A 1 143 PHE 143 346 346 PHE PHE A . n A 1 144 LEU 144 347 347 LEU LEU A . n A 1 145 TYR 145 348 348 TYR TYR A . n A 1 146 VAL 146 349 349 VAL VAL A . n A 1 147 GLY 147 350 350 GLY GLY A . n A 1 148 ALA 148 351 351 ALA ALA A . n A 1 149 GLN 149 352 352 GLN GLN A . n A 1 150 LEU 150 353 353 LEU LEU A . n A 1 151 HIS 151 354 354 HIS HIS A . n A 1 152 LEU 152 355 355 LEU LEU A . n A 1 153 ASN 153 356 356 ASN ASN A . n A 1 154 PRO 154 357 357 PRO PRO A . n A 1 155 GLN 155 358 358 GLN GLN A . n A 1 156 VAL 156 359 359 VAL VAL A . n A 1 157 ALA 157 360 360 ALA ALA A . n A 1 158 LYS 158 361 361 LYS LYS A . n A 1 159 GLU 159 362 ? ? ? A . n A 1 160 ALA 160 363 ? ? ? A . n A 1 161 GLY 161 364 ? ? ? A . n A 1 162 ILE 162 365 ? ? ? A . n A 1 163 ALA 163 366 ? ? ? A . n A 1 164 ALA 164 367 ? ? ? A . n A 1 165 GLU 165 368 ? ? ? A . n A 1 166 GLY 166 369 ? ? ? A . n A 1 167 GLY 167 370 ? ? ? A . n A 1 168 GLY 168 371 ? ? ? A . n A 1 169 GLU 169 372 ? ? ? A . n A 1 170 ASN 170 373 ? ? ? A . n A 1 171 LEU 171 374 ? ? ? A . n A 1 172 TYR 172 375 ? ? ? A . n A 1 173 PHE 173 376 ? ? ? A . n A 1 174 GLN 174 377 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1IEF _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1IEF _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 A1IEF 1 401 401 A1IEF INH A . C 3 HOH 1 501 10 HOH HOH A . C 3 HOH 2 502 29 HOH HOH A . C 3 HOH 3 503 32 HOH HOH A . C 3 HOH 4 504 22 HOH HOH A . C 3 HOH 5 505 33 HOH HOH A . C 3 HOH 6 506 19 HOH HOH A . C 3 HOH 7 507 11 HOH HOH A . C 3 HOH 8 508 15 HOH HOH A . C 3 HOH 9 509 3 HOH HOH A . C 3 HOH 10 510 1 HOH HOH A . C 3 HOH 11 511 38 HOH HOH A . C 3 HOH 12 512 27 HOH HOH A . C 3 HOH 13 513 7 HOH HOH A . C 3 HOH 14 514 25 HOH HOH A . C 3 HOH 15 515 23 HOH HOH A . C 3 HOH 16 516 16 HOH HOH A . C 3 HOH 17 517 2 HOH HOH A . C 3 HOH 18 518 37 HOH HOH A . C 3 HOH 19 519 9 HOH HOH A . C 3 HOH 20 520 4 HOH HOH A . C 3 HOH 21 521 30 HOH HOH A . C 3 HOH 22 522 20 HOH HOH A . C 3 HOH 23 523 12 HOH HOH A . C 3 HOH 24 524 26 HOH HOH A . C 3 HOH 25 525 17 HOH HOH A . C 3 HOH 26 526 6 HOH HOH A . C 3 HOH 27 527 18 HOH HOH A . C 3 HOH 28 528 31 HOH HOH A . C 3 HOH 29 529 14 HOH HOH A . C 3 HOH 30 530 28 HOH HOH A . C 3 HOH 31 531 8 HOH HOH A . C 3 HOH 32 532 13 HOH HOH A . C 3 HOH 33 533 21 HOH HOH A . C 3 HOH 34 534 24 HOH HOH A . C 3 HOH 35 535 5 HOH HOH A . C 3 HOH 36 536 36 HOH HOH A . C 3 HOH 37 537 35 HOH HOH A . C 3 HOH 38 538 34 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 219 ? CG ? A LYS 16 CG 2 1 Y 1 A LYS 219 ? CD ? A LYS 16 CD 3 1 Y 1 A LYS 219 ? CE ? A LYS 16 CE 4 1 Y 1 A LYS 219 ? NZ ? A LYS 16 NZ 5 1 Y 1 A GLU 278 ? CG ? A GLU 75 CG 6 1 Y 1 A GLU 278 ? CD ? A GLU 75 CD 7 1 Y 1 A GLU 278 ? OE1 ? A GLU 75 OE1 8 1 Y 1 A GLU 278 ? OE2 ? A GLU 75 OE2 9 1 Y 1 A LYS 307 ? CG ? A LYS 104 CG 10 1 Y 1 A LYS 307 ? CD ? A LYS 104 CD 11 1 Y 1 A LYS 307 ? CE ? A LYS 104 CE 12 1 Y 1 A LYS 307 ? NZ ? A LYS 104 NZ 13 1 Y 1 A LYS 317 ? CG ? A LYS 114 CG 14 1 Y 1 A LYS 317 ? CD ? A LYS 114 CD 15 1 Y 1 A LYS 317 ? CE ? A LYS 114 CE 16 1 Y 1 A LYS 317 ? NZ ? A LYS 114 NZ 17 1 Y 1 A LYS 361 ? CG ? A LYS 158 CG 18 1 Y 1 A LYS 361 ? CD ? A LYS 158 CD 19 1 Y 1 A LYS 361 ? CE ? A LYS 158 CE 20 1 Y 1 A LYS 361 ? NZ ? A LYS 158 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? '2.11.8 (8-JUN-2022)' 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9FOE _cell.details ? _cell.formula_units_Z ? _cell.length_a 54.272 _cell.length_a_esd ? _cell.length_b 54.272 _cell.length_b_esd ? _cell.length_c 125.742 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9FOE _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9FOE _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.43 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.29 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '3.5 M sodium formate' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-09-17 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9FOE _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.963 _reflns.d_resolution_low 49.83 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11750 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 83.