data_9FP9 # _entry.id 9FP9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.408 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9FP9 pdb_00009fp9 10.2210/pdb9fp9/pdb WWPDB D_1292137180 ? ? BMRB 34920 ? 10.13018/BMR34920 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-12-24 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9FP9 _pdbx_database_status.recvd_initial_deposition_date 2024-06-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Three-dimensional structure of the Merozoite surface protein 1 C-terminal domain' _pdbx_database_related.db_id 34920 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 3 _pdbx_contact_author.email heiko.moeller@uni-potsdam.de _pdbx_contact_author.name_first Heiko _pdbx_contact_author.name_last Moeller _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-5795-1195 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bier, N.' 1 0009-0007-7303-3486 'Ramadan, S.' 2 0000-0003-3907-1466 'Nedielkov, R.' 3 0000-0001-8062-2261 'Klishin, N.' 4 0000-0002-0491-1560 'Moeller, H.M.' 5 0000-0002-5795-1195 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Three-dimensional structure of the Merozoite surface protein 1 C-terminal domain from P. berghei' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bier, N.' 1 0009-0007-7303-3486 primary 'Ramadan, S.' 2 0000-0003-3907-1466 primary 'Nedielkov, R.' 3 0000-0001-8062-2261 primary 'Klishin, N.' 4 0000-0002-0491-1560 primary 'Moeller, H.M.' 5 0000-0002-5795-1195 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Merozoite surface protein 1' _entity.formula_weight 11460.739 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation 'M1, G104' _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Merozoite surface antigen,PMMSA' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNMDSMDLLGIDPKHVCINTRDIPANAGCFRYDNGNEEWRCLLGYKKNNNTCIEDSNPTCGNNNGGCDPTAGCQTAENRE NSKKIICTCKEPTPNAYYDGVFCG ; _entity_poly.pdbx_seq_one_letter_code_can ;MNMDSMDLLGIDPKHVCINTRDIPANAGCFRYDNGNEEWRCLLGYKKNNNTCIEDSNPTCGNNNGGCDPTAGCQTAENRE NSKKIICTCKEPTPNAYYDGVFCG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 MET n 1 4 ASP n 1 5 SER n 1 6 MET n 1 7 ASP n 1 8 LEU n 1 9 LEU n 1 10 GLY n 1 11 ILE n 1 12 ASP n 1 13 PRO n 1 14 LYS n 1 15 HIS n 1 16 VAL n 1 17 CYS n 1 18 ILE n 1 19 ASN n 1 20 THR n 1 21 ARG n 1 22 ASP n 1 23 ILE n 1 24 PRO n 1 25 ALA n 1 26 ASN n 1 27 ALA n 1 28 GLY n 1 29 CYS n 1 30 PHE n 1 31 ARG n 1 32 TYR n 1 33 ASP n 1 34 ASN n 1 35 GLY n 1 36 ASN n 1 37 GLU n 1 38 GLU n 1 39 TRP n 1 40 ARG n 1 41 CYS n 1 42 LEU n 1 43 LEU n 1 44 GLY n 1 45 TYR n 1 46 LYS n 1 47 LYS n 1 48 ASN n 1 49 ASN n 1 50 ASN n 1 51 THR n 1 52 CYS n 1 53 ILE n 1 54 GLU n 1 55 ASP n 1 56 SER n 1 57 ASN n 1 58 PRO n 1 59 THR n 1 60 CYS n 1 61 GLY n 1 62 ASN n 1 63 ASN n 1 64 ASN n 1 65 GLY n 1 66 GLY n 1 67 CYS n 1 68 ASP n 1 69 PRO n 1 70 THR n 1 71 ALA n 1 72 GLY n 1 73 CYS n 1 74 GLN n 1 75 