data_9G0Y # _entry.id 9G0Y # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.403 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9G0Y pdb_00009g0y 10.2210/pdb9g0y/pdb WWPDB D_1292139837 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-04-16 ? 2 'Structure model' 1 1 2025-05-21 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9G0Y _pdbx_database_status.recvd_initial_deposition_date 2024-07-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 9GGY PDB . unspecified 9GH2 PDB . unspecified 9GGZ PDB . unspecified 9GH0 PDB . unspecified 9GH1 PDB . unspecified 9GGW PDB . unspecified 9GGX PDB . unspecified 9GGU PDB . unspecified 9GGT PDB . unspecified 9G4B PDB . unspecified 9GGV PDB . # _pdbx_contact_author.id 2 _pdbx_contact_author.email alexander.schuettelkopf@cancer.org.uk _pdbx_contact_author.name_first Alexander _pdbx_contact_author.name_last Schuettelkopf _pdbx_contact_author.name_mi W. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-9424-8730 # _audit_author.name 'Schuettelkopf, A.W.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0002-9424-8730 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 68 _citation.language ? _citation.page_first 9129 _citation.page_last 9161 _citation.title 'Reversible Small Molecule Multivariant Ras Inhibitors Display Tunable Affinity for the Active and Inactive Forms of Ras.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.4c02929 _citation.pdbx_database_id_PubMed 40162713 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Parry, C.W.' 1 ? primary 'Pellicano, F.' 2 ? primary 'Schuttelkopf, A.W.' 3 ? primary 'Beyer, K.S.' 4 ? primary 'Bower, J.' 5 ? primary 'Bryson, A.' 6 ? primary 'Cameron, K.' 7 ? primary 'Cerutti, N.M.' 8 ? primary 'Clark, J.P.' 9 ? primary 'Davidson, S.C.' 10 ? primary 'Davies, K.' 11 ? primary 'Drysdale, M.J.' 12 ? primary 'Engelman, J.' 13 ? primary 'Estevan-Barber, A.' 14 ? primary 'Gohlke, A.' 15 ? primary 'Gray, C.H.' 16 ? primary 'Guthy, D.A.' 17 ? primary 'Hong, M.' 18 ? primary 'Hopkins, A.' 19 ? primary 'Hutchinson, L.D.' 20 ? primary 'Konczal, J.' 21 ? primary 'Maira, M.' 22 ? primary 'McArthur, D.' 23 ? primary 'Mezna, M.' 24 ? primary 'McKinnon, H.' 25 ? primary 'Nepravishta, R.' 26 ? primary 'Ostermann, N.' 27 ? primary 'Pasquali, C.C.' 28 ? primary 'Pollock, K.' 29 ? primary 'Pugliese, A.' 30 ? primary 'Rooney, N.' 31 ? primary 'Schmiedeberg, N.' 32 ? primary 'Shaw, P.' 33 ? primary 'Velez-Vega, C.' 34 ? primary 'West, C.' 35 ? primary 'West, R.' 36 ? primary 'Zecri, F.' 37 ? primary 'Taylor, J.B.' 38 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'GTPase KRas' 19607.078 1 3.6.5.2 ? ? ? 2 non-polymer syn "GUANOSINE-5'-DIPHOSPHATE" 443.201 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 4 non-polymer syn 'N-(7-chloro-4-hydroxybenzo[d]thiazol-2-yl)-4-hydroxybenzenesulfonamide' 356.805 1 ? ? ? ? 5 non-polymer syn 1,2-ETHANEDIOL 62.068 1 ? ? ? ? 6 water nat water 18.015 176 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'K-Ras 2,Ki-Ras,c-K-ras,c-Ki-ras' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GGSMTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEG FLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFY TLVREIRQYRLK ; _entity_poly.pdbx_seq_one_letter_code_can ;GGSMTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEG FLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFY TLVREIRQYRLK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "GUANOSINE-5'-DIPHOSPHATE" GDP 3 'MAGNESIUM ION' MG 4 'N-(7-chloro-4-hydroxybenzo[d]thiazol-2-yl)-4-hydroxybenzenesulfonamide' A1IH1 5 1,2-ETHANEDIOL EDO 6 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLY n 1 3 SER n 1 4 MET n 1 5 THR n 1 6 GLU n 1 7 TYR n 1 8 LYS n 1 9 LEU n 1 10 VAL n 1 11 VAL n 1 12 VAL n 1 13 GLY n 1 14 ALA n 1 15 GLY n 1 16 GLY n 1 17 VAL n 1 18 GLY n 1 19 LYS n 1 20 SER n 1 21 ALA n 1 22 LEU n 1 23 THR n 1 24 ILE n 1 25 GLN n 1 26 LEU n 1 27 ILE n 1 28 GLN n 1 29 ASN n 1 30 HIS n 1 31 PHE n 1 32 VAL n 1 33 ASP n 1 34 GLU n 1 35 TYR n 1 36 ASP n 1 37 PRO n 1 38 THR n 1 39 ILE n 1 40 GLU n 1 41 ASP n 1 42 SER n 1 43 TYR n 1 44 ARG n 1 45 LYS n 1 46 GLN n 1 47 VAL n 1 48 VAL n 1 49 ILE n 1 50 ASP n 1 51 GLY n 1 52 GLU n 1 53 THR n 1 54 CYS n 1 55 LEU n 1 56 LEU n 1 57 ASP n 1 58 ILE n 1 59 LEU n 1 60 ASP n 1 61 THR n 1 62 ALA n 1 63 GLY n 1 64 GLN n 1 65 GLU n 1 66 GLU n 1 67 TYR n 1 68 SER n 1 69 ALA n 1 70 MET n 1 71 ARG n 1 72 ASP n 1 73 GLN n 1 74 TYR n 1 75 MET n 1 76 ARG n 1 77 THR n 1 78 GLY n 1 79 GLU n 1 80 GLY n 1 81 PHE n 1 82 LEU n 1 83 CYS n 1 84 VAL n 1 85 PHE n 1 86 ALA n 1 87 ILE n 1 88 ASN n 1 89 ASN n 1 90 THR n 1 91 LYS n 1 92 SER n 1 93 PHE n 1 94 GLU n 1 95 ASP n 1 96 ILE n 1 97 HIS n 1 98 HIS n 1 99 TYR n 1 100 ARG n 1 101 GLU n 1 102 GLN n 1 103 ILE n 1 104 LYS n 1 105 ARG n 1 106 VAL n 1 107 LYS n 1 108 ASP n 1 109 SER n 1 110 GLU n 1 111 ASP n 1 112 VAL n 1 113 PRO n 1 114 MET n 1 115 VAL n 1 116 LEU n 1 117 VAL n 1 118 GLY n 1 119 ASN n 1 120 LYS n 1 121 SER n 1 122 ASP n 1 123 LEU n 1 124 PRO n 1 125 SER n 1 126 ARG n 1 127 THR n 1 128 VAL n 1 129 ASP n 1 130 THR n 1 131 LYS n 1 132 GLN n 1 133 ALA n 1 134 GLN n 1 135 ASP n 1 136 LEU n 1 137 ALA n 1 138 ARG n 1 139 SER n 1 140 TYR n 1 141 GLY n 1 142 ILE n 1 143 PRO n 1 144 PHE n 1 145 ILE n 1 146 GLU n 1 147 THR n 1 148 SER n 1 149 ALA n 1 150 LYS n 1 151 THR n 1 152 ARG n 1 153 GLN n 1 154 ARG n 1 155 VAL n 1 156 GLU n 1 157 ASP n 1 158 ALA n 1 159 PHE n 1 160 TYR n 1 161 THR n 1 162 LEU n 1 163 VAL n 1 164 ARG n 1 165 GLU n 1 166 ILE n 1 167 ARG n 1 168 GLN n 1 169 TYR n 1 170 ARG n 1 171 LEU n 1 172 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 172 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'KRAS, KRAS2, RASK2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1IH1 non-polymer . 'N-(7-chloro-4-hydroxybenzo[d]thiazol-2-yl)-4-hydroxybenzenesulfonamide' 'N-(7-chloro-4-hydroxybenzo[d]thiazol-2-yl)-4-hydroxybenzenesulfonamide' 'C13 H9 Cl N2 O4 S2' 356.805 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GDP 'RNA linking' n "GUANOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O11 P2' 443.201 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 GLY 2 -1 ? ? ? A . n A 1 3 SER 3 0 0 SER SER A . n A 1 4 MET 4 1 1 MET MET A . n A 1 5 THR 5 2 2 THR THR A . n A 1 6 GLU 6 3 3 GLU GLU A . n A 1 7 TYR 7 4 4 TYR TYR A . n A 1 8 LYS 8 5 5 LYS LYS A . n A 1 9 LEU 9 6 6 LEU LEU A . n A 1 10 VAL 10 7 7 VAL VAL A . n A 1 11 VAL 11 8 8 VAL VAL A . n A 1 12 VAL 12 9 9 VAL VAL A . n A 1 13 GLY 13 10 10 GLY GLY A . n A 1 14 ALA 14 11 11 ALA ALA A . n A 1 15 GLY 15 12 12 GLY GLY A . n A 1 16 GLY 16 13 13 GLY GLY A . n A 1 17 VAL 17 14 14 VAL VAL A . n A 1 18 GLY 18 15 15 GLY GLY A . n A 1 19 LYS 19 16 16 LYS LYS A . n A 1 20 SER 20 17 17 SER SER A . n A 1 21 ALA 21 18 18 ALA ALA A . n A 1 22 LEU 22 19 19 LEU LEU A . n A 1 23 THR 23 20 20 THR THR A . n A 1 24 ILE 24 21 21 ILE ILE A . n A 1 25 GLN 25 22 22 GLN GLN A . n A 1 26 LEU 26 23 23 LEU LEU A . n A 1 27 ILE 27 24 24 ILE ILE A . n A 1 28 GLN 28 25 25 GLN GLN A . n A 1 29 ASN 29 26 26 ASN ASN A . n A 1 30 HIS 30 27 27 HIS HIS A . n A 1 31 PHE 31 28 28 PHE PHE A . n A 1 32 VAL 32 29 29 VAL VAL A . n A 1 33 ASP 33 30 30 ASP ASP A . n A 1 34 GLU 34 31 31 GLU GLU A . n A 1 35 TYR 35 32 32 TYR TYR A . n A 1 36 ASP 36 33 33 ASP ASP A . n A 1 37 PRO 37 34 34 PRO PRO A . n A 1 38 THR 38 35 35 THR THR A . n A 1 39 ILE 39 36 36 ILE ILE A . n A 1 40 GLU 40 37 37 GLU GLU A . n A 1 41 ASP 41 38 38 ASP ASP A . n A 1 42 SER 42 39 39 SER SER A . n A 1 43 TYR 43 40 40 TYR TYR A . n A 1 44 ARG 44 41 41 ARG ARG A . n A 1 45 LYS 45 42 42 LYS LYS A . n A 1 46 GLN 46 43 43 GLN GLN A . n A 1 47 VAL 47 44 44 VAL VAL A . n A 1 48 VAL 48 45 45 VAL VAL A . n A 1 49 ILE 49 46 46 ILE ILE A . n A 1 50 ASP 50 47 47 ASP ASP A . n A 1 51 GLY 51 48 48 GLY GLY A . n A 1 52 GLU 52 49 49 GLU GLU A . n A 1 53 THR 53 50 50 THR THR A . n A 1 54 CYS 54 51 51 CYS CYS A . n A 1 55 LEU 55 52 52 LEU LEU A . n A 1 56 LEU 56 53 53 LEU LEU A . n A 1 57 ASP 57 54 54 ASP ASP A . n A 1 58 ILE 58 55 55 ILE ILE A . n A 1 59 LEU 59 56 56 LEU LEU A . n A 1 60 ASP 60 57 57 ASP ASP A . n A 1 61 THR 61 58 58 THR THR A . n A 1 62 ALA 62 59 59 ALA ALA A . n A 1 63 GLY 63 60 60 GLY GLY A . n A 1 64 GLN 64 61 61 GLN GLN A . n A 1 65 GLU 65 62 62 GLU GLU A . n A 1 66 GLU 66 63 63 GLU GLU A . n A 1 67 TYR 67 64 64 TYR TYR A . n A 1 68 SER 68 65 65 SER SER A . n A 1 69 ALA 69 66 66 ALA ALA A . n A 1 70 MET 70 67 67 MET MET A . n A 1 71 ARG 71 68 68 ARG ARG A . n A 1 72 ASP 72 69 69 ASP ASP A . n A 1 73 GLN 73 70 70 GLN GLN A . n A 1 74 TYR 74 71 71 TYR TYR A . n A 1 75 MET 75 72 72 MET MET A . n A 1 76 ARG 76 73 73 ARG ARG A . n A 1 77 THR 77 74 74 THR THR A . n A 1 78 GLY 78 75 75 GLY GLY A . n A 1 79 GLU 79 76 76 GLU GLU A . n A 1 80 GLY 80 77 77 GLY GLY A . n A 1 81 PHE 81 78 78 PHE PHE A . n A 1 82 LEU 82 79 79 LEU LEU A . n A 1 83 CYS 83 80 80 CYS CYS A . n A 1 84 VAL 84 81 81 VAL VAL A . n A 1 85 PHE 85 82 82 PHE PHE A . n A 1 86 ALA 86 83 83 ALA ALA A . n A 1 87 ILE 87 84 84 ILE ILE A . n A 1 88 ASN 88 85 85 ASN ASN A . n A 1 89 ASN 89 86 86 ASN ASN A . n A 1 90 THR 90 87 87 THR THR A . n A 1 91 LYS 91 88 88 LYS LYS A . n A 1 92 SER 92 89 89 SER SER A . n A 1 93 PHE 93 90 90 PHE PHE A . n A 1 94 GLU 94 91 91 GLU GLU A . n A 1 95 ASP 95 92 92 ASP ASP A . n A 1 96 ILE 96 93 93 ILE ILE A . n A 1 97 HIS 97 94 94 HIS HIS A . n A 1 98 HIS 98 95 95 HIS HIS A . n A 1 99 TYR 99 96 96 TYR TYR A . n A 1 100 ARG 100 97 97 ARG ARG A . n A 1 101 GLU 101 98 98 GLU GLU A . n A 1 102 GLN 102 99 99 GLN GLN A . n A 1 103 ILE 103 100 100 ILE ILE A . n A 1 104 LYS 104 101 101 LYS LYS A . n A 1 105 ARG 105 102 102 ARG ARG A . n A 1 106 VAL 106 103 103 VAL VAL A . n A 1 107 LYS 107 104 104 LYS LYS A . n A 1 108 ASP 108 105 105 ASP ASP A . n A 1 109 SER 109 106 106 SER SER A . n A 1 110 GLU 110 107 107 GLU GLU A . n A 1 111 ASP 111 108 108 ASP ASP A . n A 1 112 VAL 112 109 109 VAL VAL A . n A 1 113 PRO 113 110 110 PRO PRO A . n A 1 114 MET 114 111 111 MET MET A . n A 1 115 VAL 115 112 112 VAL VAL A . n A 1 116 LEU 116 113 113 LEU LEU A . n A 1 117 VAL 117 114 114 VAL VAL A . n A 1 118 GLY 118 115 115 GLY GLY A . n A 1 119 ASN 119 116 116 ASN ASN A . n A 1 120 LYS 120 117 117 LYS LYS A . n A 1 121 SER 121 118 118 SER SER A . n A 1 122 ASP 122 119 119 ASP ASP A . n A 1 123 LEU 123 120 120 LEU LEU A . n A 1 124 PRO 124 121 121 PRO PRO A . n A 1 125 SER 125 122 122 SER SER A . n A 1 126 ARG 126 123 123 ARG ARG A . n A 1 127 THR 127 124 124 THR THR A . n A 1 128 VAL 128 125 125 VAL VAL A . n A 1 129 ASP 129 126 126 ASP ASP A . n A 1 130 THR 130 127 127 THR THR A . n A 1 131 LYS 131 128 128 LYS LYS A . n A 1 132 GLN 132 129 129 GLN GLN A . n A 1 133 ALA 133 130 130 ALA ALA A . n A 1 134 GLN 134 131 131 GLN GLN A . n A 1 135 ASP 135 132 132 ASP ASP A . n A 1 136 LEU 136 133 133 LEU LEU A . n A 1 137 ALA 137 134 134 ALA ALA A . n A 1 138 ARG 138 135 135 ARG ARG A . n A 1 139 SER 139 136 136 SER SER A . n A 1 140 TYR 140 137 137 TYR TYR A . n A 1 141 GLY 141 138 138 GLY GLY A . n A 1 142 ILE 142 139 139 ILE ILE A . n A 1 143 PRO 143 140 140 PRO PRO A . n A 1 144 PHE 144 141 141 PHE PHE A . n A 1 145 ILE 145 142 142 ILE ILE A . n A 1 146 GLU 146 143 143 GLU GLU A . n A 1 147 THR 147 144 144 THR THR A . n A 1 148 SER 148 145 145 SER SER A . n A 1 149 ALA 149 146 146 ALA ALA A . n A 1 150 LYS 150 147 147 LYS LYS A . n A 1 151 THR 151 148 148 THR THR A . n A 1 152 ARG 152 149 149 ARG ARG A . n A 1 153 GLN 153 150 150 GLN GLN A . n A 1 154 ARG 154 151 151 ARG ARG A . n A 1 155 VAL 155 152 152 VAL VAL A . n A 1 156 GLU 156 153 153 GLU GLU A . n A 1 157 ASP 157 154 154 ASP ASP A . n A 1 158 ALA 158 155 155 ALA ALA A . n A 1 159 PHE 159 156 156 PHE PHE A . n A 1 160 TYR 160 157 157 TYR TYR A . n A 1 161 THR 161 158 158 THR THR A . n A 1 162 LEU 162 159 159 LEU LEU A . n A 1 163 VAL 163 160 160 VAL VAL A . n A 1 164 ARG 164 161 161 ARG ARG A . n A 1 165 GLU 165 162 162 GLU GLU A . n A 1 166 ILE 166 163 163 ILE ILE A . n A 1 167 ARG 167 164 164 ARG ARG A . n A 1 168 GLN 168 165 165 GLN GLN A . n A 1 169 TYR 169 166 166 TYR TYR A . n A 1 170 ARG 170 167 167 ARG ARG A . n A 1 171 LEU 171 168 168 LEU LEU A . n A 1 172 LYS 172 169 169 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GDP 1 201 1000 GDP GDP A . C 3 MG 1 202 1001 MG MG A . D 4 A1IH1 1 203 1 A1IH1 DRG A . E 5 EDO 1 204 1 EDO EDO A . F 6 HOH 1 301 339 HOH HOH A . F 6 HOH 2 302 329 HOH HOH A . F 6 HOH 3 303 240 HOH HOH A . F 6 HOH 4 304 151 HOH HOH A . F 6 HOH 5 305 28 HOH HOH A . F 6 HOH 6 306 206 HOH HOH A . F 6 HOH 7 307 310 HOH HOH A . F 6 HOH 8 308 233 HOH HOH A . F 6 HOH 9 309 49 HOH HOH A . F 6 HOH 10 310 330 HOH HOH A . F 6 HOH 11 311 225 HOH HOH A . F 6 HOH 12 312 325 HOH HOH A . F 6 HOH 13 313 141 HOH HOH A . F 6 HOH 14 314 11 HOH HOH A . F 6 HOH 15 315 181 HOH HOH A . F 6 HOH 16 316 64 HOH HOH A . F 6 HOH 17 317 132 HOH HOH A . F 6 HOH 18 318 287 HOH HOH A . F 6 HOH 19 319 222 HOH HOH A . F 6 HOH 20 320 16 HOH HOH A . F 6 HOH 21 321 133 HOH HOH A . F 6 HOH 22 322 6 HOH HOH A . F 6 HOH 23 323 260 HOH HOH A . F 6 HOH 24 324 5 HOH HOH A . F 6 HOH 25 325 186 HOH HOH A . F 6 HOH 26 326 341 HOH HOH A . F 6 HOH 27 327 239 HOH HOH A . F 6 HOH 28 328 4 HOH HOH A . F 6 HOH 29 329 196 HOH HOH A . F 6 HOH 30 330 48 HOH HOH A . F 6 HOH 31 331 227 HOH HOH A . F 6 HOH 32 332 180 HOH HOH A . F 6 HOH 33 333 87 HOH HOH A . F 6 HOH 34 334 244 HOH HOH A . F 6 HOH 35 335 12 HOH HOH A . F 6 HOH 36 336 285 HOH HOH A . F 6 HOH 37 337 160 HOH HOH A . F 6 HOH 38 338 303 HOH HOH A . F 6 HOH 39 339 292 HOH HOH A . F 6 HOH 40 340 150 HOH HOH A . F 6 HOH 41 341 258 HOH HOH A . F 6 HOH 42 342 207 HOH HOH A . F 6 HOH 43 343 184 HOH HOH A . F 6 HOH 44 344 322 HOH HOH A . F 6 HOH 45 345 208 HOH HOH A . F 6 HOH 46 346 143 HOH HOH A . F 6 HOH 47 347 159 HOH HOH A . F 6 HOH 48 348 137 HOH HOH A . F 6 HOH 49 349 177 HOH HOH A . F 6 HOH 50 350 201 HOH HOH A . F 6 HOH 51 351 290 HOH HOH A . F 6 HOH 52 352 154 HOH HOH A . F 6 HOH 53 353 183 HOH HOH A . F 6 HOH 54 354 44 HOH HOH A . F 6 HOH 55 355 9 HOH HOH A . F 6 HOH 56 356 188 HOH HOH A . F 6 HOH 57 357 135 HOH HOH A . F 6 HOH 58 358 3 HOH HOH A . F 6 HOH 59 359 199 HOH HOH A . F 6 HOH 60 360 161 HOH HOH A . F 6 HOH 61 361 337 HOH HOH A . F 6 HOH 62 362 192 HOH HOH A . F 6 HOH 63 363 218 HOH HOH A . F 6 HOH 64 364 293 HOH HOH A . F 6 HOH 65 365 10 HOH HOH A . F 6 HOH 66 366 319 HOH HOH A . F 6 HOH 67 367 185 HOH HOH A . F 6 HOH 68 368 26 HOH HOH A . F 6 HOH 69 369 311 HOH HOH A . F 6 HOH 70 370 236 HOH HOH A . F 6 HOH 71 371 194 HOH HOH A . F 6 HOH 72 372 312 HOH HOH A . F 6 HOH 73 373 205 HOH HOH A . F 6 HOH 74 374 40 HOH HOH A . F 6 HOH 75 375 306 HOH HOH A . F 6 HOH 76 376 289 HOH HOH A . F 6 HOH 77 377 146 HOH HOH A . F 6 HOH 78 378 29 HOH HOH A . F 6 HOH 79 379 134 HOH HOH A . F 6 HOH 80 380 68 HOH HOH A . F 6 HOH 81 381 171 HOH HOH A . F 6 HOH 82 382 31 HOH HOH A . F 6 HOH 83 383 39 HOH HOH A . F 6 HOH 84 384 77 HOH HOH A . F 6 HOH 85 385 313 HOH HOH A . F 6 HOH 86 386 1 HOH HOH A . F 6 HOH 87 387 17 HOH HOH A . F 6 HOH 88 388 229 HOH HOH A . F 6 HOH 89 389 195 HOH HOH A . F 6 HOH 90 390 343 HOH HOH A . F 6 HOH 91 391 256 HOH HOH A . F 6 HOH 92 392 255 HOH HOH A . F 6 HOH 93 393 149 HOH HOH A . F 6 HOH 94 394 148 HOH HOH A . F 6 HOH 95 395 217 HOH HOH A . F 6 HOH 96 396 294 HOH HOH A . F 6 HOH 97 397 136 HOH HOH A . F 6 HOH 98 398 212 HOH HOH A . F 6 HOH 99 399 248 HOH HOH A . F 6 HOH 100 400 308 HOH HOH A . F 6 HOH 101 401 320 HOH HOH A . F 6 HOH 102 402 215 HOH HOH A . F 6 HOH 103 403 156 HOH HOH A . F 6 HOH 104 404 344 HOH HOH A . F 6 HOH 105 405 19 HOH HOH A . F 6 HOH 106 406 231 HOH HOH A . F 6 HOH 107 407 252 HOH HOH A . F 6 HOH 108 408 223 HOH HOH A . F 6 HOH 109 409 309 HOH HOH A . F 6 HOH 110 410 230 HOH HOH A . F 6 HOH 111 411 190 HOH HOH A . F 6 HOH 112 412 176 HOH HOH A . F 6 HOH 113 413 291 HOH HOH A . F 6 HOH 114 414 204 HOH HOH A . F 6 HOH 115 415 238 HOH HOH A . F 6 HOH 116 416 214 HOH HOH A . F 6 HOH 117 417 302 HOH HOH A . F 6 HOH 118 418 145 HOH HOH A . F 6 HOH 119 419 304 HOH HOH A . F 6 HOH 120 420 317 HOH HOH A . F 6 HOH 121 421 338 HOH HOH A . F 6 HOH 122 422 213 HOH HOH A . F 6 HOH 123 423 257 HOH HOH A . F 6 HOH 124 424 59 HOH HOH A . F 6 HOH 125 425 216 HOH HOH A . F 6 HOH 126 426 202 HOH HOH A . F 6 HOH 127 427 243 HOH HOH A . F 6 HOH 128 428 33 HOH HOH A . F 6 HOH 129 429 189 HOH HOH A . F 6 HOH 130 430 316 HOH HOH A . F 6 HOH 131 431 140 HOH HOH A . F 6 HOH 132 432 259 HOH HOH A . F 6 HOH 133 433 307 HOH HOH A . F 6 HOH 134 434 198 HOH HOH A . F 6 HOH 135 435 305 HOH HOH A . F 6 HOH 136 436 224 HOH HOH A . F 6 HOH 137 437 251 HOH HOH A . F 6 HOH 138 438 226 HOH HOH A . F 6 HOH 139 439 85 HOH HOH A . F 6 HOH 140 440 249 HOH HOH A . F 6 HOH 141 441 235 HOH HOH A . F 6 HOH 142 442 138 HOH HOH A . F 6 HOH 143 443 250 HOH HOH A . F 6 HOH 144 444 147 HOH HOH A . F 6 HOH 145 445 38 HOH HOH A . F 6 HOH 146 446 170 HOH HOH A . F 6 HOH 147 447 323 HOH HOH A . F 6 HOH 148 448 324 HOH HOH A . F 6 HOH 149 449 35 HOH HOH A . F 6 HOH 150 450 242 HOH HOH A . F 6 HOH 151 451 326 HOH HOH A . F 6 HOH 152 452 237 HOH HOH A . F 6 HOH 153 453 315 HOH HOH A . F 6 HOH 154 454 191 HOH HOH A . F 6 HOH 155 455 328 HOH HOH A . F 6 HOH 156 456 221 HOH HOH A . F 6 HOH 157 457 321 HOH HOH A . F 6 HOH 158 458 327 HOH HOH A . F 6 HOH 159 459 234 HOH HOH A . F 6 HOH 160 460 333 HOH HOH A . F 6 HOH 161 461 265 HOH HOH A . F 6 HOH 162 462 300 HOH HOH A . F 6 HOH 163 463 261 HOH HOH A . F 6 HOH 164 464 331 HOH HOH A . F 6 HOH 165 465 203 HOH HOH A . F 6 HOH 166 466 340 HOH HOH A . F 6 HOH 167 467 342 HOH HOH A . F 6 HOH 168 468 296 HOH HOH A . F 6 HOH 169 469 200 HOH HOH A . F 6 HOH 170 470 336 HOH HOH A . F 6 HOH 171 471 228 HOH HOH A . F 6 HOH 172 472 246 HOH HOH A . F 6 HOH 173 473 211 HOH HOH A . F 6 HOH 174 474 332 HOH HOH A . F 6 HOH 175 475 334 HOH HOH A . F 6 HOH 176 476 335 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A GLU 31 ? CG ? A GLU 34 CG 2 1 Y 0 A GLU 31 ? CD ? A GLU 34 CD 3 1 Y 0 A GLU 31 ? OE1 ? A GLU 34 OE1 4 1 Y 0 A GLU 31 ? OE2 ? A GLU 34 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0258 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? 0.3.8.0 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9G0Y _cell.details ? _cell.formula_units_Z ? _cell.length_a 36.880 _cell.length_a_esd ? _cell.length_b 40.240 _cell.length_b_esd ? _cell.length_c 110.570 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9G0Y _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9G0Y _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.09 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 41.21 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity 0.164 _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '27.5% PEG 8000, 400 mM LiCl' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 292 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-05-02 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97625 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I03' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97625 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I03 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 13.649 _reflns.entry_id 9G0Y _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.310 _reflns.d_resolution_low 22.780 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 40396 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.700 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.200 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.800 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.101 _reflns.pdbx_Rpim_I_all 0.041 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 250447 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.084 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 1.310 1.340 ? 1.300 ? ? ? ? 2939 ? ? ? ? ? ? ? ? ? ? ? 6.100 ? ? ? 1.450 0.578 ? 1 1 ? ? ? 100.000 ? 1.221 ? ? ? ? ? ? ? ? ? 5.860 22.780 ? 30.600 ? ? ? ? 531 ? ? ? ? ? ? ? ? ? ? ? 5.000 ? ? ? 0.056 0.024 ? 2 1 ? ? ? 98.100 ? 0.046 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] -0.9200 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 0.6400 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 0.2900 _refine.B_iso_max 74.310 _refine.B_iso_mean 18.6470 _refine.B_iso_min 9.140 _refine.correlation_coeff_Fo_to_Fc 0.9800 _refine.correlation_coeff_Fo_to_Fc_free 0.9750 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9G0Y _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.3100 _refine.ls_d_res_low 22.7800 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 38327 _refine.ls_number_reflns_R_free 2003 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.6500 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1423 _refine.ls_R_factor_R_free 0.1687 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1409 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.0490 _refine.pdbx_overall_ESU_R_Free 0.0460 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 2.1280 _refine.overall_SU_ML 0.0380 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.3100 _refine_hist.d_res_low 22.7800 _refine_hist.number_atoms_solvent 176 _refine_hist.number_atoms_total 1599 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 170 _refine_hist.pdbx_B_iso_mean_ligand 18.34 _refine_hist.pdbx_B_iso_mean_solvent 33.72 _refine_hist.pdbx_number_atoms_protein 1368 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 55 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.019 0.013 1470 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.035 0.018 1333 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 2.029 1.711 1995 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 2.378 1.608 3089 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 4.631 5.000 175 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 34.397 22.048 83 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 13.708 15.000 261 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 21.543 15.000 12 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.130 0.200 191 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 0.020 1642 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.012 0.020 316 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 2.555 1.611 694 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.548 1.608 693 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 3.188 2.432 871 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.715 3.000 2803 ? r_rigid_bond_restr ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.3100 _refine_ls_shell.d_res_low 1.3440 _refine_ls_shell.number_reflns_all 2929 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 168 _refine_ls_shell.number_reflns_R_work 2761 _refine_ls_shell.percent_reflns_obs 100.0000 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2790 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.3210 # _struct.entry_id 9G0Y _struct.title 'Human KRas4A (GDP) in complex with compound 11' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9G0Y _struct_keywords.text 'RAS, GTPase, inhibitor, CELL CYCLE' _struct_keywords.pdbx_keywords 'CELL CYCLE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RASK_HUMAN _struct_ref.pdbx_db_accession P01116 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLC VFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLV REIRQYRLK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9G0Y _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 172 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P01116 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 169 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 169 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9G0Y GLY A 1 ? UNP P01116 ? ? 'expression tag' -2 1 1 9G0Y GLY A 2 ? UNP P01116 ? ? 'expression tag' -1 2 1 9G0Y SER A 3 ? UNP P01116 ? ? 'expression tag' 0 3 1 9G0Y SER A 121 ? UNP P01116 CYS 118 'engineered mutation' 118 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 18 ? ASN A 29 ? GLY A 15 ASN A 26 1 ? 12 HELX_P HELX_P2 AA2 SER A 68 ? GLY A 78 ? SER A 65 GLY A 75 1 ? 11 HELX_P HELX_P3 AA3 ASN A 89 ? ASP A 108 ? ASN A 86 ASP A 105 1 ? 20 HELX_P HELX_P4 AA4 ASP A 129 ? GLY A 141 ? ASP A 126 GLY A 138 1 ? 13 HELX_P HELX_P5 AA5 ARG A 154 ? LEU A 171 ? ARG A 151 LEU A 168 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A SER 20 OG ? ? ? 1_555 C MG . MG ? ? A SER 17 A MG 202 1_555 ? ? ? ? ? ? ? 2.130 ? ? metalc2 metalc ? ? B GDP . O1B ? ? ? 1_555 C MG . MG ? ? A GDP 201 A MG 202 1_555 ? ? ? ? ? ? ? 2.118 ? ? metalc3 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 202 A HOH 312 1_555 ? ? ? ? ? ? ? 2.201 ? ? metalc4 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 202 A HOH 322 1_555 ? ? ? ? ? ? ? 2.081 ? ? metalc5 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 202 A HOH 324 1_555 ? ? ? ? ? ? ? 2.045 ? ? metalc6 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 202 A HOH 375 1_555 ? ? ? ? ? ? ? 2.137 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OG ? A SER 20 ? A SER 17 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O1B ? B GDP . ? A GDP 201 ? 1_555 92.3 ? 2 OG ? A SER 20 ? A SER 17 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? F HOH . ? A HOH 312 ? 1_555 92.5 ? 3 O1B ? B GDP . ? A GDP 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? F HOH . ? A HOH 312 ? 1_555 85.9 ? 4 OG ? A SER 20 ? A SER 17 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? F HOH . ? A HOH 322 ? 1_555 82.0 ? 5 O1B ? B GDP . ? A GDP 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? F HOH . ? A HOH 322 ? 1_555 94.4 ? 6 O ? F HOH . ? A HOH 312 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? F HOH . ? A HOH 322 ? 1_555 174.5 ? 7 OG ? A SER 20 ? A SER 17 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? F HOH . ? A HOH 324 ? 1_555 172.6 ? 8 O1B ? B GDP . ? A GDP 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? F HOH . ? A HOH 324 ? 1_555 88.8 ? 9 O ? F HOH . ? A HOH 312 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? F HOH . ? A HOH 324 ? 1_555 94.8 ? 10 O ? F HOH . ? A HOH 322 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? F HOH . ? A HOH 324 ? 1_555 90.7 ? 11 OG ? A SER 20 ? A SER 17 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? F HOH . ? A HOH 375 ? 1_555 91.0 ? 12 O1B ? B GDP . ? A GDP 201 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? F HOH . ? A HOH 375 ? 1_555 169.7 ? 13 O ? F HOH . ? A HOH 312 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? F HOH . ? A HOH 375 ? 1_555 84.2 ? 14 O ? F HOH . ? A HOH 322 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? F HOH . ? A HOH 375 ? 1_555 95.7 ? 15 O ? F HOH . ? A HOH 324 ? 1_555 MG ? C MG . ? A MG 202 ? 1_555 O ? F HOH . ? A HOH 375 ? 1_555 89.3 ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 6 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASP A 41 ? ILE A 49 ? ASP A 38 ILE A 46 AA1 2 GLU A 52 ? ASP A 60 ? GLU A 49 ASP A 57 AA1 3 THR A 5 ? VAL A 12 ? THR A 2 VAL A 9 AA1 4 GLY A 80 ? ALA A 86 ? GLY A 77 ALA A 83 AA1 5 MET A 114 ? ASN A 119 ? MET A 111 ASN A 116 AA1 6 PHE A 144 ? GLU A 146 ? PHE A 141 GLU A 143 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 47 ? N VAL A 44 O CYS A 54 ? O CYS A 51 AA1 2 3 O LEU A 59 ? O LEU A 56 N VAL A 11 ? N VAL A 8 AA1 3 4 N VAL A 12 ? N VAL A 9 O VAL A 84 ? O VAL A 81 AA1 4 5 N PHE A 85 ? N PHE A 82 O ASN A 119 ? O ASN A 116 AA1 5 6 N LEU A 116 ? N LEU A 113 O ILE A 145 ? O ILE A 142 # _pdbx_entry_details.entry_id 9G0Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 153 ? ? OE1 A GLU 153 ? ? 1.162 1.252 -0.090 0.011 N 2 1 CD A GLU 153 ? ? OE2 A GLU 153 ? ? 1.178 1.252 -0.074 0.011 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 31 ? ? -160.63 89.29 2 1 ALA A 59 ? ? -106.87 -83.70 3 1 LYS A 117 ? ? 71.47 37.78 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id MET _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 1 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id A _pdbx_validate_main_chain_plane.improper_torsion_angle -11.40 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 475 ? 6.77 . 2 1 O ? A HOH 476 ? 7.26 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A GLY -1 ? A GLY 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1IH1 CAM C Y N 1 A1IH1 CAN C Y N 2 A1IH1 CAO C Y N 3 A1IH1 OAV O N N 4 A1IH1 CAP C Y N 5 A1IH1 CAQ C Y N 6 A1IH1 CAL C Y N 7 A1IH1 SAK S N N 8 A1IH1 OAT O N N 9 A1IH1 OAU O N N 10 A1IH1 NAJ N N N 11 A1IH1 CAI C Y N 12 A1IH1 SAR S Y N 13 A1IH1 NAH N Y N 14 A1IH1 CAG C Y N 15 A1IH1 CAF C Y N 16 A1IH1 CAE C Y N 17 A1IH1 CL1 CL N N 18 A1IH1 CAD C Y N 19 A1IH1 CAC C Y N 20 A1IH1 CAB C Y N 21 A1IH1 OAA O N N 22 A1IH1 H1 H N N 23 A1IH1 H2 H N N 24 A1IH1 H3 H N N 25 A1IH1 H4 H N N 26 A1IH1 H5 H N N 27 A1IH1 H6 H N N 28 A1IH1 H7 H N N 29 A1IH1 H8 H N N 30 A1IH1 H9 H N N 31 ALA N N N N 32 ALA CA C N S 33 ALA C C N N 34 ALA O O N N 35 ALA CB C N N 36 ALA OXT O N N 37 ALA H H N N 38 ALA H2 H N N 39 ALA HA H N N 40 ALA HB1 H N N 41 ALA HB2 H N N 42 ALA HB3 H N N 43 ALA HXT H N N 44 ARG N N N N 45 ARG CA C N S 46 ARG C C N N 47 ARG O O N N 48 ARG CB C N N 49 ARG CG C N N 50 ARG CD C N N 51 ARG NE N N N 52 ARG CZ C N N 53 ARG NH1 N N N 54 ARG NH2 N N N 55 ARG OXT O N N 56 ARG H H N N 57 ARG H2 H N N 58 ARG HA H N N 59 ARG HB2 H N N 60 ARG HB3 H N N 61 ARG HG2 H N N 62 ARG HG3 H N N 63 ARG HD2 H N N 64 ARG HD3 H N N 65 ARG HE H N N 66 ARG HH11 H N N 67 ARG HH12 H N N 68 ARG HH21 H N N 69 ARG HH22 H N N 70 ARG HXT H N N 71 ASN N N N N 72 ASN CA C N S 73 ASN C C N N 74 ASN O O N N 75 ASN CB C N N 76 ASN CG C N N 77 ASN OD1 O N N 78 ASN ND2 N N N 79 ASN OXT O N N 80 ASN H H N N 81 ASN H2 H N N 82 ASN HA H N N 83 ASN HB2 H N N 84 ASN HB3 H N N 85 ASN HD21 H N N 86 ASN HD22 H N N 87 ASN HXT H N N 88 ASP N N N N 89 ASP CA C N S 90 ASP C C N N 91 ASP O O N N 92 ASP CB C N N 93 ASP CG C N N 94 ASP OD1 O N N 95 ASP OD2 O N N 96 ASP OXT O N N 97 ASP H H N N 98 ASP H2 H N N 99 ASP HA H N N 100 ASP HB2 H N N 101 ASP HB3 H N N 102 ASP HD2 H N N 103 ASP HXT H N N 104 CYS N N N N 105 CYS CA C N R 106 CYS C C N N 107 CYS O O N N 108 CYS CB C N N 109 CYS SG S N N 110 CYS OXT O N N 111 CYS H H N N 112 CYS H2 H N N 113 CYS HA H N N 114 CYS HB2 H N N 115 CYS HB3 H N N 116 CYS HG H N N 117 CYS HXT H N N 118 EDO C1 C N N 119 EDO O1 O N N 120 EDO C2 C N N 121 EDO O2 O N N 122 EDO H11 H N N 123 EDO H12 H N N 124 EDO HO1 H N N 125 EDO H21 H N N 126 EDO H22 H N N 127 EDO HO2 H N N 128 GDP PB P N N 129 GDP O1B O N N 130 GDP O2B O N N 131 GDP O3B O N N 132 GDP O3A O N N 133 GDP PA P N N 134 GDP O1A O N N 135 GDP O2A O N N 136 GDP "O5'" O N N 137 GDP "C5'" C N N 138 GDP "C4'" C N R 139 GDP "O4'" O N N 140 GDP "C3'" C N S 141 GDP "O3'" O N N 142 GDP "C2'" C N R 143 GDP "O2'" O N N 144 GDP "C1'" C N R 145 GDP N9 N Y N 146 GDP C8 C Y N 147 GDP N7 N Y N 148 GDP C5 C Y N 149 GDP C6 C N N 150 GDP O6 O N N 151 GDP N1 N N N 152 GDP C2 C N N 153 GDP N2 N N N 154 GDP N3 N N N 155 GDP C4 C Y N 156 GDP HOB2 H N N 157 GDP HOB3 H N N 158 GDP HOA2 H N N 159 GDP "H5'" H N N 160 GDP "H5''" H N N 161 GDP "H4'" H N N 162 GDP "H3'" H N N 163 GDP "HO3'" H N N 164 GDP "H2'" H N N 165 GDP "HO2'" H N N 166 GDP "H1'" H N N 167 GDP H8 H N N 168 GDP HN1 H N N 169 GDP HN21 H N N 170 GDP HN22 H N N 171 GLN N N N N 172 GLN CA C N S 173 GLN C C N N 174 GLN O O N N 175 GLN CB C N N 176 GLN CG C N N 177 GLN CD C N N 178 GLN OE1 O N N 179 GLN NE2 N N N 180 GLN OXT O N N 181 GLN H H N N 182 GLN H2 H N N 183 GLN HA H N N 184 GLN HB2 H N N 185 GLN HB3 H N N 186 GLN HG2 H N N 187 GLN HG3 H N N 188 GLN HE21 H N N 189 GLN HE22 H N N 190 GLN HXT H N N 191 GLU N N N N 192 GLU CA C N S 193 GLU C C N N 194 GLU O O N N 195 GLU CB C N N 196 GLU CG C N N 197 GLU CD C N N 198 GLU OE1 O N N 199 GLU OE2 O N N 200 GLU OXT O N N 201 GLU H H N N 202 GLU H2 H N N 203 GLU HA H N N 204 GLU HB2 H N N 205 GLU HB3 H N N 206 GLU HG2 H N N 207 GLU HG3 H N N 208 GLU HE2 H N N 209 GLU HXT H N N 210 GLY N N N N 211 GLY CA C N N 212 GLY C C N N 213 GLY O O N N 214 GLY OXT O N N 215 GLY H H N N 216 GLY H2 H N N 217 GLY HA2 H N N 218 GLY HA3 H N N 219 GLY HXT H N N 220 HIS N N N N 221 HIS CA C N S 222 HIS C C N N 223 HIS O O N N 224 HIS CB C N N 225 HIS CG C Y N 226 HIS ND1 N Y N 227 HIS CD2 C Y N 228 HIS CE1 C Y N 229 HIS NE2 N Y N 230 HIS OXT O N N 231 HIS H H N N 232 HIS H2 H N N 233 HIS HA H N N 234 HIS HB2 H N N 235 HIS HB3 H N N 236 HIS HD1 H N N 237 HIS HD2 H N N 238 HIS HE1 H N N 239 HIS HE2 H N N 240 HIS HXT H N N 241 HOH O O N N 242 HOH H1 H N N 243 HOH H2 H N N 244 ILE N N N N 245 ILE CA C N S 246 ILE C C N N 247 ILE O O N N 248 ILE CB C N S 249 ILE CG1 C N N 250 ILE CG2 C N N 251 ILE CD1 C N N 252 ILE OXT O N N 253 ILE H H N N 254 ILE H2 H N N 255 ILE HA H N N 256 ILE HB H N N 257 ILE HG12 H N N 258 ILE HG13 H N N 259 ILE HG21 H N N 260 ILE HG22 H N N 261 ILE HG23 H N N 262 ILE HD11 H N N 263 ILE HD12 H N N 264 ILE HD13 H N N 265 ILE HXT H N N 266 LEU N N N N 267 LEU CA C N S 268 LEU C C N N 269 LEU O O N N 270 LEU CB C N N 271 LEU CG C N N 272 LEU CD1 C N N 273 LEU CD2 C N N 274 LEU OXT O N N 275 LEU H H N N 276 LEU H2 H N N 277 LEU HA H N N 278 LEU HB2 H N N 279 LEU HB3 H N N 280 LEU HG H N N 281 LEU HD11 H N N 282 LEU HD12 H N N 283 LEU HD13 H N N 284 LEU HD21 H N N 285 LEU HD22 H N N 286 LEU HD23 H N N 287 LEU HXT H N N 288 LYS N N N N 289 LYS CA C N S 290 LYS C C N N 291 LYS O O N N 292 LYS CB C N N 293 LYS CG C N N 294 LYS CD C N N 295 LYS CE C N N 296 LYS NZ N N N 297 LYS OXT O N N 298 LYS H H N N 299 LYS H2 H N N 300 LYS HA H N N 301 LYS HB2 H N N 302 LYS HB3 H N N 303 LYS HG2 H N N 304 LYS HG3 H N N 305 LYS HD2 H N N 306 LYS HD3 H N N 307 LYS HE2 H N N 308 LYS HE3 H N N 309 LYS HZ1 H N N 310 LYS HZ2 H N N 311 LYS HZ3 H N N 312 LYS HXT H N N 313 MET N N N N 314 MET CA C N S 315 MET C C N N 316 MET O O N N 317 MET CB C N N 318 MET CG C N N 319 MET SD S N N 320 MET CE C N N 321 MET OXT O N N 322 MET H H N N 323 MET H2 H N N 324 MET HA H N N 325 MET HB2 H N N 326 MET HB3 H N N 327 MET HG2 H N N 328 MET HG3 H N N 329 MET HE1 H N N 330 MET HE2 H N N 331 MET HE3 H N N 332 MET HXT H N N 333 MG MG MG N N 334 PHE N N N N 335 PHE CA C N S 336 PHE C C N N 337 PHE O O N N 338 PHE CB C N N 339 PHE CG C Y N 340 PHE CD1 C Y N 341 PHE CD2 C Y N 342 PHE CE1 C Y N 343 PHE CE2 C Y N 344 PHE CZ C Y N 345 PHE OXT O N N 346 PHE H H N N 347 PHE H2 H N N 348 PHE HA H N N 349 PHE HB2 H N N 350 PHE HB3 H N N 351 PHE HD1 H N N 352 PHE HD2 H N N 353 PHE HE1 H N N 354 PHE HE2 H N N 355 PHE HZ H N N 356 PHE HXT H N N 357 PRO N N N N 358 PRO CA C N S 359 PRO C C N N 360 PRO O O N N 361 PRO CB C N N 362 PRO CG C N N 363 PRO CD C N N 364 PRO OXT O N N 365 PRO H H N N 366 PRO HA H N N 367 PRO HB2 H N N 368 PRO HB3 H N N 369 PRO HG2 H N N 370 PRO HG3 H N N 371 PRO HD2 H N N 372 PRO HD3 H N N 373 PRO HXT H N N 374 SER N N N N 375 SER CA C N S 376 SER C C N N 377 SER O O N N 378 SER CB C N N 379 SER OG O N N 380 SER OXT O N N 381 SER H H N N 382 SER H2 H N N 383 SER HA H N N 384 SER HB2 H N N 385 SER HB3 H N N 386 SER HG H N N 387 SER HXT H N N 388 THR N N N N 389 THR CA C N S 390 THR C C N N 391 THR O O N N 392 THR CB C N R 393 THR OG1 O N N 394 THR CG2 C N N 395 THR OXT O N N 396 THR H H N N 397 THR H2 H N N 398 THR HA H N N 399 THR HB H N N 400 THR HG1 H N N 401 THR HG21 H N N 402 THR HG22 H N N 403 THR HG23 H N N 404 THR HXT H N N 405 TYR N N N N 406 TYR CA C N S 407 TYR C C N N 408 TYR O O N N 409 TYR CB C N N 410 TYR CG C Y N 411 TYR CD1 C Y N 412 TYR CD2 C Y N 413 TYR CE1 C Y N 414 TYR CE2 C Y N 415 TYR CZ C Y N 416 TYR OH O N N 417 TYR OXT O N N 418 TYR H H N N 419 TYR H2 H N N 420 TYR HA H N N 421 TYR HB2 H N N 422 TYR HB3 H N N 423 TYR HD1 H N N 424 TYR HD2 H N N 425 TYR HE1 H N N 426 TYR HE2 H N N 427 TYR HH H N N 428 TYR HXT H N N 429 VAL N N N N 430 VAL CA C N S 431 VAL C C N N 432 VAL O O N N 433 VAL CB C N N 434 VAL CG1 C N N 435 VAL CG2 C N N 436 VAL OXT O N N 437 VAL H H N N 438 VAL H2 H N N 439 VAL HA H N N 440 VAL HB H N N 441 VAL HG11 H N N 442 VAL HG12 H N N 443 VAL HG13 H N N 444 VAL HG21 H N N 445 VAL HG22 H N N 446 VAL HG23 H N N 447 VAL HXT H N N 448 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1IH1 OAA CAB sing N N 1 A1IH1 CAC CAB doub Y N 2 A1IH1 CAC CAD sing Y N 3 A1IH1 CAB CAG sing Y N 4 A1IH1 CAD CAE doub Y N 5 A1IH1 CAG NAH sing Y N 6 A1IH1 CAG CAF doub Y N 7 A1IH1 NAH CAI doub Y N 8 A1IH1 CAE CAF sing Y N 9 A1IH1 CAE CL1 sing N N 10 A1IH1 CAF SAR sing Y N 11 A1IH1 CAI NAJ sing N N 12 A1IH1 CAI SAR sing Y N 13 A1IH1 NAJ SAK sing N N 14 A1IH1 SAK OAU doub N N 15 A1IH1 SAK CAL sing N N 16 A1IH1 SAK OAT doub N N 17 A1IH1 CAL CAQ doub Y N 18 A1IH1 CAL CAM sing Y N 19 A1IH1 CAQ CAP sing Y N 20 A1IH1 CAM CAN doub Y N 21 A1IH1 CAP CAO doub Y N 22 A1IH1 CAN CAO sing Y N 23 A1IH1 CAO OAV sing N N 24 A1IH1 CAM H1 sing N N 25 A1IH1 CAN H2 sing N N 26 A1IH1 OAV H3 sing N N 27 A1IH1 CAP H4 sing N N 28 A1IH1 CAQ H5 sing N N 29 A1IH1 NAJ H6 sing N N 30 A1IH1 CAD H7 sing N N 31 A1IH1 CAC H8 sing N N 32 A1IH1 OAA H9 sing N N 33 ALA N CA sing N N 34 ALA N H sing N N 35 ALA N H2 sing N N 36 ALA CA C sing N N 37 ALA CA CB sing N N 38 ALA CA HA sing N N 39 ALA C O doub N N 40 ALA C OXT sing N N 41 ALA CB HB1 sing N N 42 ALA CB HB2 sing N N 43 ALA CB HB3 sing N N 44 ALA OXT HXT sing N N 45 ARG N CA sing N N 46 ARG N H sing N N 47 ARG N H2 sing N N 48 ARG CA C sing N N 49 ARG CA CB sing N N 50 ARG CA HA sing N N 51 ARG C O doub N N 52 ARG C OXT sing N N 53 ARG CB CG sing N N 54 ARG CB HB2 sing N N 55 ARG CB HB3 sing N N 56 ARG CG CD sing N N 57 ARG CG HG2 sing N N 58 ARG CG HG3 sing N N 59 ARG CD NE sing N N 60 ARG CD HD2 sing N N 61 ARG CD HD3 sing N N 62 ARG NE CZ sing N N 63 ARG NE HE sing N N 64 ARG CZ NH1 sing N N 65 ARG CZ NH2 doub N N 66 ARG NH1 HH11 sing N N 67 ARG NH1 HH12 sing N N 68 ARG NH2 HH21 sing N N 69 ARG NH2 HH22 sing N N 70 ARG OXT HXT sing N N 71 ASN N CA sing N N 72 ASN N H sing N N 73 ASN N H2 sing N N 74 ASN CA C sing N N 75 ASN CA CB sing N N 76 ASN CA HA sing N N 77 ASN C O doub N N 78 ASN C OXT sing N N 79 ASN CB CG sing N N 80 ASN CB HB2 sing N N 81 ASN CB HB3 sing N N 82 ASN CG OD1 doub N N 83 ASN CG ND2 sing N N 84 ASN ND2 HD21 sing N N 85 ASN ND2 HD22 sing N N 86 ASN OXT HXT sing N N 87 ASP N CA sing N N 88 ASP N H sing N N 89 ASP N H2 sing N N 90 ASP CA C sing N N 91 ASP CA CB sing N N 92 ASP CA HA sing N N 93 ASP C O doub N N 94 ASP C OXT sing N N 95 ASP CB CG sing N N 96 ASP CB HB2 sing N N 97 ASP CB HB3 sing N N 98 ASP CG OD1 doub N N 99 ASP CG OD2 sing N N 100 ASP OD2 HD2 sing N N 101 ASP OXT HXT sing N N 102 CYS N CA sing N N 103 CYS N H sing N N 104 CYS N H2 sing N N 105 CYS CA C sing N N 106 CYS CA CB sing N N 107 CYS CA HA sing N N 108 CYS C O doub N N 109 CYS C OXT sing N N 110 CYS CB SG sing N N 111 CYS CB HB2 sing N N 112 CYS CB HB3 sing N N 113 CYS SG HG sing N N 114 CYS OXT HXT sing N N 115 EDO C1 O1 sing N N 116 EDO C1 C2 sing N N 117 EDO C1 H11 sing N N 118 EDO C1 H12 sing N N 119 EDO O1 HO1 sing N N 120 EDO C2 O2 sing N N 121 EDO C2 H21 sing N N 122 EDO C2 H22 sing N N 123 EDO O2 HO2 sing N N 124 GDP PB O1B doub N N 125 GDP PB O2B sing N N 126 GDP PB O3B sing N N 127 GDP PB O3A sing N N 128 GDP O2B HOB2 sing N N 129 GDP O3B HOB3 sing N N 130 GDP O3A PA sing N N 131 GDP PA O1A doub N N 132 GDP PA O2A sing N N 133 GDP PA "O5'" sing N N 134 GDP O2A HOA2 sing N N 135 GDP "O5'" "C5'" sing N N 136 GDP "C5'" "C4'" sing N N 137 GDP "C5'" "H5'" sing N N 138 GDP "C5'" "H5''" sing N N 139 GDP "C4'" "O4'" sing N N 140 GDP "C4'" "C3'" sing N N 141 GDP "C4'" "H4'" sing N N 142 GDP "O4'" "C1'" sing N N 143 GDP "C3'" "O3'" sing N N 144 GDP "C3'" "C2'" sing N N 145 GDP "C3'" "H3'" sing N N 146 GDP "O3'" "HO3'" sing N N 147 GDP "C2'" "O2'" sing N N 148 GDP "C2'" "C1'" sing N N 149 GDP "C2'" "H2'" sing N N 150 GDP "O2'" "HO2'" sing N N 151 GDP "C1'" N9 sing N N 152 GDP "C1'" "H1'" sing N N 153 GDP N9 C8 sing Y N 154 GDP N9 C4 sing Y N 155 GDP C8 N7 doub Y N 156 GDP C8 H8 sing N N 157 GDP N7 C5 sing Y N 158 GDP C5 C6 sing N N 159 GDP C5 C4 doub Y N 160 GDP C6 O6 doub N N 161 GDP C6 N1 sing N N 162 GDP N1 C2 sing N N 163 GDP N1 HN1 sing N N 164 GDP C2 N2 sing N N 165 GDP C2 N3 doub N N 166 GDP N2 HN21 sing N N 167 GDP N2 HN22 sing N N 168 GDP N3 C4 sing N N 169 GLN N CA sing N N 170 GLN N H sing N N 171 GLN N H2 sing N N 172 GLN CA C sing N N 173 GLN CA CB sing N N 174 GLN CA HA sing N N 175 GLN C O doub N N 176 GLN C OXT sing N N 177 GLN CB CG sing N N 178 GLN CB HB2 sing N N 179 GLN CB HB3 sing N N 180 GLN CG CD sing N N 181 GLN CG HG2 sing N N 182 GLN CG HG3 sing N N 183 GLN CD OE1 doub N N 184 GLN CD NE2 sing N N 185 GLN NE2 HE21 sing N N 186 GLN NE2 HE22 sing N N 187 GLN OXT HXT sing N N 188 GLU N CA sing N N 189 GLU N H sing N N 190 GLU N H2 sing N N 191 GLU CA C sing N N 192 GLU CA CB sing N N 193 GLU CA HA sing N N 194 GLU C O doub N N 195 GLU C OXT sing N N 196 GLU CB CG sing N N 197 GLU CB HB2 sing N N 198 GLU CB HB3 sing N N 199 GLU CG CD sing N N 200 GLU CG HG2 sing N N 201 GLU CG HG3 sing N N 202 GLU CD OE1 doub N N 203 GLU CD OE2 sing N N 204 GLU OE2 HE2 sing N N 205 GLU OXT HXT sing N N 206 GLY N CA sing N N 207 GLY N H sing N N 208 GLY N H2 sing N N 209 GLY CA C sing N N 210 GLY CA HA2 sing N N 211 GLY CA HA3 sing N N 212 GLY C O doub N N 213 GLY C OXT sing N N 214 GLY OXT HXT sing N N 215 HIS N CA sing N N 216 HIS N H sing N N 217 HIS N H2 sing N N 218 HIS CA C sing N N 219 HIS CA CB sing N N 220 HIS CA HA sing N N 221 HIS C O doub N N 222 HIS C OXT sing N N 223 HIS CB CG sing N N 224 HIS CB HB2 sing N N 225 HIS CB HB3 sing N N 226 HIS CG ND1 sing Y N 227 HIS CG CD2 doub Y N 228 HIS ND1 CE1 doub Y N 229 HIS ND1 HD1 sing N N 230 HIS CD2 NE2 sing Y N 231 HIS CD2 HD2 sing N N 232 HIS CE1 NE2 sing Y N 233 HIS CE1 HE1 sing N N 234 HIS NE2 HE2 sing N N 235 HIS OXT HXT sing N N 236 HOH O H1 sing N N 237 HOH O H2 sing N N 238 ILE N CA sing N N 239 ILE N H sing N N 240 ILE N H2 sing N N 241 ILE CA C sing N N 242 ILE CA CB sing N N 243 ILE CA HA sing N N 244 ILE C O doub N N 245 ILE C OXT sing N N 246 ILE CB CG1 sing N N 247 ILE CB CG2 sing N N 248 ILE CB HB sing N N 249 ILE CG1 CD1 sing N N 250 ILE CG1 HG12 sing N N 251 ILE CG1 HG13 sing N N 252 ILE CG2 HG21 sing N N 253 ILE CG2 HG22 sing N N 254 ILE CG2 HG23 sing N N 255 ILE CD1 HD11 sing N N 256 ILE CD1 HD12 sing N N 257 ILE CD1 HD13 sing N N 258 ILE OXT HXT sing N N 259 LEU N CA sing N N 260 LEU N H sing N N 261 LEU N H2 sing N N 262 LEU CA C sing N N 263 LEU CA CB sing N N 264 LEU CA HA sing N N 265 LEU C O doub N N 266 LEU C OXT sing N N 267 LEU CB CG sing N N 268 LEU CB HB2 sing N N 269 LEU CB HB3 sing N N 270 LEU CG CD1 sing N N 271 LEU CG CD2 sing N N 272 LEU CG HG sing N N 273 LEU CD1 HD11 sing N N 274 LEU CD1 HD12 sing N N 275 LEU CD1 HD13 sing N N 276 LEU CD2 HD21 sing N N 277 LEU CD2 HD22 sing N N 278 LEU CD2 HD23 sing N N 279 LEU OXT HXT sing N N 280 LYS N CA sing N N 281 LYS N H sing N N 282 LYS N H2 sing N N 283 LYS CA C sing N N 284 LYS CA CB sing N N 285 LYS CA HA sing N N 286 LYS C O doub N N 287 LYS C OXT sing N N 288 LYS CB CG sing N N 289 LYS CB HB2 sing N N 290 LYS CB HB3 sing N N 291 LYS CG CD sing N N 292 LYS CG HG2 sing N N 293 LYS CG HG3 sing N N 294 LYS CD CE sing N N 295 LYS CD HD2 sing N N 296 LYS CD HD3 sing N N 297 LYS CE NZ sing N N 298 LYS CE HE2 sing N N 299 LYS CE HE3 sing N N 300 LYS NZ HZ1 sing N N 301 LYS NZ HZ2 sing N N 302 LYS NZ HZ3 sing N N 303 LYS OXT HXT sing N N 304 MET N CA sing N N 305 MET N H sing N N 306 MET N H2 sing N N 307 MET CA C sing N N 308 MET CA CB sing N N 309 MET CA HA sing N N 310 MET C O doub N N 311 MET C OXT sing N N 312 MET CB CG sing N N 313 MET CB HB2 sing N N 314 MET CB HB3 sing N N 315 MET CG SD sing N N 316 MET CG HG2 sing N N 317 MET CG HG3 sing N N 318 MET SD CE sing N N 319 MET CE HE1 sing N N 320 MET CE HE2 sing N N 321 MET CE HE3 sing N N 322 MET OXT HXT sing N N 323 PHE N CA sing N N 324 PHE N H sing N N 325 PHE N H2 sing N N 326 PHE CA C sing N N 327 PHE CA CB sing N N 328 PHE CA HA sing N N 329 PHE C O doub N N 330 PHE C OXT sing N N 331 PHE CB CG sing N N 332 PHE CB HB2 sing N N 333 PHE CB HB3 sing N N 334 PHE CG CD1 doub Y N 335 PHE CG CD2 sing Y N 336 PHE CD1 CE1 sing Y N 337 PHE CD1 HD1 sing N N 338 PHE CD2 CE2 doub Y N 339 PHE CD2 HD2 sing N N 340 PHE CE1 CZ doub Y N 341 PHE CE1 HE1 sing N N 342 PHE CE2 CZ sing Y N 343 PHE CE2 HE2 sing N N 344 PHE CZ HZ sing N N 345 PHE OXT HXT sing N N 346 PRO N CA sing N N 347 PRO N CD sing N N 348 PRO N H sing N N 349 PRO CA C sing N N 350 PRO CA CB sing N N 351 PRO CA HA sing N N 352 PRO C O doub N N 353 PRO C OXT sing N N 354 PRO CB CG sing N N 355 PRO CB HB2 sing N N 356 PRO CB HB3 sing N N 357 PRO CG CD sing N N 358 PRO CG HG2 sing N N 359 PRO CG HG3 sing N N 360 PRO CD HD2 sing N N 361 PRO CD HD3 sing N N 362 PRO OXT HXT sing N N 363 SER N CA sing N N 364 SER N H sing N N 365 SER N H2 sing N N 366 SER CA C sing N N 367 SER CA CB sing N N 368 SER CA HA sing N N 369 SER C O doub N N 370 SER C OXT sing N N 371 SER CB OG sing N N 372 SER CB HB2 sing N N 373 SER CB HB3 sing N N 374 SER OG HG sing N N 375 SER OXT HXT sing N N 376 THR N CA sing N N 377 THR N H sing N N 378 THR N H2 sing N N 379 THR CA C sing N N 380 THR CA CB sing N N 381 THR CA HA sing N N 382 THR C O doub N N 383 THR C OXT sing N N 384 THR CB OG1 sing N N 385 THR CB CG2 sing N N 386 THR CB HB sing N N 387 THR OG1 HG1 sing N N 388 THR CG2 HG21 sing N N 389 THR CG2 HG22 sing N N 390 THR CG2 HG23 sing N N 391 THR OXT HXT sing N N 392 TYR N CA sing N N 393 TYR N H sing N N 394 TYR N H2 sing N N 395 TYR CA C sing N N 396 TYR CA CB sing N N 397 TYR CA HA sing N N 398 TYR C O doub N N 399 TYR C OXT sing N N 400 TYR CB CG sing N N 401 TYR CB HB2 sing N N 402 TYR CB HB3 sing N N 403 TYR CG CD1 doub Y N 404 TYR CG CD2 sing Y N 405 TYR CD1 CE1 sing Y N 406 TYR CD1 HD1 sing N N 407 TYR CD2 CE2 doub Y N 408 TYR CD2 HD2 sing N N 409 TYR CE1 CZ doub Y N 410 TYR CE1 HE1 sing N N 411 TYR CE2 CZ sing Y N 412 TYR CE2 HE2 sing N N 413 TYR CZ OH sing N N 414 TYR OH HH sing N N 415 TYR OXT HXT sing N N 416 VAL N CA sing N N 417 VAL N H sing N N 418 VAL N H2 sing N N 419 VAL CA C sing N N 420 VAL CA CB sing N N 421 VAL CA HA sing N N 422 VAL C O doub N N 423 VAL C OXT sing N N 424 VAL CB CG1 sing N N 425 VAL CB CG2 sing N N 426 VAL CB HB sing N N 427 VAL CG1 HG11 sing N N 428 VAL CG1 HG12 sing N N 429 VAL CG1 HG13 sing N N 430 VAL CG2 HG21 sing N N 431 VAL CG2 HG22 sing N N 432 VAL CG2 HG23 sing N N 433 VAL OXT HXT sing N N 434 # _pdbx_audit_support.funding_organization 'Cancer Research UK' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'unreleased crystal structure' # _atom_sites.entry_id 9G0Y _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.027115 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.024851 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009044 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL MG N O P S # loop_ # loop_ #