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.6 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.093 _reflns.pdbx_Rpim_I_all 0.027 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.089 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.963 _reflns_shell.d_res_low 2.104 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all 7138 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 582 _reflns_shell.percent_possible_obs 22.6 _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 12.3 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 1.5 _reflns_shell.pdbx_Rrim_I_all 2.088 _reflns_shell.pdbx_Rpim_I_all 0.594 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 2.000 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -0.55920 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] 0.00000 _refine.aniso_B[2][2] -0.55920 _refine.aniso_B[2][3] 0.00000 _refine.aniso_B[3][3] 1.11840 _refine.B_iso_max ? _refine.B_iso_mean 49.03 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.951 _refine.correlation_coeff_Fo_to_Fc_free 0.950 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9FOE _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.963 _refine.ls_d_res_low 49.83 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11750 _refine.ls_number_reflns_R_free 608 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 83.2 _refine.ls_percent_reflns_R_free 5.170 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2277 _refine.ls_R_factor_R_free 0.2355 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2273 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.144 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.146 _refine.pdbx_overall_SU_R_Blow_DPI 0.177 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.171 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 9FOE _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.34 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 1.963 _refine_hist.d_res_low 49.83 _refine_hist.number_atoms_solvent 38 _refine_hist.number_atoms_total 1007 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 942 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 27 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 1002 ? t_bond_d 2.00 HARMONIC 'X-RAY DIFFRACTION' ? 0.95 ? 1363 ? t_angle_deg 2.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 326 ? t_dihedral_angle_d 2.00 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_incorr_chiral_ct ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_trig_c_planes ? ? 'X-RAY DIFFRACTION' ? ? ? 163 ? t_gen_planes 5.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1002 ? t_it 10.00 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? 3.90 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 16.32 ? ? ? t_other_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 122 ? t_chiral_improper_torsion 5.00 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 824 ? t_ideal_dist_contact 4.00 SEMIHARMONIC # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.963 _refine_ls_shell.d_res_low 2.08 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free ? _refine_ls_shell.number_reflns_R_work 372 _refine_ls_shell.percent_reflns_obs 17.82 _refine_ls_shell.percent_reflns_R_free 5.10 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.3121 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.2972 # _struct.entry_id 9FOE _struct.title 'Crystal structure of the PWWP1 domain of NSD2 bound by compound 7.' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9FOE _struct_keywords.text 'drug discovery, NSD2, DEL, cancer research, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NSD2_HUMAN _struct_ref.pdbx_db_accession O96028 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFGDAPERAWIFEKSLVAFEGE GQFEKLCQESAKQAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVAKEAGIAA E ; _struct_ref.pdbx_align_begin 208 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9FOE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 165 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O96028 _struct_ref_seq.db_align_beg 208 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 368 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 208 _struct_ref_seq.pdbx_auth_seq_align_end 368 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9FOE MET A 1 ? UNP O96028 ? ? 'initiating methionine' 204 1 1 9FOE GLY A 2 ? UNP O96028 ? ? 'expression tag' 205 2 1 9FOE GLY A 3 ? UNP O96028 ? ? 'expression tag' 206 3 1 9FOE GLY A 4 ? UNP O96028 ? ? 'expression tag' 207 4 1 9FOE ALA A 53 ? UNP O96028 LYS 256 'engineered mutation' 256 5 1 9FOE ALA A 54 ? UNP O96028 LYS 257 'engineered mutation' 257 6 1 9FOE ALA A 82 ? UNP O96028 GLU 285 'engineered mutation' 285 7 1 9FOE ALA A 88 ? UNP O96028 GLU 291 'engineered mutation' 291 8 1 9FOE ALA A 101 ? UNP O96028 LYS 304 'engineered mutation' 304 9 1 9FOE ALA A 109 ? UNP O96028 LYS 312 'engineered mutation' 312 10 1 9FOE ALA A 148 ? UNP O96028 ASP 351 'engineered mutation' 351 11 1 9FOE GLY A 166 ? UNP O96028 ? ? 'expression tag' 369 12 1 9FOE GLY A 167 ? UNP O96028 ? ? 'expression tag' 370 13 1 9FOE GLY A 168 ? UNP O96028 ? ? 'expression tag' 371 14 1 9FOE GLU A 169 ? UNP O96028 ? ? 'expression tag' 372 15 1 9FOE ASN A 170 ? UNP O96028 ? ? 'expression tag' 373 16 1 9FOE LEU A 171 ? UNP O96028 ? ? 'expression tag' 374 17 1 9FOE TYR A 172 ? UNP O96028 ? ? 'expression tag' 375 18 1 9FOE PHE A 173 ? UNP O96028 ? ? 'expression tag' 376 19 1 9FOE GLN A 174 ? UNP O96028 ? ? 'expression tag' 377 20 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 6790 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 101 ? ILE A 105 ? ALA A 304 ILE A 308 5 ? 5 HELX_P HELX_P2 AA2 SER A 112 ? SER A 131 ? SER A 315 SER A 334 1 ? 20 HELX_P HELX_P3 AA3 SER A 133 ? THR A 142 ? SER A 336 THR A 345 1 ? 10 HELX_P HELX_P4 AA4 ASN A 153 ? LYS A 158 ? ASN A 356 LYS A 361 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 5 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 47 ? LYS A 48 ? THR A 250 LYS A 251 AA1 2 GLN A 58 ? PHE A 63 ? GLN A 261 PHE A 266 AA1 3 GLU A 69 ? PHE A 74 ? GLU A 272 PHE A 277 AA2 1 THR A 47 ? LYS A 48 ? THR A 250 LYS A 251 AA2 2 GLN A 58 ? PHE A 63 ? GLN A 261 PHE A 266 AA2 3 TRP A 33 ? VAL A 37 ? TRP A 236 VAL A 240 AA2 4 LEU A 22 ? SER A 25 ? LEU A 225 SER A 228 AA2 5 LEU A 78 ? ALA A 80 ? LEU A 281 ALA A 283 AA3 1 LEU A 144 ? VAL A 146 ? LEU A 347 VAL A 349 AA3 2 GLN A 149 ? HIS A 151 ? GLN A 352 HIS A 354 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LYS A 48 ? N LYS A 251 O GLN A 58 ? O GLN A 261 AA1 2 3 N TYR A 59 ? N TYR A 262 O ILE A 73 ? O ILE A 276 AA2 1 2 N LYS A 48 ? N LYS A 251 O GLN A 58 ? O GLN A 261 AA2 2 3 O GLN A 62 ? O GLN A 265 N MET A 36 ? N MET A 239 AA2 3 4 O CYS A 35 ? O CYS A 238 N VAL A 23 ? N VAL A 226 AA2 4 5 N TRP A 24 ? N TRP A 227 O VAL A 79 ? O VAL A 282 AA3 1 2 N VAL A 146 ? N VAL A 349 O GLN A 149 ? O GLN A 352 # _pdbx_entry_details.entry_id 9FOE _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 204 ? A MET 1 2 1 Y 1 A GLY 205 ? A GLY 2 3 1 Y 1 A GLY 206 ? A GLY 3 4 1 Y 1 A GLY 207 ? A GLY 4 5 1 Y 1 A PRO 208 ? A PRO 5 6 1 Y 1 A ASN 209 ? A ASN 6 7 1 Y 1 A THR 210 ? A THR 7 8 1 Y 1 A GLY 211 ? A GLY 8 9 1 Y 1 A ARG 212 ? A ARG 9 10 1 Y 1 A ASP 213 ? A ASP 10 11 1 Y 1 A LYS 214 ? A LYS 11 12 1 Y 1 A ASP 215 ? A ASP 12 13 1 Y 1 A HIS 216 ? A HIS 13 14 1 Y 1 A LEU 217 ? A LEU 14 15 1 Y 1 A LYS 253 ? A LYS 50 16 1 Y 1 A GLY 254 ? A GLY 51 17 1 Y 1 A GLN 255 ? A GLN 52 18 1 Y 1 A ALA 256 ? A ALA 53 19 1 Y 1 A ALA 257 ? A ALA 54 20 1 Y 1 A SER 258 ? A SER 55 21 1 Y 1 A GLY 286 ? A GLY 83 22 1 Y 1 A GLU 287 ? A GLU 84 23 1 Y 1 A GLY 288 ? A GLY 85 24 1 Y 1 A GLN 289 ? A GLN 86 25 1 Y 1 A PHE 290 ? A PHE 87 26 1 Y 1 A ALA 291 ? A ALA 88 27 1 Y 1 A LYS 292 ? A LYS 89 28 1 Y 1 A LEU 293 ? A LEU 90 29 1 Y 1 A CYS 294 ? A CYS 91 30 1 Y 1 A GLN 295 ? A GLN 92 31 1 Y 1 A GLU 296 ? A GLU 93 32 1 Y 1 A SER 297 ? A SER 94 33 1 Y 1 A ALA 298 ? A ALA 95 34 1 Y 1 A LYS 299 ? A LYS 96 35 1 Y 1 A GLN 300 ? A GLN 97 36 1 Y 1 A ALA 301 ? A ALA 98 37 1 Y 1 A PRO 302 ? A PRO 99 38 1 Y 1 A THR 303 ? A THR 100 39 1 Y 1 A GLU 362 ? A GLU 159 40 1 Y 1 A ALA 363 ? A ALA 160 41 1 Y 1 A GLY 364 ? A GLY 161 42 1 Y 1 A ILE 365 ? A ILE 162 43 1 Y 1 A ALA 366 ? A ALA 163 44 1 Y 1 A ALA 367 ? A ALA 164 45 1 Y 1 A GLU 368 ? A GLU 165 46 1 Y 1 A GLY 369 ? A GLY 166 47 1 Y 1 A GLY 370 ? A GLY 167 48 1 Y 1 A GLY 371 ? A GLY 168 49 1 Y 1 A GLU 372 ? A GLU 169 50 1 Y 1 A ASN 373 ? A ASN 170 51 1 Y 1 A LEU 374 ? A LEU 171 52 1 Y 1 A TYR 375 ? A TYR 172 53 1 Y 1 A PHE 376 ? A PHE 173 54 1 Y 1 A GLN 377 ? A GLN 174 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1IEF C1 C N N 1 A1IEF C2 C N N 2 A1IEF C3 C Y N 3 A1IEF N6 N N N 4 A1IEF C7 C Y N 5 A1IEF C8 C Y N 6 A1IEF C9 C Y N 7 A1IEF C10 C Y N 8 A1IEF C11 C N N 9 A1IEF C12 C Y N 10 A1IEF C13 C N N 11 A1IEF C14 C N N 12 A1IEF C15 C N N 13 A1IEF C16 C N S 14 A1IEF O O N N 15 A1IEF C18 C N N 16 A1IEF N5 N N N 17 A1IEF C17 C N N 18 A1IEF N4 N N N 19 A1IEF N2 N Y N 20 A1IEF N3 N Y N 21 A1IEF N N N N 22 A1IEF C C N N 23 A1IEF C6 C Y N 24 A1IEF N1 N Y N 25 A1IEF C5 C Y N 26 A1IEF C4 C Y N 27 A1IEF H1 H N N 28 A1IEF H2 H N N 29 A1IEF H3 H N N 30 A1IEF H4 H N N 31 A1IEF H5 H N N 32 A1IEF H6 H N N 33 A1IEF H7 H N N 34 A1IEF H8 H N N 35 A1IEF H9 H N N 36 A1IEF H10 H N N 37 A1IEF H11 H N N 38 A1IEF H12 H N N 39 A1IEF H13 H N N 40 A1IEF H14 H N N 41 A1IEF H15 H N N 42 A1IEF H16 H N N 43 A1IEF H17 H N N 44 A1IEF H18 H N N 45 A1IEF H19 H N N 46 A1IEF H20 H N N 47 A1IEF H21 H N N 48 A1IEF H22 H N N 49 A1IEF H23 H N N 50 A1IEF H24 H N N 51 A1IEF H25 H N N 52 A1IEF H26 H N N 53 A1IEF H27 H N N 54 ALA N N N N 55 ALA CA C N S 56 ALA C C N N 57 ALA O O N N 58 ALA CB C N N 59 ALA OXT O N N 60 ALA H H N N 61 ALA H2 H N N 62 ALA HA H N N 63 ALA HB1 H N N 64 ALA HB2 H N N 65 ALA HB3 H N N 66 ALA HXT H N N 67 ARG N N N N 68 ARG CA C N S 69 ARG C C N N 70 ARG O O N N 71 ARG CB C N N 72 ARG CG C N N 73 ARG CD C N N 74 ARG NE N N N 75 ARG CZ C N N 76 ARG NH1 N N N 77 ARG NH2 N N N 78 ARG OXT O N N 79 ARG H H N N 80 ARG H2 H N N 81 ARG HA H N N 82 ARG HB2 H N N 83 ARG HB3 H N N 84 ARG HG2 H N N 85 ARG HG3 H N N 86 ARG HD2 H N N 87 ARG HD3 H N N 88 ARG HE H N N 89 ARG HH11 H N N 90 ARG HH12 H N N 91 ARG HH21 H N N 92 ARG HH22 H N N 93 ARG HXT H N N 94 ASN N N N N 95 ASN CA C N S 96 ASN C C N N 97 ASN O O N N 98 ASN CB C N N 99 ASN CG C N N 100 ASN OD1 O N N 101 ASN ND2 N N N 102 ASN OXT O N N 103 ASN H H N N 104 ASN H2 H N N 105 ASN HA H N N 106 ASN HB2 H N N 107 ASN HB3 H N N 108 ASN HD21 H N N 109 ASN HD22 H N N 110 ASN HXT H N N 111 ASP N N N N 112 ASP CA C N S 113 ASP C C N N 114 ASP O O N N 115 ASP CB C N N 116 ASP CG C N N 117 ASP OD1 O N N 118 ASP OD2 O N N 119 ASP OXT O N N 120 ASP H H N N 121 ASP H2 H N N 122 ASP HA H N N 123 ASP HB2 H N N 124 ASP HB3 H N N 125 ASP HD2 H N N 126 ASP HXT H N N 127 CYS N N N N 128 CYS CA C N R 129 CYS C C N N 130 CYS O O N N 131 CYS CB C N N 132 CYS SG S N N 133 CYS OXT O N N 134 CYS H H N N 135 CYS H2 H N N 136 CYS HA H N N 137 CYS HB2 H N N 138 CYS HB3 H N N 139 CYS HG H N N 140 CYS HXT H N N 141 GLN N N N N 142 GLN CA C N S 143 GLN C C N N 144 GLN O O N N 145 GLN CB C N N 146 GLN CG C N N 147 GLN CD C N N 148 GLN OE1 O N N 149 GLN NE2 N N N 150 GLN OXT O N N 151 GLN H H N N 152 GLN H2 H N N 153 GLN HA H N N 154 GLN HB2 H N N 155 GLN HB3 H N N 156 GLN HG2 H N N 157 GLN HG3 H N N 158 GLN HE21 H N N 159 GLN HE22 H N N 160 GLN HXT H N N 161 GLU N N N N 162 GLU CA C N S 163 GLU C C N N 164 GLU O O N N 165 GLU CB C N N 166 GLU CG C N N 167 GLU CD C N N 168 GLU OE1 O N N 169 GLU OE2 O N N 170 GLU OXT O N N 171 GLU H H N N 172 GLU H2 H N N 173 GLU HA H N N 174 GLU HB2 H N N 175 GLU HB3 H N N 176 GLU HG2 H N N 177 GLU HG3 H N N 178 GLU HE2 H N N 179 GLU HXT H N N 180 GLY N N N N 181 GLY CA C N N 182 GLY C C N N 183 GLY O O N N 184 GLY OXT O N N 185 GLY H H N N 186 GLY H2 H N N 187 GLY HA2 H N N 188 GLY HA3 H N N 189 GLY HXT H N N 190 HIS N N N N 191 HIS CA C N S 192 HIS C C N N 193 HIS O O N N 194 HIS CB C N N 195 HIS CG C Y N 196 HIS ND1 N Y N 197 HIS CD2 C Y N 198 HIS CE1 C Y N 199 HIS NE2 N Y N 200 HIS OXT O N N 201 HIS H H N N 202 HIS H2 H N N 203 HIS HA H N N 204 HIS HB2 H N N 205 HIS HB3 H N N 206 HIS HD1 H N N 207 HIS HD2 H N N 208 HIS HE1 H N N 209 HIS HE2 H N N 210 HIS HXT H N N 211 HOH O O N N 212 HOH H1 H N N 213 HOH H2 H N N 214 ILE N N N N 215 ILE CA C N S 216 ILE C C N N 217 ILE O O N N 218 ILE CB C N S 219 ILE CG1 C N N 220 ILE CG2 C N N 221 ILE CD1 C N N 222 ILE OXT O N N 223 ILE H H N N 224 ILE H2 H N N 225 ILE HA H N N 226 ILE HB H N N 227 ILE HG12 H N N 228 ILE HG13 H N N 229 ILE HG21 H N N 230 ILE HG22 H N N 231 ILE HG23 H N N 232 ILE HD11 H N N 233 ILE HD12 H N N 234 ILE HD13 H N N 235 ILE HXT H N N 236 LEU N N N N 237 LEU CA C N S 238 LEU C C N N 239 LEU O O N N 240 LEU CB C N N 241 LEU CG C N N 242 LEU CD1 C N N 243 LEU CD2 C N N 244 LEU OXT O N N 245 LEU H H N N 246 LEU H2 H N N 247 LEU HA H N N 248 LEU HB2 H N N 249 LEU HB3 H N N 250 LEU HG H N N 251 LEU HD11 H N N 252 LEU HD12 H N N 253 LEU HD13 H N N 254 LEU HD21 H N N 255 LEU HD22 H N N 256 LEU HD23 H N N 257 LEU HXT H N N 258 LYS N N N N 259 LYS CA C N S 260 LYS C C N N 261 LYS O O N N 262 LYS CB C N N 263 LYS CG C N N 264 LYS CD C N N 265 LYS CE C N N 266 LYS NZ N N N 267 LYS OXT O N N 268 LYS H H N N 269 LYS H2 H N N 270 LYS HA H N N 271 LYS HB2 H N N 272 LYS HB3 H N N 273 LYS HG2 H N N 274 LYS HG3 H N N 275 LYS HD2 H N N 276 LYS HD3 H N N 277 LYS HE2 H N N 278 LYS HE3 H N N 279 LYS HZ1 H N N 280 LYS HZ2 H N N 281 LYS HZ3 H N N 282 LYS HXT H N N 283 MET N N N N 284 MET CA C N S 285 MET C C N N 286 MET O O N N 287 MET CB C N N 288 MET CG C N N 289 MET SD S N N 290 MET CE C N N 291 MET OXT O N N 292 MET H H N N 293 MET H2 H N N 294 MET HA H N N 295 MET HB2 H N N 296 MET HB3 H N N 297 MET HG2 H N N 298 MET HG3 H N N 299 MET HE1 H N N 300 MET HE2 H N N 301 MET HE3 H N N 302 MET HXT H N N 303 PHE N N N N 304 PHE CA C N S 305 PHE C C N N 306 PHE O O N N 307 PHE CB C N N 308 PHE CG C Y N 309 PHE CD1 C Y N 310 PHE CD2 C Y N 311 PHE CE1 C Y N 312 PHE CE2 C Y N 313 PHE CZ C Y N 314 PHE OXT O N N 315 PHE H H N N 316 PHE H2 H N N 317 PHE HA H N N 318 PHE HB2 H N N 319 PHE HB3 H N N 320 PHE HD1 H N N 321 PHE HD2 H N N 322 PHE HE1 H N N 323 PHE HE2 H N N 324 PHE HZ H N N 325 PHE HXT H N N 326 PRO N N N N 327 PRO CA C N S 328 PRO C C N N 329 PRO O O N N 330 PRO CB C N N 331 PRO CG C N N 332 PRO CD C N N 333 PRO OXT O N N 334 PRO H H N N 335 PRO HA H N N 336 PRO HB2 H N N 337 PRO HB3 H N N 338 PRO HG2 H N N 339 PRO HG3 H N N 340 PRO HD2 H N N 341 PRO HD3 H N N 342 PRO HXT H N N 343 SER N N N N 344 SER CA C N S 345 SER C C N N 346 SER O O N N 347 SER CB C N N 348 SER OG O N N 349 SER OXT O N N 350 SER H H N N 351 SER H2 H N N 352 SER HA H N N 353 SER HB2 H N N 354 SER HB3 H N N 355 SER HG H N N 356 SER HXT H N N 357 THR N N N N 358 THR CA C N S 359 THR C C N N 360 THR O O N N 361 THR CB C N R 362 THR OG1 O N N 363 THR CG2 C N N 364 THR OXT O N N 365 THR H H N N 366 THR H2 H N N 367 THR HA H N N 368 THR HB H N N 369 THR HG1 H N N 370 THR HG21 H N N 371 THR HG22 H N N 372 THR HG23 H N N 373 THR HXT H N N 374 TRP N N N N 375 TRP CA C N S 376 TRP C C N N 377 TRP O O N N 378 TRP CB C N N 379 TRP CG C Y N 380 TRP CD1 C Y N 381 TRP CD2 C Y N 382 TRP NE1 N Y N 383 TRP CE2 C Y N 384 TRP CE3 C Y N 385 TRP CZ2 C Y N 386 TRP CZ3 C Y N 387 TRP CH2 C Y N 388 TRP OXT O N N 389 TRP H H N N 390 TRP H2 H N N 391 TRP HA H N N 392 TRP HB2 H N N 393 TRP HB3 H N N 394 TRP HD1 H N N 395 TRP HE1 H N N 396 TRP HE3 H N N 397 TRP HZ2 H N N 398 TRP HZ3 H N N 399 TRP HH2 H N N 400 TRP HXT H N N 401 TYR N N N N 402 TYR CA C N S 403 TYR C C N N 404 TYR O O N N 405 TYR CB C N N 406 TYR CG C Y N 407 TYR CD1 C Y N 408 TYR CD2 C Y N 409 TYR CE1 C Y N 410 TYR CE2 C Y N 411 TYR CZ C Y N 412 TYR OH O N N 413 TYR OXT O N N 414 TYR H H N N 415 TYR H2 H N N 416 TYR HA H N N 417 TYR HB2 H N N 418 TYR HB3 H N N 419 TYR HD1 H N N 420 TYR HD2 H N N 421 TYR HE1 H N N 422 TYR HE2 H N N 423 TYR HH H N N 424 TYR HXT H N N 425 VAL N N N N 426 VAL CA C N S 427 VAL C C N N 428 VAL O O N N 429 VAL CB C N N 430 VAL CG1 C N N 431 VAL CG2 C N N 432 VAL OXT O N N 433 VAL H H N N 434 VAL H2 H N N 435 VAL HA H N N 436 VAL HB H N N 437 VAL HG11 H N N 438 VAL HG12 H N N 439 VAL HG13 H N N 440 VAL HG21 H N N 441 VAL HG22 H N N 442 VAL HG23 H N N 443 VAL HXT H N N 444 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1IEF C15 C14 sing N N 1 A1IEF C15 C16 sing N N 2 A1IEF C14 C13 sing N N 3 A1IEF O C18 doub N N 4 A1IEF C16 C17 sing N N 5 A1IEF C16 N4 sing N N 6 A1IEF C13 N4 sing N N 7 A1IEF C17 N5 sing N N 8 A1IEF C18 N5 sing N N 9 A1IEF C18 N6 sing N N 10 A1IEF N4 C12 sing N N 11 A1IEF C2 C3 sing N N 12 A1IEF C2 N sing N N 13 A1IEF C4 C3 doub Y N 14 A1IEF C4 C5 sing Y N 15 A1IEF N3 C12 doub Y N 16 A1IEF N3 C8 sing Y N 17 A1IEF C12 N2 sing Y N 18 A1IEF C C1 sing N N 19 A1IEF C3 C7 sing Y N 20 A1IEF C5 N1 doub Y N 21 A1IEF N C8 sing N N 22 A1IEF N C1 sing N N 23 A1IEF C8 C9 doub Y N 24 A1IEF N2 C10 doub Y N 25 A1IEF C10 C9 sing Y N 26 A1IEF C10 C11 sing N N 27 A1IEF N1 C6 sing Y N 28 A1IEF C7 C6 doub Y N 29 A1IEF C1 H1 sing N N 30 A1IEF C1 H2 sing N N 31 A1IEF C2 H3 sing N N 32 A1IEF C2 H4 sing N N 33 A1IEF N6 H5 sing N N 34 A1IEF N6 H6 sing N N 35 A1IEF C7 H7 sing N N 36 A1IEF C9 H8 sing N N 37 A1IEF C11 H9 sing N N 38 A1IEF C11 H10 sing N N 39 A1IEF C11 H11 sing N N 40 A1IEF C13 H12 sing N N 41 A1IEF C13 H13 sing N N 42 A1IEF C14 H14 sing N N 43 A1IEF C14 H15 sing N N 44 A1IEF C15 H16 sing N N 45 A1IEF C15 H17 sing N N 46 A1IEF C16 H18 sing N N 47 A1IEF N5 H19 sing N N 48 A1IEF C17 H20 sing N N 49 A1IEF C17 H21 sing N N 50 A1IEF C H22 sing N N 51 A1IEF C H23 sing N N 52 A1IEF C H24 sing N N 53 A1IEF C6 H25 sing N N 54 A1IEF C5 H26 sing N N 55 A1IEF C4 H27 sing N N 56 ALA N CA sing N N 57 ALA N H sing N N 58 ALA N H2 sing N N 59 ALA CA C sing N N 60 ALA CA CB sing N N 61 ALA CA HA sing N N 62 ALA C O doub N N 63 ALA C OXT sing N N 64 ALA CB HB1 sing N N 65 ALA CB HB2 sing N N 66 ALA CB HB3 sing N N 67 ALA OXT HXT sing N N 68 ARG N CA sing N N 69 ARG N H sing N N 70 ARG N H2 sing N N 71 ARG CA C sing N N 72 ARG CA CB sing N N 73 ARG CA HA sing N N 74 ARG C O doub N N 75 ARG C OXT sing N N 76 ARG CB CG sing N N 77 ARG CB HB2 sing N N 78 ARG CB HB3 sing N N 79 ARG CG CD sing N N 80 ARG CG HG2 sing N N 81 ARG CG HG3 sing N N 82 ARG CD NE sing N N 83 ARG CD HD2 sing N N 84 ARG CD HD3 sing N N 85 ARG NE CZ sing N N 86 ARG NE HE sing N N 87 ARG CZ NH1 sing N N 88 ARG CZ NH2 doub N N 89 ARG NH1 HH11 sing N N 90 ARG NH1 HH12 sing N N 91 ARG NH2 HH21 sing N N 92 ARG NH2 HH22 sing N N 93 ARG OXT HXT sing N N 94 ASN N CA sing N N 95 ASN N H sing N N 96 ASN N H2 sing N N 97 ASN CA C sing N N 98 ASN CA CB sing N N 99 ASN CA HA sing N N 100 ASN C O doub N N 101 ASN C OXT sing N N 102 ASN CB CG sing N N 103 ASN CB HB2 sing N N 104 ASN CB HB3 sing N N 105 ASN CG OD1 doub N N 106 ASN CG ND2 sing N N 107 ASN ND2 HD21 sing N N 108 ASN ND2 HD22 sing N N 109 ASN OXT HXT sing N N 110 ASP N CA sing N N 111 ASP N H sing N N 112 ASP N H2 sing N N 113 ASP CA C sing N N 114 ASP CA CB sing N N 115 ASP CA HA sing N N 116 ASP C O doub N N 117 ASP C OXT sing N N 118 ASP CB CG sing N N 119 ASP CB HB2 sing N N 120 ASP CB HB3 sing N N 121 ASP CG OD1 doub N N 122 ASP CG OD2 sing N N 123 ASP OD2 HD2 sing N N 124 ASP OXT HXT sing N N 125 CYS N CA sing N N 126 CYS N H sing N N 127 CYS N H2 sing N N 128 CYS CA C sing N N 129 CYS CA CB sing N N 130 CYS CA HA sing N N 131 CYS C O doub N N 132 CYS C OXT sing N N 133 CYS CB SG sing N N 134 CYS CB HB2 sing N N 135 CYS CB HB3 sing N N 136 CYS SG HG sing N N 137 CYS OXT HXT sing N N 138 GLN N CA sing N N 139 GLN N H sing N N 140 GLN N H2 sing N N 141 GLN CA C sing N N 142 GLN CA CB sing N N 143 GLN CA HA sing N N 144 GLN C O doub N N 145 GLN C OXT sing N N 146 GLN CB CG sing N N 147 GLN CB HB2 sing N N 148 GLN CB HB3 sing N N 149 GLN CG CD sing N N 150 GLN CG HG2 sing N N 151 GLN CG HG3 sing N N 152 GLN CD OE1 doub N N 153 GLN CD NE2 sing N N 154 GLN NE2 HE21 sing N N 155 GLN NE2 HE22 sing N N 156 GLN OXT HXT sing N N 157 GLU N CA sing N N 158 GLU N H sing N N 159 GLU N H2 sing N N 160 GLU CA C sing N N 161 GLU CA CB sing N N 162 GLU CA HA sing N N 163 GLU C O doub N N 164 GLU C OXT sing N N 165 GLU CB CG sing N N 166 GLU CB HB2 sing N N 167 GLU CB HB3 sing N N 168 GLU CG CD sing N N 169 GLU CG HG2 sing N N 170 GLU CG HG3 sing N N 171 GLU CD OE1 doub N N 172 GLU CD OE2 sing N N 173 GLU OE2 HE2 sing N N 174 GLU OXT HXT sing N N 175 GLY N CA sing N N 176 GLY N H sing N N 177 GLY N H2 sing N N 178 GLY CA C sing N N 179 GLY CA HA2 sing N N 180 GLY CA HA3 sing N N 181 GLY C O doub N N 182 GLY C OXT sing N N 183 GLY OXT HXT sing N N 184 HIS N CA sing N N 185 HIS N H sing N N 186 HIS N H2 sing N N 187 HIS CA C sing N N 188 HIS CA CB sing N N 189 HIS CA HA sing N N 190 HIS C O doub N N 191 HIS C OXT sing N N 192 HIS CB CG sing N N 193 HIS CB HB2 sing N N 194 HIS CB HB3 sing N N 195 HIS CG ND1 sing Y N 196 HIS CG CD2 doub Y N 197 HIS ND1 CE1 doub Y N 198 HIS ND1 HD1 sing N N 199 HIS CD2 NE2 sing Y N 200 HIS CD2 HD2 sing N N 201 HIS CE1 NE2 sing Y N 202 HIS CE1 HE1 sing N N 203 HIS NE2 HE2 sing N N 204 HIS OXT HXT sing N N 205 HOH O H1 sing N N 206 HOH O H2 sing N N 207 ILE N CA sing N N 208 ILE N H sing N N 209 ILE N H2 sing N N 210 ILE CA C sing N N 211 ILE CA CB sing N N 212 ILE CA HA sing N N 213 ILE C O doub N N 214 ILE C OXT sing N N 215 ILE CB CG1 sing N N 216 ILE CB CG2 sing N N 217 ILE CB HB sing N N 218 ILE CG1 CD1 sing N N 219 ILE CG1 HG12 sing N N 220 ILE CG1 HG13 sing N N 221 ILE CG2 HG21 sing N N 222 ILE CG2 HG22 sing N N 223 ILE CG2 HG23 sing N N 224 ILE CD1 HD11 sing N N 225 ILE CD1 HD12 sing N N 226 ILE CD1 HD13 sing N N 227 ILE OXT HXT sing N N 228 LEU N CA sing N N 229 LEU N H sing N N 230 LEU N H2 sing N N 231 LEU CA C sing N N 232 LEU CA CB sing N N 233 LEU CA HA sing N N 234 LEU C O doub N N 235 LEU C OXT sing N N 236 LEU CB CG sing N N 237 LEU CB HB2 sing N N 238 LEU CB HB3 sing N N 239 LEU CG CD1 sing N N 240 LEU CG CD2 sing N N 241 LEU CG HG sing N N 242 LEU CD1 HD11 sing N N 243 LEU CD1 HD12 sing N N 244 LEU CD1 HD13 sing N N 245 LEU CD2 HD21 sing N N 246 LEU CD2 HD22 sing N N 247 LEU CD2 HD23 sing N N 248 LEU OXT HXT sing N N 249 LYS N CA sing N N 250 LYS N H sing N N 251 LYS N H2 sing N N 252 LYS CA C sing N N 253 LYS CA CB sing N N 254 LYS CA HA sing N N 255 LYS C O doub N N 256 LYS C OXT sing N N 257 LYS CB CG sing N N 258 LYS CB HB2 sing N N 259 LYS CB HB3 sing N N 260 LYS CG CD sing N N 261 LYS CG HG2 sing N N 262 LYS CG HG3 sing N N 263 LYS CD CE sing N N 264 LYS CD HD2 sing N N 265 LYS CD HD3 sing N N 266 LYS CE NZ sing N N 267 LYS CE HE2 sing N N 268 LYS CE HE3 sing N N 269 LYS NZ HZ1 sing N N 270 LYS NZ HZ2 sing N N 271 LYS NZ HZ3 sing N N 272 LYS OXT HXT sing N N 273 MET N CA sing N N 274 MET N H sing N N 275 MET N H2 sing N N 276 MET CA C sing N N 277 MET CA CB sing N N 278 MET CA HA sing N N 279 MET C O doub N N 280 MET C OXT sing N N 281 MET CB CG sing N N 282 MET CB HB2 sing N N 283 MET CB HB3 sing N N 284 MET CG SD sing N N 285 MET CG HG2 sing N N 286 MET CG HG3 sing N N 287 MET SD CE sing N N 288 MET CE HE1 sing N N 289 MET CE HE2 sing N N 290 MET CE HE3 sing N N 291 MET OXT HXT sing N N 292 PHE N CA sing N N 293 PHE N H sing N N 294 PHE N H2 sing N N 295 PHE CA C sing N N 296 PHE CA CB sing N N 297 PHE CA HA sing N N 298 PHE C O doub N N 299 PHE C OXT sing N N 300 PHE CB CG sing N N 301 PHE CB HB2 sing N N 302 PHE CB HB3 sing N N 303 PHE CG CD1 doub Y N 304 PHE CG CD2 sing Y N 305 PHE CD1 CE1 sing Y N 306 PHE CD1 HD1 sing N N 307 PHE CD2 CE2 doub Y N 308 PHE CD2 HD2 sing N N 309 PHE CE1 CZ doub Y N 310 PHE CE1 HE1 sing N N 311 PHE CE2 CZ sing Y N 312 PHE CE2 HE2 sing N N 313 PHE CZ HZ sing N N 314 PHE OXT HXT sing N N 315 PRO N CA sing N N 316 PRO N CD sing N N 317 PRO N H sing N N 318 PRO CA C sing N N 319 PRO CA CB sing N N 320 PRO CA HA sing N N 321 PRO C O doub N N 322 PRO C OXT sing N N 323 PRO CB CG sing N N 324 PRO CB HB2 sing N N 325 PRO CB HB3 sing N N 326 PRO CG CD sing N N 327 PRO CG HG2 sing N N 328 PRO CG HG3 sing N N 329 PRO CD HD2 sing N N 330 PRO CD HD3 sing N N 331 PRO OXT HXT sing N N 332 SER N CA sing N N 333 SER N H sing N N 334 SER N H2 sing N N 335 SER CA C sing N N 336 SER CA CB sing N N 337 SER CA HA sing N N 338 SER C O doub N N 339 SER C OXT sing N N 340 SER CB OG sing N N 341 SER CB HB2 sing N N 342 SER CB HB3 sing N N 343 SER OG HG sing N N 344 SER OXT HXT sing N N 345 THR N CA sing N N 346 THR N H sing N N 347 THR N H2 sing N N 348 THR CA C sing N N 349 THR CA CB sing N N 350 THR CA HA sing N N 351 THR C O doub N N 352 THR C OXT sing N N 353 THR CB OG1 sing N N 354 THR CB CG2 sing N N 355 THR CB HB sing N N 356 THR OG1 HG1 sing N N 357 THR CG2 HG21 sing N N 358 THR CG2 HG22 sing N N 359 THR CG2 HG23 sing N N 360 THR OXT HXT sing N N 361 TRP N CA sing N N 362 TRP N H sing N N 363 TRP N H2 sing N N 364 TRP CA C sing N N 365 TRP CA CB sing N N 366 TRP CA HA sing N N 367 TRP C O doub N N 368 TRP C OXT sing N N 369 TRP CB CG sing N N 370 TRP CB HB2 sing N N 371 TRP CB HB3 sing N N 372 TRP CG CD1 doub Y N 373 TRP CG CD2 sing Y N 374 TRP CD1 NE1 sing Y N 375 TRP CD1 HD1 sing N N 376 TRP CD2 CE2 doub Y N 377 TRP CD2 CE3 sing Y N 378 TRP NE1 CE2 sing Y N 379 TRP NE1 HE1 sing N N 380 TRP CE2 CZ2 sing Y N 381 TRP CE3 CZ3 doub Y N 382 TRP CE3 HE3 sing N N 383 TRP CZ2 CH2 doub Y N 384 TRP CZ2 HZ2 sing N N 385 TRP CZ3 CH2 sing Y N 386 TRP CZ3 HZ3 sing N N 387 TRP CH2 HH2 sing N N 388 TRP OXT HXT sing N N 389 TYR N CA sing N N 390 TYR N H sing N N 391 TYR N H2 sing N N 392 TYR CA C sing N N 393 TYR CA CB sing N N 394 TYR CA HA sing N N 395 TYR C O doub N N 396 TYR C OXT sing N N 397 TYR CB CG sing N N 398 TYR CB HB2 sing N N 399 TYR CB HB3 sing N N 400 TYR CG CD1 doub Y N 401 TYR CG CD2 sing Y N 402 TYR CD1 CE1 sing Y N 403 TYR CD1 HD1 sing N N 404 TYR CD2 CE2 doub Y N 405 TYR CD2 HD2 sing N N 406 TYR CE1 CZ doub Y N 407 TYR CE1 HE1 sing N N 408 TYR CE2 CZ sing Y N 409 TYR CE2 HE2 sing N N 410 TYR CZ OH sing N N 411 TYR OH HH sing N N 412 TYR OXT HXT sing N N 413 VAL N CA sing N N 414 VAL N H sing N N 415 VAL N H2 sing N N 416 VAL CA C sing N N 417 VAL CA CB sing N N 418 VAL CA HA sing N N 419 VAL C O doub N N 420 VAL C OXT sing N N 421 VAL CB CG1 sing N N 422 VAL CB CG2 sing N N 423 VAL CB HB sing N N 424 VAL CG1 HG11 sing N N 425 VAL CG1 HG12 sing N N 426 VAL CG1 HG13 sing N N 427 VAL CG2 HG21 sing N N 428 VAL CG2 HG22 sing N N 429 VAL CG2 HG23 sing N N 430 VAL OXT HXT sing N N 431 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'Internal model' # _atom_sites.entry_id 9FOE _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.018426 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018426 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007953 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ #