data_9GI9 # _entry.id 9GI9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.404 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9GI9 pdb_00009gi9 10.2210/pdb9gi9/pdb WWPDB D_1292141003 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-05-14 ? 2 'Structure model' 1 1 2025-06-11 ? 3 'Structure model' 1 2 2025-07-23 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.page_first' 6 2 'Structure model' '_citation.page_last' 7 2 'Structure model' '_citation.pdbx_database_id_DOI' 8 2 'Structure model' '_citation.pdbx_database_id_PubMed' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation.year' 11 3 'Structure model' '_citation.journal_volume' 12 3 'Structure model' '_citation.page_first' 13 3 'Structure model' '_citation.page_last' 14 3 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9GI9 _pdbx_database_status.recvd_initial_deposition_date 2024-08-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 9FRD unspecified PDB . 9FQP unspecified PDB . 9FQS unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email brendan@scorpiontx.com _pdbx_contact_author.name_first Brendan _pdbx_contact_author.name_last Hilbert _pdbx_contact_author.name_mi J _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-9353-1799 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Pagliarini, R.A.' 1 ? 'Henderson, J.A.' 2 ? 'Borrelli, D.R.' 3 ? 'Brooijmans, N.' 4 ? 'Hilbert, B.J.' 5 ? 'Huff, M.R.' 6 ? 'Ito, T.' 7 ? 'Kryukov, G.V.' 8 ? 'Ladd, B.' 9 ? 'Martin, B.R.' 10 ? 'Milgram, B.C.' 11 ? 'Motiwala, H.' 12 ? 'OHearn, E.' 13 ? 'Wang, W.' 14 ? 'Hata, A.' 15 ? 'Bellier, J.' 16 ? 'Kuzmic, P.' 17 ? 'Guzman-Perez, A.' 18 ? 'Jackson, E.L.' 19 ? 'Stuart, D.D.' 20 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Clin.Cancer Res.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1078-0432 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 31 _citation.language ? _citation.page_first 3002 _citation.page_last 3018 _citation.title ;STX-721, a Covalent EGFR/HER2 Exon 20 Inhibitor, Utilizes Exon 20-Mutant Dynamic Protein States and Achieves Unique Mutant Selectivity Across Human Cancer Models. ; _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1158/1078-0432.CCR-24-3833 _citation.pdbx_database_id_PubMed 40465424 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pagliarini, R.A.' 1 ? primary 'Henderson, J.A.' 2 ? primary 'Milgram, B.C.' 3 ? primary 'Borrelli, D.R.' 4 ? primary 'Brooijmans, N.' 5 ? primary 'Hilbert, B.J.' 6 ? primary 'Huff, M.R.' 7 ? primary 'Ito, T.' 8 ? primary 'Kryukov, G.V.' 9 ? primary 'Ladd, B.' 10 ? primary 'Martin, B.R.' 11 ? primary 'Motiwala, H.' 12 ? primary ;O'Hearn, E. ; 13 ? primary 'Tsai, C.F.' 14 ? primary 'Wang, W.' 15 ? primary 'Bellier, J.' 16 ? primary 'Boland, L.' 17 ? primary 'Clark, S.' 18 ? primary 'Hensley, E.' 19 ? primary 'Hata, A.N.' 20 ? primary 'Kuzmic, P.' 21 ? primary 'Guzman-Perez, A.' 22 ? primary 'Jackson, E.L.' 23 ? primary 'Stuart, D.D.' 24 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Epidermal growth factor receptor' 37579.457 1 2.7.10.1 ? >#FRAGMENT#< ? 2 non-polymer syn ;3-[(3-chloranyl-2-methoxy-phenyl)amino]-2-[3-[[(2~{R})-oxolan-2-yl]methoxy]pyridin-4-yl]-1,5,6,7-tetrahydropyrrolo[3,2-c]pyridin-4-one ; 468.933 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Proto-oncogene c-ErbB-1,Receptor tyrosine-protein kinase erbB-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSMGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNP HVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVK ITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGER LPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVD ADEYLIPQQG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSMGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNP HVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVK ITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGER LPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVD ADEYLIPQQG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name ;3-[(3-chloranyl-2-methoxy-phenyl)amino]-2-[3-[[(2~{R})-oxolan-2-yl]methoxy]pyridin-4-yl]-1,5,6,7-tetrahydropyrrolo[3,2-c]pyridin-4-one ; _pdbx_entity_nonpoly.comp_id A1ILZ # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 GLY n 1 5 GLU n 1 6 ALA n 1 7 PRO n 1 8 ASN n 1 9 GLN n 1 10 ALA n 1 11 LEU n 1 12 LEU n 1 13 ARG n 1 14 ILE n 1 15 LEU n 1 16 LYS n 1 17 GLU n 1 18 THR n 1 19 GLU n 1 20 PHE n 1 21 LYS n 1 22 LYS n 1 23 ILE n 1 24 LYS n 1 25 VAL n 1 26 LEU n 1 27 GLY n 1 28 SER n 1 29 GLY n 1 30 ALA n 1 31 PHE n 1 32 GLY n 1 33 THR n 1 34 VAL n 1 35 TYR n 1 36 LYS n 1 37 GLY n 1 38 LEU n 1 39 TRP n 1 40 ILE n 1 41 PRO n 1 42 GLU n 1 43 GLY n 1 44 GLU n 1 45 LYS n 1 46 VAL n 1 47 LYS n 1 48 ILE n 1 49 PRO n 1 50 VAL n 1 51 ALA n 1 52 ILE n 1 53 LYS n 1 54 GLU n 1 55 LEU n 1 56 ARG n 1 57 GLU n 1 58 ALA n 1 59 THR n 1 60 SER n 1 61 PRO n 1 62 LYS n 1 63 ALA n 1 64 ASN n 1 65 LYS n 1 66 GLU n 1 67 ILE n 1 68 LEU n 1 69 ASP n 1 70 GLU n 1 71 ALA n 1 72 TYR n 1 73 VAL n 1 74 MET n 1 75 ALA n 1 76 SER n 1 77 VAL n 1 78 ASP n 1 79 ASN n 1 80 PRO n 1 81 HIS n 1 82 VAL n 1 83 CYS n 1 84 ARG n 1 85 LEU n 1 86 LEU n 1 87 GLY n 1 88 ILE n 1 89 CYS n 1 90 LEU n 1 91 THR n 1 92 SER n 1 93 THR n 1 94 VAL n 1 95 GLN n 1 96 LEU n 1 97 ILE n 1 98 THR n 1 99 GLN n 1 100 LEU n 1 101 MET n 1 102 PRO n 1 103 PHE n 1 104 GLY n 1 105 CYS n 1 106 LEU n 1 107 LEU n 1 108 ASP n 1 109 TYR n 1 110 VAL n 1 111 ARG n 1 112 GLU n 1 113 HIS n 1 114 LYS n 1 115 ASP n 1 116 ASN n 1 117 ILE n 1 118 GLY n 1 119 SER n 1 120 GLN n 1 121 TYR n 1 122 LEU n 1 123 LEU n 1 124 ASN n 1 125 TRP n 1 126 CYS n 1 127 VAL n 1 128 GLN n 1 129 ILE n 1 130 ALA n 1 131 LYS n 1 132 GLY n 1 133 MET n 1 134 ASN n 1 135 TYR n 1 136 LEU n 1 137 GLU n 1 138 ASP n 1 139 ARG n 1 140 ARG n 1 141 LEU n 1 142 VAL n 1 143 HIS n 1 144 ARG n 1 145 ASP n 1 146 LEU n 1 147 ALA n 1 148 ALA n 1 149 ARG n 1 150 ASN n 1 151 VAL n 1 152 LEU n 1 153 VAL n 1 154 LYS n 1 155 THR n 1 156 PRO n 1 157 GLN n 1 158 HIS n 1 159 VAL n 1 160 LYS n 1 161 ILE n 1 162 THR n 1 163 ASP n 1 164 PHE n 1 165 GLY n 1 166 LEU n 1 167 ALA n 1 168 LYS n 1 169 LEU n 1 170 LEU n 1 171 GLY n 1 172 ALA n 1 173 GLU n 1 174 GLU n 1 175 LYS n 1 176 GLU n 1 177 TYR n 1 178 HIS n 1 179 ALA n 1 180 GLU n 1 181 GLY n 1 182 GLY n 1 183 LYS n 1 184 VAL n 1 185 PRO n 1 186 ILE n 1 187 LYS n 1 188 TRP n 1 189 MET n 1 190 ALA n 1 191 LEU n 1 192 GLU n 1 193 SER n 1 194 ILE n 1 195 LEU n 1 196 HIS n 1 197 ARG n 1 198 ILE n 1 199 TYR n 1 200 THR n 1 201 HIS n 1 202 GLN n 1 203 SER n 1 204 ASP n 1 205 VAL n 1 206 TRP n 1 207 SER n 1 208 TYR n 1 209 GLY n 1 210 VAL n 1 211 THR n 1 212 VAL n 1 213 TRP n 1 214 GLU n 1 215 LEU n 1 216 MET n 1 217 THR n 1 218 PHE n 1 219 GLY n 1 220 SER n 1 221 LYS n 1 222 PRO n 1 223 TYR n 1 224 ASP n 1 225 GLY n 1 226 ILE n 1 227 PRO n 1 228 ALA n 1 229 SER n 1 230 GLU n 1 231 ILE n 1 232 SER n 1 233 SER n 1 234 ILE n 1 235 LEU n 1 236 GLU n 1 237 LYS n 1 238 GLY n 1 239 GLU n 1 240 ARG n 1 241 LEU n 1 242 PRO n 1 243 GLN n 1 244 PRO n 1 245 PRO n 1 246 ILE n 1 247 CYS n 1 248 THR n 1 249 ILE n 1 250 ASP n 1 251 VAL n 1 252 TYR n 1 253 MET n 1 254 ILE n 1 255 MET n 1 256 VAL n 1 257 LYS n 1 258 CYS n 1 259 TRP n 1 260 MET n 1 261 ILE n 1 262 ASP n 1 263 ALA n 1 264 ASP n 1 265 SER n 1 266 ARG n 1 267 PRO n 1 268 LYS n 1 269 PHE n 1 270 ARG n 1 271 GLU n 1 272 LEU n 1 273 ILE n 1 274 ILE n 1 275 GLU n 1 276 PHE n 1 277 SER n 1 278 LYS n 1 279 MET n 1 280 ALA n 1 281 ARG n 1 282 ASP n 1 283 PRO n 1 284 GLN n 1 285 ARG n 1 286 TYR n 1 287 LEU n 1 288 VAL n 1 289 ILE n 1 290 GLN n 1 291 GLY n 1 292 ASP n 1 293 GLU n 1 294 ARG n 1 295 MET n 1 296 HIS n 1 297 LEU n 1 298 PRO n 1 299 SER n 1 300 PRO n 1 301 THR n 1 302 ASP n 1 303 SER n 1 304 ASN n 1 305 PHE n 1 306 TYR n 1 307 ARG n 1 308 ALA n 1 309 LEU n 1 310 MET n 1 311 ASP n 1 312 GLU n 1 313 GLU n 1 314 ASP n 1 315 MET n 1 316 ASP n 1 317 ASP n 1 318 VAL n 1 319 VAL n 1 320 ASP n 1 321 ALA n 1 322 ASP n 1 323 GLU n 1 324 TYR n 1 325 LEU n 1 326 ILE n 1 327 PRO n 1 328 GLN n 1 329 GLN n 1 330 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 330 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'EGFR, ERBB, ERBB1, HER1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1ILZ non-polymer . ;3-[(3-chloranyl-2-methoxy-phenyl)amino]-2-[3-[[(2~{R})-oxolan-2-yl]methoxy]pyridin-4-yl]-1,5,6,7-tetrahydropyrrolo[3,2-c]pyridin-4-one ; ? 'C24 H25 Cl N4 O4' 468.933 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 693 ? ? ? A . n A 1 2 SER 2 694 ? ? ? A . n A 1 3 MET 3 695 ? ? ? A . n A 1 4 GLY 4 696 696 GLY GLY A . n A 1 5 GLU 5 697 697 GLU GLU A . n A 1 6 ALA 6 698 698 ALA ALA A . n A 1 7 PRO 7 699 699 PRO PRO A . n A 1 8 ASN 8 700 700 ASN ASN A . n A 1 9 GLN 9 701 701 GLN GLN A . n A 1 10 ALA 10 702 702 ALA ALA A . n A 1 11 LEU 11 703 703 LEU LEU A . n A 1 12 LEU 12 704 704 LEU LEU A . n A 1 13 ARG 13 705 705 ARG ARG A . n A 1 14 ILE 14 706 706 ILE ILE A . n A 1 15 LEU 15 707 707 LEU LEU A . n A 1 16 LYS 16 708 708 LYS LYS A . n A 1 17 GLU 17 709 709 GLU GLU A . n A 1 18 THR 18 710 710 THR THR A . n A 1 19 GLU 19 711 711 GLU GLU A . n A 1 20 PHE 20 712 712 PHE PHE A . n A 1 21 LYS 21 713 713 LYS LYS A . n A 1 22 LYS 22 714 714 LYS LYS A . n A 1 23 ILE 23 715 715 ILE ILE A . n A 1 24 LYS 24 716 716 LYS LYS A . n A 1 25 VAL 25 717 717 VAL VAL A . n A 1 26 LEU 26 718 718 LEU LEU A . n A 1 27 GLY 27 719 719 GLY GLY A . n A 1 28 SER 28 720 720 SER SER A . n A 1 29 GLY 29 721 721 GLY GLY A . n A 1 30 ALA 30 722 722 ALA ALA A . n A 1 31 PHE 31 723 723 PHE PHE A . n A 1 32 GLY 32 724 724 GLY GLY A . n A 1 33 THR 33 725 725 THR THR A . n A 1 34 VAL 34 726 726 VAL VAL A . n A 1 35 TYR 35 727 727 TYR TYR A . n A 1 36 LYS 36 728 728 LYS LYS A . n A 1 37 GLY 37 729 729 GLY GLY A . n A 1 38 LEU 38 730 730 LEU LEU A . n A 1 39 TRP 39 731 731 TRP TRP A . n A 1 40 ILE 40 732 732 ILE ILE A . n A 1 41 PRO 41 733 733 PRO PRO A . n A 1 42 GLU 42 734 734 GLU GLU A . n A 1 43 GLY 43 735 735 GLY GLY A . n A 1 44 GLU 44 736 736 GLU GLU A . n A 1 45 LYS 45 737 737 LYS LYS A . n A 1 46 VAL 46 738 738 VAL VAL A . n A 1 47 LYS 47 739 739 LYS LYS A . n A 1 48 ILE 48 740 740 ILE ILE A . n A 1 49 PRO 49 741 741 PRO PRO A . n A 1 50 VAL 50 742 742 VAL VAL A . n A 1 51 ALA 51 743 743 ALA ALA A . n A 1 52 ILE 52 744 744 ILE ILE A . n A 1 53 LYS 53 745 745 LYS LYS A . n A 1 54 GLU 54 746 746 GLU GLU A . n A 1 55 LEU 55 747 747 LEU LEU A . n A 1 56 ARG 56 748 748 ARG ARG A . n A 1 57 GLU 57 749 749 GLU GLU A . n A 1 58 ALA 58 750 750 ALA ALA A . n A 1 59 THR 59 751 751 THR THR A . n A 1 60 SER 60 752 752 SER SER A . n A 1 61 PRO 61 753 753 PRO PRO A . n A 1 62 LYS 62 754 754 LYS LYS A . n A 1 63 ALA 63 755 755 ALA ALA A . n A 1 64 ASN 64 756 756 ASN ASN A . n A 1 65 LYS 65 757 757 LYS LYS A . n A 1 66 GLU 66 758 758 GLU GLU A . n A 1 67 ILE 67 759 759 ILE ILE A . n A 1 68 LEU 68 760 760 LEU LEU A . n A 1 69 ASP 69 761 761 ASP ASP A . n A 1 70 GLU 70 762 762 GLU GLU A . n A 1 71 ALA 71 763 763 ALA ALA A . n A 1 72 TYR 72 764 764 TYR TYR A . n A 1 73 VAL 73 765 765 VAL VAL A . n A 1 74 MET 74 766 766 MET MET A . n A 1 75 ALA 75 767 767 ALA ALA A . n A 1 76 SER 76 768 768 SER SER A . n A 1 77 VAL 77 769 769 VAL VAL A . n A 1 78 ASP 78 770 770 ASP ASP A . n A 1 79 ASN 79 771 771 ASN ASN A . n A 1 80 PRO 80 772 772 PRO PRO A . n A 1 81 HIS 81 773 773 HIS HIS A . n A 1 82 VAL 82 774 774 VAL VAL A . n A 1 83 CYS 83 775 775 CYS CYS A . n A 1 84 ARG 84 776 776 ARG ARG A . n A 1 85 LEU 85 777 777 LEU LEU A . n A 1 86 LEU 86 778 778 LEU LEU A . n A 1 87 GLY 87 779 779 GLY GLY A . n A 1 88 ILE 88 780 780 ILE ILE A . n A 1 89 CYS 89 781 781 CYS CYS A . n A 1 90 LEU 90 782 782 LEU LEU A . n A 1 91 THR 91 783 783 THR THR A . n A 1 92 SER 92 784 784 SER SER A . n A 1 93 THR 93 785 785 THR THR A . n A 1 94 VAL 94 786 786 VAL VAL A . n A 1 95 GLN 95 787 787 GLN GLN A . n A 1 96 LEU 96 788 788 LEU LEU A . n A 1 97 ILE 97 789 789 ILE ILE A . n A 1 98 THR 98 790 790 THR THR A . n A 1 99 GLN 99 791 791 GLN GLN A . n A 1 100 LEU 100 792 792 LEU LEU A . n A 1 101 MET 101 793 793 MET MET A . n A 1 102 PRO 102 794 794 PRO PRO A . n A 1 103 PHE 103 795 795 PHE PHE A . n A 1 104 GLY 104 796 796 GLY GLY A . n A 1 105 CYS 105 797 797 CYS CYS A . n A 1 106 LEU 106 798 798 LEU LEU A . n A 1 107 LEU 107 799 799 LEU LEU A . n A 1 108 ASP 108 800 800 ASP ASP A . n A 1 109 TYR 109 801 801 TYR TYR A . n A 1 110 VAL 110 802 802 VAL VAL A . n A 1 111 ARG 111 803 803 ARG ARG A . n A 1 112 GLU 112 804 804 GLU GLU A . n A 1 113 HIS 113 805 805 HIS HIS A . n A 1 114 LYS 114 806 806 LYS LYS A . n A 1 115 ASP 115 807 807 ASP ASP A . n A 1 116 ASN 116 808 808 ASN ASN A . n A 1 117 ILE 117 809 809 ILE ILE A . n A 1 118 GLY 118 810 810 GLY GLY A . n A 1 119 SER 119 811 811 SER SER A . n A 1 120 GLN 120 812 812 GLN GLN A . n A 1 121 TYR 121 813 813 TYR TYR A . n A 1 122 LEU 122 814 814 LEU LEU A . n A 1 123 LEU 123 815 815 LEU LEU A . n A 1 124 ASN 124 816 816 ASN ASN A . n A 1 125 TRP 125 817 817 TRP TRP A . n A 1 126 CYS 126 818 818 CYS CYS A . n A 1 127 VAL 127 819 819 VAL VAL A . n A 1 128 GLN 128 820 820 GLN GLN A . n A 1 129 ILE 129 821 821 ILE ILE A . n A 1 130 ALA 130 822 822 ALA ALA A . n A 1 131 LYS 131 823 823 LYS LYS A . n A 1 132 GLY 132 824 824 GLY GLY A . n A 1 133 MET 133 825 825 MET MET A . n A 1 134 ASN 134 826 826 ASN ASN A . n A 1 135 TYR 135 827 827 TYR TYR A . n A 1 136 LEU 136 828 828 LEU LEU A . n A 1 137 GLU 137 829 829 GLU GLU A . n A 1 138 ASP 138 830 830 ASP ASP A . n A 1 139 ARG 139 831 831 ARG ARG A . n A 1 140 ARG 140 832 832 ARG ARG A . n A 1 141 LEU 141 833 833 LEU LEU A . n A 1 142 VAL 142 834 834 VAL VAL A . n A 1 143 HIS 143 835 835 HIS HIS A . n A 1 144 ARG 144 836 836 ARG ARG A . n A 1 145 ASP 145 837 837 ASP ASP A . n A 1 146 LEU 146 838 838 LEU LEU A . n A 1 147 ALA 147 839 839 ALA ALA A . n A 1 148 ALA 148 840 840 ALA ALA A . n A 1 149 ARG 149 841 841 ARG ARG A . n A 1 150 ASN 150 842 842 ASN ASN A . n A 1 151 VAL 151 843 843 VAL VAL A . n A 1 152 LEU 152 844 844 LEU LEU A . n A 1 153 VAL 153 845 845 VAL VAL A . n A 1 154 LYS 154 846 846 LYS LYS A . n A 1 155 THR 155 847 847 THR THR A . n A 1 156 PRO 156 848 848 PRO PRO A . n A 1 157 GLN 157 849 849 GLN GLN A . n A 1 158 HIS 158 850 850 HIS HIS A . n A 1 159 VAL 159 851 851 VAL VAL A . n A 1 160 LYS 160 852 852 LYS LYS A . n A 1 161 ILE 161 853 853 ILE ILE A . n A 1 162 THR 162 854 854 THR THR A . n A 1 163 ASP 163 855 855 ASP ASP A . n A 1 164 PHE 164 856 856 PHE PHE A . n A 1 165 GLY 165 857 857 GLY GLY A . n A 1 166 LEU 166 858 858 LEU LEU A . n A 1 167 ALA 167 859 859 ALA ALA A . n A 1 168 LYS 168 860 860 LYS LYS A . n A 1 169 LEU 169 861 861 LEU LEU A . n A 1 170 LEU 170 862 862 LEU LEU A . n A 1 171 GLY 171 863 ? ? ? A . n A 1 172 ALA 172 864 ? ? ? A . n A 1 173 GLU 173 865 ? ? ? A . n A 1 174 GLU 174 866 ? ? ? A . n A 1 175 LYS 175 867 ? ? ? A . n A 1 176 GLU 176 868 ? ? ? A . n A 1 177 TYR 177 869 ? ? ? A . n A 1 178 HIS 178 870 870 HIS HIS A . n A 1 179 ALA 179 871 871 ALA ALA A . n A 1 180 GLU 180 872 872 GLU GLU A . n A 1 181 GLY 181 873 873 GLY GLY A . n A 1 182 GLY 182 874 874 GLY GLY A . n A 1 183 LYS 183 875 875 LYS LYS A . n A 1 184 VAL 184 876 876 VAL VAL A . n A 1 185 PRO 185 877 877 PRO PRO A . n A 1 186 ILE 186 878 878 ILE ILE A . n A 1 187 LYS 187 879 879 LYS LYS A . n A 1 188 TRP 188 880 880 TRP TRP A . n A 1 189 MET 189 881 881 MET MET A . n A 1 190 ALA 190 882 882 ALA ALA A . n A 1 191 LEU 191 883 883 LEU LEU A . n A 1 192 GLU 192 884 884 GLU GLU A . n A 1 193 SER 193 885 885 SER SER A . n A 1 194 ILE 194 886 886 ILE ILE A . n A 1 195 LEU 195 887 887 LEU LEU A . n A 1 196 HIS 196 888 888 HIS HIS A . n A 1 197 ARG 197 889 889 ARG ARG A . n A 1 198 ILE 198 890 890 ILE ILE A . n A 1 199 TYR 199 891 891 TYR TYR A . n A 1 200 THR 200 892 892 THR THR A . n A 1 201 HIS 201 893 893 HIS HIS A . n A 1 202 GLN 202 894 894 GLN GLN A . n A 1 203 SER 203 895 895 SER SER A . n A 1 204 ASP 204 896 896 ASP ASP A . n A 1 205 VAL 205 897 897 VAL VAL A . n A 1 206 TRP 206 898 898 TRP TRP A . n A 1 207 SER 207 899 899 SER SER A . n A 1 208 TYR 208 900 900 TYR TYR A . n A 1 209 GLY 209 901 901 GLY GLY A . n A 1 210 VAL 210 902 902 VAL VAL A . n A 1 211 THR 211 903 903 THR THR A . n A 1 212 VAL 212 904 904 VAL VAL A . n A 1 213 TRP 213 905 905 TRP TRP A . n A 1 214 GLU 214 906 906 GLU GLU A . n A 1 215 LEU 215 907 907 LEU LEU A . n A 1 216 MET 216 908 908 MET MET A . n A 1 217 THR 217 909 909 THR THR A . n A 1 218 PHE 218 910 910 PHE PHE A . n A 1 219 GLY 219 911 911 GLY GLY A . n A 1 220 SER 220 912 912 SER SER A . n A 1 221 LYS 221 913 913 LYS LYS A . n A 1 222 PRO 222 914 914 PRO PRO A . n A 1 223 TYR 223 915 915 TYR TYR A . n A 1 224 ASP 224 916 916 ASP ASP A . n A 1 225 GLY 225 917 917 GLY GLY A . n A 1 226 ILE 226 918 918 ILE ILE A . n A 1 227 PRO 227 919 919 PRO PRO A . n A 1 228 ALA 228 920 920 ALA ALA A . n A 1 229 SER 229 921 921 SER SER A . n A 1 230 GLU 230 922 922 GLU GLU A . n A 1 231 ILE 231 923 923 ILE ILE A . n A 1 232 SER 232 924 924 SER SER A . n A 1 233 SER 233 925 925 SER SER A . n A 1 234 ILE 234 926 926 ILE ILE A . n A 1 235 LEU 235 927 927 LEU LEU A . n A 1 236 GLU 236 928 928 GLU GLU A . n A 1 237 LYS 237 929 929 LYS LYS A . n A 1 238 GLY 238 930 930 GLY GLY A . n A 1 239 GLU 239 931 931 GLU GLU A . n A 1 240 ARG 240 932 932 ARG ARG A . n A 1 241 LEU 241 933 933 LEU LEU A . n A 1 242 PRO 242 934 934 PRO PRO A . n A 1 243 GLN 243 935 935 GLN GLN A . n A 1 244 PRO 244 936 936 PRO PRO A . n A 1 245 PRO 245 937 937 PRO PRO A . n A 1 246 ILE 246 938 938 ILE ILE A . n A 1 247 CYS 247 939 939 CYS CYS A . n A 1 248 THR 248 940 940 THR THR A . n A 1 249 ILE 249 941 941 ILE ILE A . n A 1 250 ASP 250 942 942 ASP ASP A . n A 1 251 VAL 251 943 943 VAL VAL A . n A 1 252 TYR 252 944 944 TYR TYR A . n A 1 253 MET 253 945 945 MET MET A . n A 1 254 ILE 254 946 946 ILE ILE A . n A 1 255 MET 255 947 947 MET MET A . n A 1 256 VAL 256 948 948 VAL VAL A . n A 1 257 LYS 257 949 949 LYS LYS A . n A 1 258 CYS 258 950 950 CYS CYS A . n A 1 259 TRP 259 951 951 TRP TRP A . n A 1 260 MET 260 952 952 MET MET A . n A 1 261 ILE 261 953 953 ILE ILE A . n A 1 262 ASP 262 954 954 ASP ASP A . n A 1 263 ALA 263 955 955 ALA ALA A . n A 1 264 ASP 264 956 956 ASP ASP A . n A 1 265 SER 265 957 957 SER SER A . n A 1 266 ARG 266 958 958 ARG ARG A . n A 1 267 PRO 267 959 959 PRO PRO A . n A 1 268 LYS 268 960 960 LYS LYS A . n A 1 269 PHE 269 961 961 PHE PHE A . n A 1 270 ARG 270 962 962 ARG ARG A . n A 1 271 GLU 271 963 963 GLU GLU A . n A 1 272 LEU 272 964 964 LEU LEU A . n A 1 273 ILE 273 965 965 ILE ILE A . n A 1 274 ILE 274 966 966 ILE ILE A . n A 1 275 GLU 275 967 967 GLU GLU A . n A 1 276 PHE 276 968 968 PHE PHE A . n A 1 277 SER 277 969 969 SER SER A . n A 1 278 LYS 278 970 970 LYS LYS A . n A 1 279 MET 279 971 971 MET MET A . n A 1 280 ALA 280 972 972 ALA ALA A . n A 1 281 ARG 281 973 973 ARG ARG A . n A 1 282 ASP 282 974 974 ASP ASP A . n A 1 283 PRO 283 975 975 PRO PRO A . n A 1 284 GLN 284 976 976 GLN GLN A . n A 1 285 ARG 285 977 977 ARG ARG A . n A 1 286 TYR 286 978 978 TYR TYR A . n A 1 287 LEU 287 979 979 LEU LEU A . n A 1 288 VAL 288 980 980 VAL VAL A . n A 1 289 ILE 289 981 981 ILE ILE A . n A 1 290 GLN 290 982 982 GLN GLN A . n A 1 291 GLY 291 983 983 GLY GLY A . n A 1 292 ASP 292 984 984 ASP ASP A . n A 1 293 GLU 293 985 985 GLU GLU A . n A 1 294 ARG 294 986 986 ARG ARG A . n A 1 295 MET 295 987 987 MET MET A . n A 1 296 HIS 296 988 988 HIS HIS A . n A 1 297 LEU 297 989 989 LEU LEU A . n A 1 298 PRO 298 990 990 PRO PRO A . n A 1 299 SER 299 991 ? ? ? A . n A 1 300 PRO 300 992 ? ? ? A . n A 1 301 THR 301 993 ? ? ? A . n A 1 302 ASP 302 994 ? ? ? A . n A 1 303 SER 303 995 ? ? ? A . n A 1 304 ASN 304 996 ? ? ? A . n A 1 305 PHE 305 997 ? ? ? A . n A 1 306 TYR 306 998 ? ? ? A . n A 1 307 ARG 307 999 999 ARG ARG A . n A 1 308 ALA 308 1000 1000 ALA ALA A . n A 1 309 LEU 309 1001 1001 LEU LEU A . n A 1 310 MET 310 1002 1002 MET MET A . n A 1 311 ASP 311 1003 1003 ASP ASP A . n A 1 312 GLU 312 1004 1004 GLU GLU A . n A 1 313 GLU 313 1005 1005 GLU GLU A . n A 1 314 ASP 314 1006 1006 ASP ASP A . n A 1 315 MET 315 1007 1007 MET MET A . n A 1 316 ASP 316 1008 1008 ASP ASP A . n A 1 317 ASP 317 1009 1009 ASP ASP A . n A 1 318 VAL 318 1010 1010 VAL VAL A . n A 1 319 VAL 319 1011 1011 VAL VAL A . n A 1 320 ASP 320 1012 1012 ASP ASP A . n A 1 321 ALA 321 1013 1013 ALA ALA A . n A 1 322 ASP 322 1014 1014 ASP ASP A . n A 1 323 GLU 323 1015 1015 GLU GLU A . n A 1 324 TYR 324 1016 1016 TYR TYR A . n A 1 325 LEU 325 1017 1017 LEU LEU A . n A 1 326 ILE 326 1018 1018 ILE ILE A . n A 1 327 PRO 327 1019 ? ? ? A . n A 1 328 GLN 328 1020 ? ? ? A . n A 1 329 GLN 329 1021 ? ? ? A . n A 1 330 GLY 330 1022 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1ILZ _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1ILZ _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id A1ILZ _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 1101 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id A1ILZ _pdbx_nonpoly_scheme.auth_mon_id INX _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.28 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? PROCOR ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9GI9 _cell.details ? _cell.formula_units_Z ? _cell.length_a 147.845 _cell.length_a_esd ? _cell.length_b 147.845 _cell.length_b_esd ? _cell.length_c 147.845 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9GI9 _symmetry.cell_setting ? _symmetry.Int_Tables_number 197 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9GI9 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.710 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 66.830 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;sodium tartrate, sodium acetate, ammonium chloride ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-09-23 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000038 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X10SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000038 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X10SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9GI9 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.12 _reflns.d_resolution_low 73.923 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9052 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 93.400 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 25.100 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.300 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.276 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.276 _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 3.122 _reflns_shell.d_res_low 3.237 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.400 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 446 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 26.200 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 47.100 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 3.489 _reflns_shell.pdbx_Rsym_value 3.489 _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.0000 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 0.0000 _refine.B_iso_max 270.620 _refine.B_iso_mean 114.7750 _refine.B_iso_min 67.160 _refine.correlation_coeff_Fo_to_Fc 0.9320 _refine.correlation_coeff_Fo_to_Fc_free 0.9340 _refine.details 'U VALUES : WITH TLS ADDED HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9GI9 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.1200 _refine.ls_d_res_low 73.923 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8594 _refine.ls_number_reflns_R_free 459 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 93.2900 _refine.ls_percent_reflns_R_free 5.1000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1921 _refine.ls_R_factor_R_free 0.2482 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1892 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.4350 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 21.3720 _refine.overall_SU_ML 0.3380 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 3.1200 _refine_hist.d_res_low 73.923 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2497 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 308 _refine_hist.pdbx_B_iso_mean_ligand 97.98 _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2464 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 33 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.004 0.013 2552 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.017 2490 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.414 1.659 3453 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.063 1.594 5750 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.380 5.000 305 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 32.104 22.188 128 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.219 15.074 475 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 10.204 15.000 16 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.053 0.200 328 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.020 2784 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 543 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 7.471 11.080 1229 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 7.425 11.075 1228 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 11.445 16.616 1531 ? r_mcangle_it ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 3.1220 _refine_ls_shell.d_res_low 3.2030 _refine_ls_shell.number_reflns_all 243 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 11 _refine_ls_shell.number_reflns_R_work 232 _refine_ls_shell.percent_reflns_obs 34.8100 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3220 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.3870 # _struct.entry_id 9GI9 _struct.title ;Wildtype EGFR bound with (R)-3-((3-chloro-2-methoxyphenyl)amino)-2-(3-((tetrahydrofuran-2-yl)methoxy)pyridin-4-yl)-1,5,6,7-tetrahydro-4H-pyrrolo[3,2-c]pyridin-4-one ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9GI9 _struct_keywords.text 'Kinase, EGFR wildtype, ONCOPROTEIN' _struct_keywords.pdbx_keywords ONCOPROTEIN # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EGFR_HUMAN _struct_ref.pdbx_db_accession P00533 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVC RLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITD FGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQ PPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADE YLIPQQG ; _struct_ref.pdbx_align_begin 696 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9GI9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 330 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00533 _struct_ref_seq.db_align_beg 696 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1022 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 696 _struct_ref_seq.pdbx_auth_seq_align_end 1022 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9GI9 GLY A 1 ? UNP P00533 ? ? 'expression tag' 693 1 1 9GI9 SER A 2 ? UNP P00533 ? ? 'expression tag' 694 2 1 9GI9 MET A 3 ? UNP P00533 ? ? 'expression tag' 695 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 15840 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 16 ? PHE A 20 ? LYS A 708 PHE A 712 5 ? 5 HELX_P HELX_P2 AA2 SER A 60 ? VAL A 77 ? SER A 752 VAL A 769 1 ? 18 HELX_P HELX_P3 AA3 CYS A 105 ? HIS A 113 ? CYS A 797 HIS A 805 1 ? 9 HELX_P HELX_P4 AA4 GLY A 118 ? ARG A 139 ? GLY A 810 ARG A 831 1 ? 22 HELX_P HELX_P5 AA5 ALA A 147 ? ARG A 149 ? ALA A 839 ARG A 841 5 ? 3 HELX_P HELX_P6 AA6 PRO A 185 ? MET A 189 ? PRO A 877 MET A 881 5 ? 5 HELX_P HELX_P7 AA7 ALA A 190 ? HIS A 196 ? ALA A 882 HIS A 888 1 ? 7 HELX_P HELX_P8 AA8 THR A 200 ? THR A 217 ? THR A 892 THR A 909 1 ? 18 HELX_P HELX_P9 AA9 GLU A 230 ? LYS A 237 ? GLU A 922 LYS A 929 1 ? 8 HELX_P HELX_P10 AB1 THR A 248 ? TRP A 259 ? THR A 940 TRP A 951 1 ? 12 HELX_P HELX_P11 AB2 LYS A 268 ? ASP A 282 ? LYS A 960 ASP A 974 1 ? 15 HELX_P HELX_P12 AB3 PRO A 283 ? TYR A 286 ? PRO A 975 TYR A 978 5 ? 4 HELX_P HELX_P13 AB4 ASP A 320 ? TYR A 324 ? ASP A 1012 TYR A 1016 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 24 ? GLY A 29 ? LYS A 716 GLY A 721 AA1 2 GLY A 32 ? TRP A 39 ? GLY A 724 TRP A 731 AA1 3 ILE A 48 ? GLU A 54 ? ILE A 740 GLU A 746 AA1 4 VAL A 94 ? GLN A 99 ? VAL A 786 GLN A 791 AA1 5 LEU A 85 ? LEU A 90 ? LEU A 777 LEU A 782 AA2 1 LEU A 141 ? VAL A 142 ? LEU A 833 VAL A 834 AA2 2 LYS A 168 ? LEU A 169 ? LYS A 860 LEU A 861 AA3 1 VAL A 151 ? THR A 155 ? VAL A 843 THR A 847 AA3 2 HIS A 158 ? ILE A 161 ? HIS A 850 ILE A 853 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 27 ? N GLY A 719 O VAL A 34 ? O VAL A 726 AA1 2 3 N TRP A 39 ? N TRP A 731 O ILE A 48 ? O ILE A 740 AA1 3 4 N ALA A 51 ? N ALA A 743 O THR A 98 ? O THR A 790 AA1 4 5 O ILE A 97 ? O ILE A 789 N LEU A 86 ? N LEU A 778 AA2 1 2 N VAL A 142 ? N VAL A 834 O LYS A 168 ? O LYS A 860 AA3 1 2 N LEU A 152 ? N LEU A 844 O LYS A 160 ? O LYS A 852 # _pdbx_entry_details.entry_id 9GI9 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 713 ? ? -164.26 81.17 2 1 LYS A 714 ? ? -57.96 82.32 3 1 THR A 751 ? ? -54.39 89.16 4 1 ASP A 837 ? ? -161.38 39.34 5 1 ASP A 855 ? ? 58.09 96.13 6 1 PHE A 910 ? ? 39.81 42.22 7 1 LEU A 1001 ? ? -102.16 -69.05 8 1 MET A 1002 ? ? -33.67 -89.46 9 1 ASP A 1003 ? ? 42.75 84.32 10 1 GLU A 1004 ? ? -103.45 -166.86 11 1 GLU A 1005 ? ? -63.50 -82.45 12 1 TYR A 1016 ? ? -102.21 -96.30 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 693 ? A GLY 1 2 1 Y 1 A SER 694 ? A SER 2 3 1 Y 1 A MET 695 ? A MET 3 4 1 Y 1 A GLY 863 ? A GLY 171 5 1 Y 1 A ALA 864 ? A ALA 172 6 1 Y 1 A GLU 865 ? A GLU 173 7 1 Y 1 A GLU 866 ? A GLU 174 8 1 Y 1 A LYS 867 ? A LYS 175 9 1 Y 1 A GLU 868 ? A GLU 176 10 1 Y 1 A TYR 869 ? A TYR 177 11 1 Y 1 A SER 991 ? A SER 299 12 1 Y 1 A PRO 992 ? A PRO 300 13 1 Y 1 A THR 993 ? A THR 301 14 1 Y 1 A ASP 994 ? A ASP 302 15 1 Y 1 A SER 995 ? A SER 303 16 1 Y 1 A ASN 996 ? A ASN 304 17 1 Y 1 A PHE 997 ? A PHE 305 18 1 Y 1 A TYR 998 ? A TYR 306 19 1 Y 1 A PRO 1019 ? A PRO 327 20 1 Y 1 A GLN 1020 ? A GLN 328 21 1 Y 1 A GLN 1021 ? A GLN 329 22 1 Y 1 A GLY 1022 ? A GLY 330 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1ILZ C2 C Y N 1 A1ILZ C3 C Y N 2 A1ILZ C4 C Y N 3 A1ILZ C5 C Y N 4 A1ILZ C6 C Y N 5 A1ILZ C8 C Y N 6 A1ILZ C15 C Y N 7 A1ILZ C17 C Y N 8 A1ILZ C18 C Y N 9 A1ILZ C19 C Y N 10 A1ILZ C23 C Y N 11 A1ILZ C30 C N N 12 A1ILZ C32 C Y N 13 A1ILZ C34 C N N 14 A1ILZ CL1 CL N N 15 A1ILZ N7 N N N 16 A1ILZ C9 C Y N 17 A1ILZ C10 C N N 18 A1ILZ O11 O N N 19 A1ILZ N12 N N N 20 A1ILZ C13 C N N 21 A1ILZ C14 C N N 22 A1ILZ N16 N Y N 23 A1ILZ C20 C Y N 24 A1ILZ N21 N Y N 25 A1ILZ C22 C Y N 26 A1ILZ O24 O N N 27 A1ILZ C25 C N N 28 A1ILZ C26 C N R 29 A1ILZ C28 C N N 30 A1ILZ C29 C N N 31 A1ILZ O31 O N N 32 A1ILZ O33 O N N 33 A1ILZ H1 H N N 34 A1ILZ H2 H N N 35 A1ILZ H3 H N N 36 A1ILZ H4 H N N 37 A1ILZ H5 H N N 38 A1ILZ H6 H N N 39 A1ILZ H7 H N N 40 A1ILZ H8 H N N 41 A1ILZ H9 H N N 42 A1ILZ H10 H N N 43 A1ILZ H11 H N N 44 A1ILZ H12 H N N 45 A1ILZ H13 H N N 46 A1ILZ H14 H N N 47 A1ILZ H15 H N N 48 A1ILZ H16 H N N 49 A1ILZ H17 H N N 50 A1ILZ H18 H N N 51 A1ILZ H19 H N N 52 A1ILZ H20 H N N 53 A1ILZ H21 H N N 54 A1ILZ H22 H N N 55 A1ILZ H23 H N N 56 A1ILZ H24 H N N 57 A1ILZ H25 H N N 58 ALA N N N N 59 ALA CA C N S 60 ALA C C N N 61 ALA O O N N 62 ALA CB C N N 63 ALA OXT O N N 64 ALA H H N N 65 ALA H2 H N N 66 ALA HA H N N 67 ALA HB1 H N N 68 ALA HB2 H N N 69 ALA HB3 H N N 70 ALA HXT H N N 71 ARG N N N N 72 ARG CA C N S 73 ARG C C N N 74 ARG O O N N 75 ARG CB C N N 76 ARG CG C N N 77 ARG CD C N N 78 ARG NE N N N 79 ARG CZ C N N 80 ARG NH1 N N N 81 ARG NH2 N N N 82 ARG OXT O N N 83 ARG H H N N 84 ARG H2 H N N 85 ARG HA H N N 86 ARG HB2 H N N 87 ARG HB3 H N N 88 ARG HG2 H N N 89 ARG HG3 H N N 90 ARG HD2 H N N 91 ARG HD3 H N N 92 ARG HE H N N 93 ARG HH11 H N N 94 ARG HH12 H N N 95 ARG HH21 H N N 96 ARG HH22 H N N 97 ARG HXT H N N 98 ASN N N N N 99 ASN CA C N S 100 ASN C C N N 101 ASN O O N N 102 ASN CB C N N 103 ASN CG C N N 104 ASN OD1 O N N 105 ASN ND2 N N N 106 ASN OXT O N N 107 ASN H H N N 108 ASN H2 H N N 109 ASN HA H N N 110 ASN HB2 H N N 111 ASN HB3 H N N 112 ASN HD21 H N N 113 ASN HD22 H N N 114 ASN HXT H N N 115 ASP N N N N 116 ASP CA C N S 117 ASP C C N N 118 ASP O O N N 119 ASP CB C N N 120 ASP CG C N N 121 ASP OD1 O N N 122 ASP OD2 O N N 123 ASP OXT O N N 124 ASP H H N N 125 ASP H2 H N N 126 ASP HA H N N 127 ASP HB2 H N N 128 ASP HB3 H N N 129 ASP HD2 H N N 130 ASP HXT H N N 131 CYS N N N N 132 CYS CA C N R 133 CYS C C N N 134 CYS O O N N 135 CYS CB C N N 136 CYS SG S N N 137 CYS OXT O N N 138 CYS H H N N 139 CYS H2 H N N 140 CYS HA H N N 141 CYS HB2 H N N 142 CYS HB3 H N N 143 CYS HG H N N 144 CYS HXT H N N 145 GLN N N N N 146 GLN CA C N S 147 GLN C C N N 148 GLN O O N N 149 GLN CB C N N 150 GLN CG C N N 151 GLN CD C N N 152 GLN OE1 O N N 153 GLN NE2 N N N 154 GLN OXT O N N 155 GLN H H N N 156 GLN H2 H N N 157 GLN HA H N N 158 GLN HB2 H N N 159 GLN HB3 H N N 160 GLN HG2 H N N 161 GLN HG3 H N N 162 GLN HE21 H N N 163 GLN HE22 H N N 164 GLN HXT H N N 165 GLU N N N N 166 GLU CA C N S 167 GLU C C N N 168 GLU O O N N 169 GLU CB C N N 170 GLU CG C N N 171 GLU CD C N N 172 GLU OE1 O N N 173 GLU OE2 O N N 174 GLU OXT O N N 175 GLU H H N N 176 GLU H2 H N N 177 GLU HA H N N 178 GLU HB2 H N N 179 GLU HB3 H N N 180 GLU HG2 H N N 181 GLU HG3 H N N 182 GLU HE2 H N N 183 GLU HXT H N N 184 GLY N N N N 185 GLY CA C N N 186 GLY C C N N 187 GLY O O N N 188 GLY OXT O N N 189 GLY H H N N 190 GLY H2 H N N 191 GLY HA2 H N N 192 GLY HA3 H N N 193 GLY HXT H N N 194 HIS N N N N 195 HIS CA C N S 196 HIS C C N N 197 HIS O O N N 198 HIS CB C N N 199 HIS CG C Y N 200 HIS ND1 N Y N 201 HIS CD2 C Y N 202 HIS CE1 C Y N 203 HIS NE2 N Y N 204 HIS OXT O N N 205 HIS H H N N 206 HIS H2 H N N 207 HIS HA H N N 208 HIS HB2 H N N 209 HIS HB3 H N N 210 HIS HD1 H N N 211 HIS HD2 H N N 212 HIS HE1 H N N 213 HIS HE2 H N N 214 HIS HXT H N N 215 ILE N N N N 216 ILE CA C N S 217 ILE C C N N 218 ILE O O N N 219 ILE CB C N S 220 ILE CG1 C N N 221 ILE CG2 C N N 222 ILE CD1 C N N 223 ILE OXT O N N 224 ILE H H N N 225 ILE H2 H N N 226 ILE HA H N N 227 ILE HB H N N 228 ILE HG12 H N N 229 ILE HG13 H N N 230 ILE HG21 H N N 231 ILE HG22 H N N 232 ILE HG23 H N N 233 ILE HD11 H N N 234 ILE HD12 H N N 235 ILE HD13 H N N 236 ILE HXT H N N 237 LEU N N N N 238 LEU CA C N S 239 LEU C C N N 240 LEU O O N N 241 LEU CB C N N 242 LEU CG C N N 243 LEU CD1 C N N 244 LEU CD2 C N N 245 LEU OXT O N N 246 LEU H H N N 247 LEU H2 H N N 248 LEU HA H N N 249 LEU HB2 H N N 250 LEU HB3 H N N 251 LEU HG H N N 252 LEU HD11 H N N 253 LEU HD12 H N N 254 LEU HD13 H N N 255 LEU HD21 H N N 256 LEU HD22 H N N 257 LEU HD23 H N N 258 LEU HXT H N N 259 LYS N N N N 260 LYS CA C N S 261 LYS C C N N 262 LYS O O N N 263 LYS CB C N N 264 LYS CG C N N 265 LYS CD C N N 266 LYS CE C N N 267 LYS NZ N N N 268 LYS OXT O N N 269 LYS H H N N 270 LYS H2 H N N 271 LYS HA H N N 272 LYS HB2 H N N 273 LYS HB3 H N N 274 LYS HG2 H N N 275 LYS HG3 H N N 276 LYS HD2 H N N 277 LYS HD3 H N N 278 LYS HE2 H N N 279 LYS HE3 H N N 280 LYS HZ1 H N N 281 LYS HZ2 H N N 282 LYS HZ3 H N N 283 LYS HXT H N N 284 MET N N N N 285 MET CA C N S 286 MET C C N N 287 MET O O N N 288 MET CB C N N 289 MET CG C N N 290 MET SD S N N 291 MET CE C N N 292 MET OXT O N N 293 MET H H N N 294 MET H2 H N N 295 MET HA H N N 296 MET HB2 H N N 297 MET HB3 H N N 298 MET HG2 H N N 299 MET HG3 H N N 300 MET HE1 H N N 301 MET HE2 H N N 302 MET HE3 H N N 303 MET HXT H N N 304 PHE N N N N 305 PHE CA C N S 306 PHE C C N N 307 PHE O O N N 308 PHE CB C N N 309 PHE CG C Y N 310 PHE CD1 C Y N 311 PHE CD2 C Y N 312 PHE CE1 C Y N 313 PHE CE2 C Y N 314 PHE CZ C Y N 315 PHE OXT O N N 316 PHE H H N N 317 PHE H2 H N N 318 PHE HA H N N 319 PHE HB2 H N N 320 PHE HB3 H N N 321 PHE HD1 H N N 322 PHE HD2 H N N 323 PHE HE1 H N N 324 PHE HE2 H N N 325 PHE HZ H N N 326 PHE HXT H N N 327 PRO N N N N 328 PRO CA C N S 329 PRO C C N N 330 PRO O O N N 331 PRO CB C N N 332 PRO CG C N N 333 PRO CD C N N 334 PRO OXT O N N 335 PRO H H N N 336 PRO HA H N N 337 PRO HB2 H N N 338 PRO HB3 H N N 339 PRO HG2 H N N 340 PRO HG3 H N N 341 PRO HD2 H N N 342 PRO HD3 H N N 343 PRO HXT H N N 344 SER N N N N 345 SER CA C N S 346 SER C C N N 347 SER O O N N 348 SER CB C N N 349 SER OG O N N 350 SER OXT O N N 351 SER H H N N 352 SER H2 H N N 353 SER HA H N N 354 SER HB2 H N N 355 SER HB3 H N N 356 SER HG H N N 357 SER HXT H N N 358 THR N N N N 359 THR CA C N S 360 THR C C N N 361 THR O O N N 362 THR CB C N R 363 THR OG1 O N N 364 THR CG2 C N N 365 THR OXT O N N 366 THR H H N N 367 THR H2 H N N 368 THR HA H N N 369 THR HB H N N 370 THR HG1 H N N 371 THR HG21 H N N 372 THR HG22 H N N 373 THR HG23 H N N 374 THR HXT H N N 375 TRP N N N N 376 TRP CA C N S 377 TRP C C N N 378 TRP O O N N 379 TRP CB C N N 380 TRP CG C Y N 381 TRP CD1 C Y N 382 TRP CD2 C Y N 383 TRP NE1 N Y N 384 TRP CE2 C Y N 385 TRP CE3 C Y N 386 TRP CZ2 C Y N 387 TRP CZ3 C Y N 388 TRP CH2 C Y N 389 TRP OXT O N N 390 TRP H H N N 391 TRP H2 H N N 392 TRP HA H N N 393 TRP HB2 H N N 394 TRP HB3 H N N 395 TRP HD1 H N N 396 TRP HE1 H N N 397 TRP HE3 H N N 398 TRP HZ2 H N N 399 TRP HZ3 H N N 400 TRP HH2 H N N 401 TRP HXT H N N 402 TYR N N N N 403 TYR CA C N S 404 TYR C C N N 405 TYR O O N N 406 TYR CB C N N 407 TYR CG C Y N 408 TYR CD1 C Y N 409 TYR CD2 C Y N 410 TYR CE1 C Y N 411 TYR CE2 C Y N 412 TYR CZ C Y N 413 TYR OH O N N 414 TYR OXT O N N 415 TYR H H N N 416 TYR H2 H N N 417 TYR HA H N N 418 TYR HB2 H N N 419 TYR HB3 H N N 420 TYR HD1 H N N 421 TYR HD2 H N N 422 TYR HE1 H N N 423 TYR HE2 H N N 424 TYR HH H N N 425 TYR HXT H N N 426 VAL N N N N 427 VAL CA C N S 428 VAL C C N N 429 VAL O O N N 430 VAL CB C N N 431 VAL CG1 C N N 432 VAL CG2 C N N 433 VAL OXT O N N 434 VAL H H N N 435 VAL H2 H N N 436 VAL HA H N N 437 VAL HB H N N 438 VAL HG11 H N N 439 VAL HG12 H N N 440 VAL HG13 H N N 441 VAL HG21 H N N 442 VAL HG22 H N N 443 VAL HG23 H N N 444 VAL HXT H N N 445 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1ILZ CL1 C2 sing N N 1 A1ILZ O33 C34 sing N N 2 A1ILZ O33 C32 sing N N 3 A1ILZ C2 C32 doub Y N 4 A1ILZ C2 C3 sing Y N 5 A1ILZ C32 C6 sing Y N 6 A1ILZ C3 C4 doub Y N 7 A1ILZ O11 C10 doub N N 8 A1ILZ C6 N7 sing N N 9 A1ILZ C6 C5 doub Y N 10 A1ILZ C4 C5 sing Y N 11 A1ILZ C10 N12 sing N N 12 A1ILZ C10 C9 sing N N 13 A1ILZ N12 C13 sing N N 14 A1ILZ N7 C8 sing N N 15 A1ILZ C9 C8 sing Y N 16 A1ILZ C9 C15 doub Y N 17 A1ILZ C8 C17 doub Y N 18 A1ILZ C13 C14 sing N N 19 A1ILZ C15 C14 sing N N 20 A1ILZ C15 N16 sing Y N 21 A1ILZ C17 N16 sing Y N 22 A1ILZ C17 C18 sing N N 23 A1ILZ C19 C18 doub Y N 24 A1ILZ C19 C20 sing Y N 25 A1ILZ C18 C23 sing Y N 26 A1ILZ C20 N21 doub Y N 27 A1ILZ C23 O24 sing N N 28 A1ILZ C23 C22 doub Y N 29 A1ILZ N21 C22 sing Y N 30 A1ILZ O24 C25 sing N N 31 A1ILZ O31 C30 sing N N 32 A1ILZ O31 C26 sing N N 33 A1ILZ C30 C29 sing N N 34 A1ILZ C25 C26 sing N N 35 A1ILZ C26 C28 sing N N 36 A1ILZ C29 C28 sing N N 37 A1ILZ C3 H1 sing N N 38 A1ILZ C4 H2 sing N N 39 A1ILZ C5 H3 sing N N 40 A1ILZ C19 H4 sing N N 41 A1ILZ C30 H5 sing N N 42 A1ILZ C30 H6 sing N N 43 A1ILZ C34 H7 sing N N 44 A1ILZ C34 H8 sing N N 45 A1ILZ C34 H9 sing N N 46 A1ILZ N7 H10 sing N N 47 A1ILZ N12 H11 sing N N 48 A1ILZ C13 H12 sing N N 49 A1ILZ C13 H13 sing N N 50 A1ILZ C14 H14 sing N N 51 A1ILZ C14 H15 sing N N 52 A1ILZ N16 H16 sing N N 53 A1ILZ C20 H17 sing N N 54 A1ILZ C22 H18 sing N N 55 A1ILZ C25 H19 sing N N 56 A1ILZ C25 H20 sing N N 57 A1ILZ C26 H21 sing N N 58 A1ILZ C28 H22 sing N N 59 A1ILZ C28 H23 sing N N 60 A1ILZ C29 H24 sing N N 61 A1ILZ C29 H25 sing N N 62 ALA N CA sing N N 63 ALA N H sing N N 64 ALA N H2 sing N N 65 ALA CA C sing N N 66 ALA CA CB sing N N 67 ALA CA HA sing N N 68 ALA C O doub N N 69 ALA C OXT sing N N 70 ALA CB HB1 sing N N 71 ALA CB HB2 sing N N 72 ALA CB HB3 sing N N 73 ALA OXT HXT sing N N 74 ARG N CA sing N N 75 ARG N H sing N N 76 ARG N H2 sing N N 77 ARG CA C sing N N 78 ARG CA CB sing N N 79 ARG CA HA sing N N 80 ARG C O doub N N 81 ARG C OXT sing N N 82 ARG CB CG sing N N 83 ARG CB HB2 sing N N 84 ARG CB HB3 sing N N 85 ARG CG CD sing N N 86 ARG CG HG2 sing N N 87 ARG CG HG3 sing N N 88 ARG CD NE sing N N 89 ARG CD HD2 sing N N 90 ARG CD HD3 sing N N 91 ARG NE CZ sing N N 92 ARG NE HE sing N N 93 ARG CZ NH1 sing N N 94 ARG CZ NH2 doub N N 95 ARG NH1 HH11 sing N N 96 ARG NH1 HH12 sing N N 97 ARG NH2 HH21 sing N N 98 ARG NH2 HH22 sing N N 99 ARG OXT HXT sing N N 100 ASN N CA sing N N 101 ASN N H sing N N 102 ASN N H2 sing N N 103 ASN CA C sing N N 104 ASN CA CB sing N N 105 ASN CA HA sing N N 106 ASN C O doub N N 107 ASN C OXT sing N N 108 ASN CB CG sing N N 109 ASN CB HB2 sing N N 110 ASN CB HB3 sing N N 111 ASN CG OD1 doub N N 112 ASN CG ND2 sing N N 113 ASN ND2 HD21 sing N N 114 ASN ND2 HD22 sing N N 115 ASN OXT HXT sing N N 116 ASP N CA sing N N 117 ASP N H sing N N 118 ASP N H2 sing N N 119 ASP CA C sing N N 120 ASP CA CB sing N N 121 ASP CA HA sing N N 122 ASP C O doub N N 123 ASP C OXT sing N N 124 ASP CB CG sing N N 125 ASP CB HB2 sing N N 126 ASP CB HB3 sing N N 127 ASP CG OD1 doub N N 128 ASP CG OD2 sing N N 129 ASP OD2 HD2 sing N N 130 ASP OXT HXT sing N N 131 CYS N CA sing N N 132 CYS N H sing N N 133 CYS N H2 sing N N 134 CYS CA C sing N N 135 CYS CA CB sing N N 136 CYS CA HA sing N N 137 CYS C O doub N N 138 CYS C OXT sing N N 139 CYS CB SG sing N N 140 CYS CB HB2 sing N N 141 CYS CB HB3 sing N N 142 CYS SG HG sing N N 143 CYS OXT HXT sing N N 144 GLN N CA sing N N 145 GLN N H sing N N 146 GLN N H2 sing N N 147 GLN CA C sing N N 148 GLN CA CB sing N N 149 GLN CA HA sing N N 150 GLN C O doub N N 151 GLN C OXT sing N N 152 GLN CB CG sing N N 153 GLN CB HB2 sing N N 154 GLN CB HB3 sing N N 155 GLN CG CD sing N N 156 GLN CG HG2 sing N N 157 GLN CG HG3 sing N N 158 GLN CD OE1 doub N N 159 GLN CD NE2 sing N N 160 GLN NE2 HE21 sing N N 161 GLN NE2 HE22 sing N N 162 GLN OXT HXT sing N N 163 GLU N CA sing N N 164 GLU N H sing N N 165 GLU N H2 sing N N 166 GLU CA C sing N N 167 GLU CA CB sing N N 168 GLU CA HA sing N N 169 GLU C O doub N N 170 GLU C OXT sing N N 171 GLU CB CG sing N N 172 GLU CB HB2 sing N N 173 GLU CB HB3 sing N N 174 GLU CG CD sing N N 175 GLU CG HG2 sing N N 176 GLU CG HG3 sing N N 177 GLU CD OE1 doub N N 178 GLU CD OE2 sing N N 179 GLU OE2 HE2 sing N N 180 GLU OXT HXT sing N N 181 GLY N CA sing N N 182 GLY N H sing N N 183 GLY N H2 sing N N 184 GLY CA C sing N N 185 GLY CA HA2 sing N N 186 GLY CA HA3 sing N N 187 GLY C O doub N N 188 GLY C OXT sing N N 189 GLY OXT HXT sing N N 190 HIS N CA sing N N 191 HIS N H sing N N 192 HIS N H2 sing N N 193 HIS CA C sing N N 194 HIS CA CB sing N N 195 HIS CA HA sing N N 196 HIS C O doub N N 197 HIS C OXT sing N N 198 HIS CB CG sing N N 199 HIS CB HB2 sing N N 200 HIS CB HB3 sing N N 201 HIS CG ND1 sing Y N 202 HIS CG CD2 doub Y N 203 HIS ND1 CE1 doub Y N 204 HIS ND1 HD1 sing N N 205 HIS CD2 NE2 sing Y N 206 HIS CD2 HD2 sing N N 207 HIS CE1 NE2 sing Y N 208 HIS CE1 HE1 sing N N 209 HIS NE2 HE2 sing N N 210 HIS OXT HXT sing N N 211 ILE N CA sing N N 212 ILE N H sing N N 213 ILE N H2 sing N N 214 ILE CA C sing N N 215 ILE CA CB sing N N 216 ILE CA HA sing N N 217 ILE C O doub N N 218 ILE C OXT sing N N 219 ILE CB CG1 sing N N 220 ILE CB CG2 sing N N 221 ILE CB HB sing N N 222 ILE CG1 CD1 sing N N 223 ILE CG1 HG12 sing N N 224 ILE CG1 HG13 sing N N 225 ILE CG2 HG21 sing N N 226 ILE CG2 HG22 sing N N 227 ILE CG2 HG23 sing N N 228 ILE CD1 HD11 sing N N 229 ILE CD1 HD12 sing N N 230 ILE CD1 HD13 sing N N 231 ILE OXT HXT sing N N 232 LEU N CA sing N N 233 LEU N H sing N N 234 LEU N H2 sing N N 235 LEU CA C sing N N 236 LEU CA CB sing N N 237 LEU CA HA sing N N 238 LEU C O doub N N 239 LEU C OXT sing N N 240 LEU CB CG sing N N 241 LEU CB HB2 sing N N 242 LEU CB HB3 sing N N 243 LEU CG CD1 sing N N 244 LEU CG CD2 sing N N 245 LEU CG HG sing N N 246 LEU CD1 HD11 sing N N 247 LEU CD1 HD12 sing N N 248 LEU CD1 HD13 sing N N 249 LEU CD2 HD21 sing N N 250 LEU CD2 HD22 sing N N 251 LEU CD2 HD23 sing N N 252 LEU OXT HXT sing N N 253 LYS N CA sing N N 254 LYS N H sing N N 255 LYS N H2 sing N N 256 LYS CA C sing N N 257 LYS CA CB sing N N 258 LYS CA HA sing N N 259 LYS C O doub N N 260 LYS C OXT sing N N 261 LYS CB CG sing N N 262 LYS CB HB2 sing N N 263 LYS CB HB3 sing N N 264 LYS CG CD sing N N 265 LYS CG HG2 sing N N 266 LYS CG HG3 sing N N 267 LYS CD CE sing N N 268 LYS CD HD2 sing N N 269 LYS CD HD3 sing N N 270 LYS CE NZ sing N N 271 LYS CE HE2 sing N N 272 LYS CE HE3 sing N N 273 LYS NZ HZ1 sing N N 274 LYS NZ HZ2 sing N N 275 LYS NZ HZ3 sing N N 276 LYS OXT HXT sing N N 277 MET N CA sing N N 278 MET N H sing N N 279 MET N H2 sing N N 280 MET CA C sing N N 281 MET CA CB sing N N 282 MET CA HA sing N N 283 MET C O doub N N 284 MET C OXT sing N N 285 MET CB CG sing N N 286 MET CB HB2 sing N N 287 MET CB HB3 sing N N 288 MET CG SD sing N N 289 MET CG HG2 sing N N 290 MET CG HG3 sing N N 291 MET SD CE sing N N 292 MET CE HE1 sing N N 293 MET CE HE2 sing N N 294 MET CE HE3 sing N N 295 MET OXT HXT sing N N 296 PHE N CA sing N N 297 PHE N H sing N N 298 PHE N H2 sing N N 299 PHE CA C sing N N 300 PHE CA CB sing N N 301 PHE CA HA sing N N 302 PHE C O doub N N 303 PHE C OXT sing N N 304 PHE CB CG sing N N 305 PHE CB HB2 sing N N 306 PHE CB HB3 sing N N 307 PHE CG CD1 doub Y N 308 PHE CG CD2 sing Y N 309 PHE CD1 CE1 sing Y N 310 PHE CD1 HD1 sing N N 311 PHE CD2 CE2 doub Y N 312 PHE CD2 HD2 sing N N 313 PHE CE1 CZ doub Y N 314 PHE CE1 HE1 sing N N 315 PHE CE2 CZ sing Y N 316 PHE CE2 HE2 sing N N 317 PHE CZ HZ sing N N 318 PHE OXT HXT sing N N 319 PRO N CA sing N N 320 PRO N CD sing N N 321 PRO N H sing N N 322 PRO CA C sing N N 323 PRO CA CB sing N N 324 PRO CA HA sing N N 325 PRO C O doub N N 326 PRO C OXT sing N N 327 PRO CB CG sing N N 328 PRO CB HB2 sing N N 329 PRO CB HB3 sing N N 330 PRO CG CD sing N N 331 PRO CG HG2 sing N N 332 PRO CG HG3 sing N N 333 PRO CD HD2 sing N N 334 PRO CD HD3 sing N N 335 PRO OXT HXT sing N N 336 SER N CA sing N N 337 SER N H sing N N 338 SER N H2 sing N N 339 SER CA C sing N N 340 SER CA CB sing N N 341 SER CA HA sing N N 342 SER C O doub N N 343 SER C OXT sing N N 344 SER CB OG sing N N 345 SER CB HB2 sing N N 346 SER CB HB3 sing N N 347 SER OG HG sing N N 348 SER OXT HXT sing N N 349 THR N CA sing N N 350 THR N H sing N N 351 THR N H2 sing N N 352 THR CA C sing N N 353 THR CA CB sing N N 354 THR CA HA sing N N 355 THR C O doub N N 356 THR C OXT sing N N 357 THR CB OG1 sing N N 358 THR CB CG2 sing N N 359 THR CB HB sing N N 360 THR OG1 HG1 sing N N 361 THR CG2 HG21 sing N N 362 THR CG2 HG22 sing N N 363 THR CG2 HG23 sing N N 364 THR OXT HXT sing N N 365 TRP N CA sing N N 366 TRP N H sing N N 367 TRP N H2 sing N N 368 TRP CA C sing N N 369 TRP CA CB sing N N 370 TRP CA HA sing N N 371 TRP C O doub N N 372 TRP C OXT sing N N 373 TRP CB CG sing N N 374 TRP CB HB2 sing N N 375 TRP CB HB3 sing N N 376 TRP CG CD1 doub Y N 377 TRP CG CD2 sing Y N 378 TRP CD1 NE1 sing Y N 379 TRP CD1 HD1 sing N N 380 TRP CD2 CE2 doub Y N 381 TRP CD2 CE3 sing Y N 382 TRP NE1 CE2 sing Y N 383 TRP NE1 HE1 sing N N 384 TRP CE2 CZ2 sing Y N 385 TRP CE3 CZ3 doub Y N 386 TRP CE3 HE3 sing N N 387 TRP CZ2 CH2 doub Y N 388 TRP CZ2 HZ2 sing N N 389 TRP CZ3 CH2 sing Y N 390 TRP CZ3 HZ3 sing N N 391 TRP CH2 HH2 sing N N 392 TRP OXT HXT sing N N 393 TYR N CA sing N N 394 TYR N H sing N N 395 TYR N H2 sing N N 396 TYR CA C sing N N 397 TYR CA CB sing N N 398 TYR CA HA sing N N 399 TYR C O doub N N 400 TYR C OXT sing N N 401 TYR CB CG sing N N 402 TYR CB HB2 sing N N 403 TYR CB HB3 sing N N 404 TYR CG CD1 doub Y N 405 TYR CG CD2 sing Y N 406 TYR CD1 CE1 sing Y N 407 TYR CD1 HD1 sing N N 408 TYR CD2 CE2 doub Y N 409 TYR CD2 HD2 sing N N 410 TYR CE1 CZ doub Y N 411 TYR CE1 HE1 sing N N 412 TYR CE2 CZ sing Y N 413 TYR CE2 HE2 sing N N 414 TYR CZ OH sing N N 415 TYR OH HH sing N N 416 TYR OXT HXT sing N N 417 VAL N CA sing N N 418 VAL N H sing N N 419 VAL N H2 sing N N 420 VAL CA C sing N N 421 VAL CA CB sing N N 422 VAL CA HA sing N N 423 VAL C O doub N N 424 VAL C OXT sing N N 425 VAL CB CG1 sing N N 426 VAL CB CG2 sing N N 427 VAL CB HB sing N N 428 VAL CG1 HG11 sing N N 429 VAL CG1 HG12 sing N N 430 VAL CG1 HG13 sing N N 431 VAL CG2 HG21 sing N N 432 VAL CG2 HG22 sing N N 433 VAL CG2 HG23 sing N N 434 VAL OXT HXT sing N N 435 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2EB3 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9GI9 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.006764 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006764 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006764 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL N O S # loop_ #