THR n 1 76 ALA n 1 77 GLU n 1 78 ASN n 1 79 ARG n 1 80 GLU n 1 81 ASN n 1 82 SER n 1 83 LYS n 1 84 LYS n 1 85 ILE n 1 86 ILE n 1 87 CYS n 1 88 THR n 1 89 CYS n 1 90 LYS n 1 91 GLU n 1 92 PRO n 1 93 THR n 1 94 PRO n 1 95 ASN n 1 96 ALA n 1 97 TYR n 1 98 TYR n 1 99 ASP n 1 100 GLY n 1 101 VAL n 1 102 PHE n 1 103 CYS n 1 104 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 104 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MSP1, PBNK65NY_000166300' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Plasmodium berghei' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5821 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 MET 6 6 6 MET MET A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 HIS 15 15 15 HIS HIS A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 TRP 39 39 39 TRP TRP A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 CYS 41 41 41 CYS CYS A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 ASN 48 48 48 ASN ASN A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 CYS 52 52 52 CYS CYS A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 CYS 67 67 67 CYS CYS A . n A 1 68 ASP 68 68 68 ASP ASP A . n A 1 69 PRO 69 69 69 PRO PRO A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 CYS 73 73 73 CYS CYS A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 LYS 83 83 83 LYS LYS A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 CYS 87 87 87 CYS CYS A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 CYS 89 89 89 CYS CYS A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 TYR 98 98 98 TYR TYR A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 CYS 103 103 103 CYS CYS A . n A 1 104 GLY 104 104 104 GLY GLY A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9FP9 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9FP9 _struct.title 'Three-dimensional structure of the Merozoite surface protein 1 C-terminal domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9FP9 _struct_keywords.text 'Malaria, Plasmodium berghei, EGF-domain, dynamic N-terminus, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A1C6YE36_PLABE _struct_ref.pdbx_db_accession A0A1C6YE36 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LNMDSMDLLGIDPKHVCINTRDIPANAGCFRYDNGNEEWRCLLGYKKNNNTCIEDSNPTCGNNNGGCDPTAGCQTAENRE NSKKIICTCKEPTPNAYYDGVFCS ; _struct_ref.pdbx_align_begin 1684 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9FP9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 104 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A1C6YE36 _struct_ref_seq.db_align_beg 1684 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1787 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 104 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9FP9 MET A 1 ? UNP A0A1C6YE36 LEU 1684 'engineered mutation' 1 1 1 9FP9 GLY A 104 ? UNP A0A1C6YE36 SER 1787 'engineered mutation' 104 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id TYR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 98 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id VAL _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 101 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id TYR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 98 _struct_conf.end_auth_comp_id VAL _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 101 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 29 SG ? ? A CYS 17 A CYS 29 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf2 disulf ? ? A CYS 41 SG ? ? ? 1_555 A CYS 52 SG ? ? A CYS 41 A CYS 52 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf3 disulf ? ? A CYS 60 SG ? ? ? 1_555 A CYS 73 SG ? ? A CYS 60 A CYS 73 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf4 disulf ? ? A CYS 67 SG ? ? ? 1_555 A CYS 87 SG ? ? A CYS 67 A CYS 87 1_555 ? ? ? ? ? ? ? 2.014 ? ? disulf5 disulf ? ? A CYS 89 SG ? ? ? 1_555 A CYS 103 SG ? ? A CYS 89 A CYS 103 1_555 ? ? ? ? ? ? ? 2.039 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 17 ? CYS A 29 ? CYS A 17 ? 1_555 CYS A 29 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 41 ? CYS A 52 ? CYS A 41 ? 1_555 CYS A 52 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 60 ? CYS A 73 ? CYS A 60 ? 1_555 CYS A 73 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 67 ? CYS A 87 ? CYS A 67 ? 1_555 CYS A 87 ? 1_555 SG SG . . . None 'Disulfide bridge' 5 CYS A 89 ? CYS A 103 ? CYS A 89 ? 1_555 CYS A 103 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? AA3 ? 2 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 27 ? ARG A 31 ? ALA A 27 ARG A 31 AA1 2 GLU A 37 ? CYS A 41 ? GLU A 37 CYS A 41 AA2 1 TYR A 45 ? ASN A 48 ? TYR A 45 ASN A 48 AA2 2 THR A 51 ? GLU A 54 ? THR A 51 GLU A 54 AA3 1 GLY A 72 ? THR A 75 ? GLY A 72 THR A 75 AA3 2 ILE A 85 ? THR A 88 ? ILE A 85 THR A 88 AA4 1 ALA A 96 ? TYR A 97 ? ALA A 96 TYR A 97 AA4 2 PHE A 102 ? CYS A 103 ? PHE A 102 CYS A 103 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 30 ? N PHE A 30 O GLU A 38 ? O GLU A 38 AA2 1 2 N ASN A 48 ? N ASN A 48 O THR A 51 ? O THR A 51 AA3 1 2 N GLY A 72 ? N GLY A 72 O THR A 88 ? O THR A 88 AA4 1 2 N TYR A 97 ? N TYR A 97 O PHE A 102 ? O PHE A 102 # _pdbx_entry_details.entry_id 9FP9 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 O A ASP 12 ? ? H A LYS 14 ? ? 1.58 2 6 OD2 A ASP 68 ? ? HG1 A THR 70 ? ? 1.59 3 7 OD2 A ASP 68 ? ? HG1 A THR 70 ? ? 1.59 4 11 OE2 A GLU 77 ? ? HZ1 A LYS 84 ? ? 1.58 5 14 O A ASP 12 ? ? H A LYS 14 ? ? 1.57 6 14 OD2 A ASP 68 ? ? HG1 A THR 70 ? ? 1.57 7 14 OE2 A GLU 38 ? ? HH21 A ARG 40 ? ? 1.60 8 17 OD1 A ASP 68 ? ? HG1 A THR 70 ? ? 1.56 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 5 ? ? -160.54 99.27 2 1 LEU A 8 ? ? 66.12 87.37 3 1 LEU A 9 ? ? -106.60 -71.65 4 1 PRO A 13 ? ? -59.23 60.40 5 1 CYS A 60 ? ? 76.08 -2.60 6 1 LYS A 83 ? ? 157.09 166.86 7 1 PRO A 92 ? ? -35.38 89.66 8 1 PRO A 94 ? ? -68.65 7.68 9 2 MET A 3 ? ? 69.48 118.35 10 2 SER A 5 ? ? -156.23 -60.75 11 2 LEU A 8 ? ? 70.01 117.98 12 2 ASP A 12 ? ? -49.68 151.97 13 2 PRO A 13 ? ? -64.81 50.17 14 2 CYS A 60 ? ? 73.00 -2.47 15 2 GLU A 80 ? ? -79.57 41.84 16 2 PRO A 92 ? ? -32.93 91.10 17 2 PRO A 94 ? ? -73.03 33.41 18 3 MET A 3 ? ? 62.06 97.87 19 3 LEU A 9 ? ? -101.43 72.68 20 3 PRO A 13 ? ? -59.88 67.21 21 3 THR A 59 ? ? -96.05 48.23 22 3 CYS A 60 ? ? 73.81 -2.59 23 3 ASP A 68 ? ? -49.54 150.44 24 3 GLU A 80 ? ? -80.45 45.41 25 3 PRO A 92 ? ? -39.46 89.05 26 3 PRO A 94 ? ? -70.80 37.61 27 4 SER A 5 ? ? -175.16 50.47 28 4 MET A 6 ? ? 71.91 156.65 29 4 PRO A 13 ? ? -62.30 68.48 30 4 CYS A 60 ? ? 73.95 -1.50 31 4 LYS A 83 ? ? -177.83 -73.53 32 4 LYS A 84 ? ? 173.62 -30.69 33 4 GLU A 91 ? ? -47.61 155.24 34 4 PRO A 92 ? ? -37.85 87.51 35 5 ASN A 2 ? ? -91.96 -77.50 36 5 MET A 3 ? ? 59.30 -162.42 37 5 MET A 6 ? ? 55.33 82.16 38 5 PRO A 13 ? ? -62.56 64.55 39 5 ASN A 50 ? ? 74.74 -7.29 40 5 THR A 59 ? ? -85.09 46.44 41 5 CYS A 60 ? ? 74.42 -0.83 42 5 ASN A 78 ? ? -85.26 33.25 43 5 LYS A 83 ? ? 170.41 -81.18 44 5 LYS A 84 ? ? 163.72 -45.27 45 5 PRO A 92 ? ? -21.66 73.89 46 5 PRO A 94 ? ? -79.40 39.78 47 6 ASP A 4 ? ? 64.04 -84.53 48 6 SER A 5 ? ? -179.58 105.11 49 6 PRO A 13 ? ? -60.88 60.08 50 6 ASN A 57 ? ? -119.42 77.71 51 6 THR A 59 ? ? -85.23 45.42 52 6 CYS A 60 ? ? 77.01 -2.78 53 6 LYS A 83 ? ? 158.17 -14.88 54 6 LYS A 84 ? ? 85.68 -35.41 55 6 PRO A 92 ? ? -36.30 88.92 56 6 PRO A 94 ? ? -72.09 29.30 57 7 MET A 3 ? ? -139.84 -66.84 58 7 SER A 5 ? ? 69.37 87.44 59 7 PRO A 13 ? ? -62.28 65.77 60 7 ASN A 19 ? ? -58.11 105.91 61 7 ASN A 50 ? ? 72.27 -4.42 62 7 CYS A 60 ? ? 73.32 -1.07 63 7 GLU A 77 ? ? -84.46 31.34 64 7 LYS A 83 ? ? 174.49 143.31 65 7 GLU A 91 ? ? -48.59 158.45 66 7 PRO A 92 ? ? -39.65 90.35 67 7 PRO A 94 ? ? -73.16 32.37 68 8 SER A 5 ? ? -173.54 85.84 69 8 MET A 6 ? ? 65.02 176.56 70 8 PRO A 13 ? ? -63.42 59.43 71 8 ASN A 26 ? ? 70.03 36.43 72 8 CYS A 60 ? ? 75.45 -2.34 73 8 LYS A 83 ? ? 172.48 -82.14 74 8 LYS A 84 ? ? 165.88 -39.28 75 8 GLU A 91 ? ? -49.89 158.79 76 8 PRO A 92 ? ? -28.44 84.95 77 9 ASP A 4 ? ? 41.58 -94.72 78 9 LEU A 9 ? ? -76.01 -80.85 79 9 PRO A 13 ? ? -59.86 62.79 80 9 PRO A 58 ? ? -67.80 83.54 81 9 THR A 59 ? ? -96.85 48.69 82 9 CYS A 60 ? ? 78.93 -2.42 83 9 LYS A 83 ? ? 170.95 -75.10 84 9 LYS A 84 ? ? 167.00 -38.60 85 9 GLU A 91 ? ? -49.63 158.40 86 9 PRO A 92 ? ? -36.32 88.75 87 9 PRO A 94 ? ? -72.34 38.58 88 10 SER A 5 ? ? -159.33 -39.55 89 10 PRO A 13 ? ? -59.14 56.54 90 10 ASN A 57 ? ? -118.25 78.66 91 10 THR A 59 ? ? -84.95 49.88 92 10 CYS A 60 ? ? 71.84 -2.44 93 10 LYS A 83 ? ? 170.87 169.37 94 10 PRO A 92 ? ? -31.98 91.09 95 10 PRO A 94 ? ? -72.47 40.92 96 11 ASN A 2 ? ? -144.74 -69.23 97 11 MET A 3 ? ? 63.02 -83.58 98 11 SER A 5 ? ? -161.87 -51.88 99 11 PRO A 13 ? ? -60.04 60.75 100 11 PRO A 24 ? ? -74.35 -168.04 101 11 ASN A 50 ? ? 72.05 -10.74 102 11 CYS A 60 ? ? 77.33 -0.74 103 11 ARG A 79 ? ? -101.62 49.00 104 11 LYS A 83 ? ? 171.05 -77.36 105 11 LYS A 84 ? ? 169.46 -33.56 106 11 PRO A 92 ? ? -33.52 85.33 107 12 SER A 5 ? ? -172.32 106.22 108 12 MET A 6 ? ? 63.94 -166.27 109 12 PRO A 13 ? ? -58.64 67.31 110 12 CYS A 60 ? ? 73.59 -1.57 111 12 LYS A 83 ? ? 165.57 -71.83 112 12 LYS A 84 ? ? 163.40 -34.78 113 12 PRO A 92 ? ? -28.32 84.74 114 13 ASP A 7 ? ? -166.74 92.76 115 13 LEU A 8 ? ? 58.63 81.02 116 13 LEU A 9 ? ? -109.14 -80.22 117 13 PRO A 13 ? ? -62.21 63.65 118 13 CYS A 60 ? ? 76.60 -1.02 119 13 LYS A 83 ? ? 159.11 166.12 120 13 PRO A 92 ? ? -28.48 81.15 121 13 PRO A 94 ? ? -76.51 21.95 122 14 SER A 5 ? ? -96.12 -88.64 123 14 PRO A 13 ? ? -57.80 56.00 124 14 THR A 59 ? ? -85.23 41.98 125 14 CYS A 60 ? ? 75.09 -1.50 126 14 LYS A 83 ? ? 164.43 163.83 127 14 GLU A 91 ? ? -48.50 156.15 128 14 PRO A 92 ? ? -41.93 91.59 129 14 PRO A 94 ? ? -68.60 31.63 130 15 ASP A 4 ? ? 54.57 -89.46 131 15 SER A 5 ? ? -147.72 40.45 132 15 LEU A 9 ? ? -103.55 -85.78 133 15 PRO A 13 ? ? -63.30 60.22 134 15 CYS A 60 ? ? 76.75 -1.78 135 15 ARG A 79 ? ? -155.77 26.92 136 15 LYS A 83 ? ? 162.50 -24.31 137 15 LYS A 84 ? ? 87.80 -42.40 138 15 PRO A 92 ? ? -32.45 90.87 139 15 PRO A 94 ? ? -72.03 37.29 140 16 PRO A 13 ? ? -58.85 59.09 141 16 ASN A 57 ? ? -113.38 79.64 142 16 CYS A 60 ? ? 72.72 -1.51 143 16 LYS A 83 ? ? 159.56 164.75 144 16 PRO A 92 ? ? -32.99 87.33 145 16 PRO A 94 ? ? -73.00 23.28 146 17 MET A 3 ? ? -166.47 89.13 147 17 ASP A 4 ? ? -173.92 142.21 148 17 LEU A 9 ? ? -98.08 -70.49 149 17 PRO A 13 ? ? -57.48 70.39 150 17 PRO A 58 ? ? -68.37 87.31 151 17 THR A 59 ? ? -96.04 33.91 152 17 CYS A 60 ? ? 76.77 -2.34 153 17 GLU A 80 ? ? -77.77 29.93 154 17 LYS A 83 ? ? 167.16 172.93 155 17 GLU A 91 ? ? -48.00 156.91 156 17 PRO A 92 ? ? -40.67 85.51 157 18 MET A 3 ? ? 55.40 -143.55 158 18 ASP A 4 ? ? 73.01 148.39 159 18 LEU A 8 ? ? 71.42 117.71 160 18 PRO A 13 ? ? -61.29 67.17 161 18 CYS A 60 ? ? 72.99 -2.43 162 18 GLU A 80 ? ? -75.13 20.38 163 18 LYS A 83 ? ? 165.09 174.07 164 18 GLU A 91 ? ? -48.49 153.69 165 18 PRO A 92 ? ? -38.06 89.66 166 18 PRO A 94 ? ? -76.74 48.26 167 19 ASN A 2 ? ? -171.02 -50.23 168 19 PRO A 13 ? ? -59.48 72.24 169 19 ASN A 19 ? ? -59.47 109.08 170 19 ASN A 26 ? ? 71.01 42.39 171 19 ASN A 50 ? ? 74.25 -8.60 172 19 ASN A 57 ? ? -119.80 77.95 173 19 THR A 59 ? ? -87.80 49.05 174 19 CYS A 60 ? ? 78.42 -2.84 175 19 GLU A 80 ? ? -149.89 19.40 176 19 LYS A 83 ? ? -171.53 147.39 177 19 PRO A 92 ? ? -40.96 90.16 178 20 SER A 5 ? ? -153.42 32.37 179 20 MET A 6 ? ? 64.38 -92.36 180 20 ASP A 7 ? ? -142.30 15.12 181 20 PRO A 13 ? ? -61.69 72.09 182 20 PRO A 58 ? ? -69.77 73.00 183 20 CYS A 60 ? ? 78.75 -0.76 184 20 LYS A 83 ? ? 174.66 -72.85 185 20 LYS A 84 ? ? 173.97 -35.53 186 20 GLU A 91 ? ? -48.35 156.49 187 20 PRO A 92 ? ? -39.38 93.69 188 20 PRO A 94 ? ? -71.59 24.91 # _pdbx_nmr_ensemble.entry_id 9FP9 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9FP9 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 ;0.873 mM [U-99% 13C; U-98% 15N] MSP1-19, 25 mM Potassium dihydrogen phosphate, 50 mM Potassium chloride, 4 mM Sodium azide, 0.1 mM d6 DSS, 95% H2O/5% D2O ; '95% H2O/5% D2O' 15N,13C_sample solution ? 2 ;0.741 mM [U-99% 13C; U-98% 15N] MSP1-19, 25 mM Potassium dideuterium phosphate, 50 mM Potassium chloride, 4 mM Sodium azide, 0.1 mM d6 DSS, 100% D2O ; '100% D2O' 15N,13C_sample solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 MSP1-19 0.873 ? mM '[U-99% 13C; U-98% 15N]' 1 'Potassium dihydrogen phosphate' 25 ? mM none 1 'Potassium chloride' 50 ? mM none 1 'Sodium azide' 4 ? mM none 1 DSS 0.1 ? mM d6 2 MSP1-19 0.741 ? mM '[U-99% 13C; U-98% 15N]' 2 'Potassium dideuterium phosphate' 25 ? mM none 2 'Potassium chloride' 50 ? mM none 2 'Sodium azide' 4 ? mM none 2 DSS 0.1 ? mM d6 # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.details _pdbx_nmr_exptl_sample_conditions.ionic_strength_err _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_err _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.pressure_err _pdbx_nmr_exptl_sample_conditions.temperature_err _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298 atm 1 6.5 187.5 ? ? mM 'MSP1-19 in water' ? pH ? ? K 2 298 atm 1 6.5 187.5 ? ? mM 'MSP1-19 in deuterium oxide' ? pD ? ? K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC aliphatic' 1 isotropic 3 1 1 '2D 1H-13C HSQC aromatic' 1 isotropic 4 1 1 '3D HNCO' 1 isotropic 5 1 1 '3D HN(CA)CO' 1 isotropic 10 1 1 '3D HNCACB' 1 isotropic 9 1 1 '3D CBCA(CO)NH' 1 isotropic 8 1 1 '3D HBHA(CO)NH' 1 isotropic 7 1 1 '3D HBHANH' 1 isotropic 6 1 1 '3D 1H-15N NOESY' 1 isotropic 13 1 1 '3D 1H-15N TOCSY' 1 isotropic 11 1 1 '3D H(CCO)NH' 1 isotropic 16 1 1 '3D C(CO)NH' 1 isotropic 15 2 2 '3D HCCH-COSY' 1 isotropic 14 2 2 '3D HCCH-TOCSY' 1 isotropic 12 2 2 '2D 1H-1H NOESY' 1 isotropic 17 2 2 '3D 1H-13C NOESY aliphatic' 1 isotropic 18 2 2 '(HB)CB(CGCD)HD' 1 isotropic 19 2 2 '(HB)CB(CGCDCE)HE' 1 isotropic # loop_ _pdbx_nmr_refine.entry_id _pdbx_nmr_refine.method _pdbx_nmr_refine.details _pdbx_nmr_refine.software_ordinal 9FP9 'torsion angle dynamics' ? 5 9FP9 'simulated annealing' 'with explicit water' 2 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 4 'peak picking' 'CcpNmr Analysis' ? CCPN 3 'structure calculation' ARTINA ? 'Klukowski, P., Riek, R. and Guntert, P.' 5 refinement CYANA 3.98.15 'Guntert, Mumenthaler and Wuthrich' 2 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_audit_support.funding_organization 'Max Planck Society' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number 'IMPRS Multiscale Biosystems' _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details 'Prodigy cryo-probe' # _atom_sites.entry_id 9FP9 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #