data_9GL7 # _entry.id 9GL7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.404 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9GL7 pdb_00009gl7 10.2210/pdb9gl7/pdb WWPDB D_1292141240 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-05-14 ? 2 'Structure model' 1 1 2025-06-11 ? 3 'Structure model' 1 2 2025-07-23 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.page_first' 6 2 'Structure model' '_citation.page_last' 7 2 'Structure model' '_citation.pdbx_database_id_DOI' 8 2 'Structure model' '_citation.pdbx_database_id_PubMed' 9 2 'Structure model' '_citation.title' 10 2 'Structure model' '_citation.year' 11 3 'Structure model' '_citation.journal_volume' 12 3 'Structure model' '_citation.page_first' 13 3 'Structure model' '_citation.page_last' 14 3 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9GL7 _pdbx_database_status.recvd_initial_deposition_date 2024-08-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 2 _pdbx_contact_author.email brendan@scorpiontx.com _pdbx_contact_author.name_first Brendan _pdbx_contact_author.name_last Hilbert _pdbx_contact_author.name_mi J. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-9353-1799 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Hilbert, B.J.' 1 0000-0001-9353-1799 'Brooijmans, N.' 2 0000-0003-3514-4189 'Milgram, B.C.' 3 0009-0008-5824-4645 'Pagliarini, R.A.' 4 0000-0001-8920-8198 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Clin.Cancer Res.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1078-0432 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 31 _citation.language ? _citation.page_first 3002 _citation.page_last 3018 _citation.title ;STX-721, a Covalent EGFR/HER2 Exon 20 Inhibitor, Utilizes Exon 20-Mutant Dynamic Protein States and Achieves Unique Mutant Selectivity Across Human Cancer Models. ; _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1158/1078-0432.CCR-24-3833 _citation.pdbx_database_id_PubMed 40465424 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pagliarini, R.A.' 1 ? primary 'Henderson, J.A.' 2 ? primary 'Milgram, B.C.' 3 ? primary 'Borrelli, D.R.' 4 ? primary 'Brooijmans, N.' 5 ? primary 'Hilbert, B.J.' 6 ? primary 'Huff, M.R.' 7 ? primary 'Ito, T.' 8 ? primary 'Kryukov, G.V.' 9 ? primary 'Ladd, B.' 10 ? primary 'Martin, B.R.' 11 ? primary 'Motiwala, H.' 12 ? primary ;O'Hearn, E. ; 13 ? primary 'Tsai, C.F.' 14 ? primary 'Wang, W.' 15 ? primary 'Bellier, J.' 16 ? primary 'Boland, L.' 17 ? primary 'Clark, S.' 18 ? primary 'Hensley, E.' 19 ? primary 'Hata, A.N.' 20 ? primary 'Kuzmic, P.' 21 ? primary 'Guzman-Perez, A.' 22 ? primary 'Jackson, E.L.' 23 ? primary 'Stuart, D.D.' 24 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Epidermal growth factor receptor' 38677.609 1 2.7.10.1 V948R ? D770_N771insNPG 2 non-polymer syn '3-[(3-chloranyl-2-methoxy-phenyl)amino]-2-[3-[[(2S)-oxolan-2-yl]methoxy]pyridin-4-yl]-1,5,6,7-tetrahydropyrrolo[3,2-c]pyridin-4-one' 468.933 1 ? ? ? ? 3 water nat water 18.015 106 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Proto-oncogene c-ErbB-1,Receptor tyrosine-protein kinase erbB-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPG NPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQH VKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKG ERLPQPPICTIDVYMIMRKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDV VDADEYLIPQQGHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPG NPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQH VKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKG ERLPQPPICTIDVYMIMRKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDV VDADEYLIPQQGHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '3-[(3-chloranyl-2-methoxy-phenyl)amino]-2-[3-[[(2S)-oxolan-2-yl]methoxy]pyridin-4-yl]-1,5,6,7-tetrahydropyrrolo[3,2-c]pyridin-4-one' A1IMS 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 GLY n 1 4 GLU n 1 5 ALA n 1 6 PRO n 1 7 ASN n 1 8 GLN n 1 9 ALA n 1 10 LEU n 1 11 LEU n 1 12 ARG n 1 13 ILE n 1 14 LEU n 1 15 LYS n 1 16 GLU n 1 17 THR n 1 18 GLU n 1 19 PHE n 1 20 LYS n 1 21 LYS n 1 22 ILE n 1 23 LYS n 1 24 VAL n 1 25 LEU n 1 26 GLY n 1 27 SER n 1 28 GLY n 1 29 ALA n 1 30 PHE n 1 31 GLY n 1 32 THR n 1 33 VAL n 1 34 TYR n 1 35 LYS n 1 36 GLY n 1 37 LEU n 1 38 TRP n 1 39 ILE n 1 40 PRO n 1 41 GLU n 1 42 GLY n 1 43 GLU n 1 44 LYS n 1 45 VAL n 1 46 LYS n 1 47 ILE n 1 48 PRO n 1 49 VAL n 1 50 ALA n 1 51 ILE n 1 52 LYS n 1 53 GLU n 1 54 LEU n 1 55 ARG n 1 56 GLU n 1 57 ALA n 1 58 THR n 1 59 SER n 1 60 PRO n 1 61 LYS n 1 62 ALA n 1 63 ASN n 1 64 LYS n 1 65 GLU n 1 66 ILE n 1 67 LEU n 1 68 ASP n 1 69 GLU n 1 70 ALA n 1 71 TYR n 1 72 VAL n 1 73 MET n 1 74 ALA n 1 75 SER n 1 76 VAL n 1 77 ASP n 1 78 ASN n 1 79 PRO n 1 80 GLY n 1 81 ASN n 1 82 PRO n 1 83 HIS n 1 84 VAL n 1 85 CYS n 1 86 ARG n 1 87 LEU n 1 88 LEU n 1 89 GLY n 1 90 ILE n 1 91 CYS n 1 92 LEU n 1 93 THR n 1 94 SER n 1 95 THR n 1 96 VAL n 1 97 GLN n 1 98 LEU n 1 99 ILE n 1 100 THR n 1 101 GLN n 1 102 LEU n 1 103 MET n 1 104 PRO n 1 105 PHE n 1 106 GLY n 1 107 CYS n 1 108 LEU n 1 109 LEU n 1 110 ASP n 1 111 TYR n 1 112 VAL n 1 113 ARG n 1 114 GLU n 1 115 HIS n 1 116 LYS n 1 117 ASP n 1 118 ASN n 1 119 ILE n 1 120 GLY n 1 121 SER n 1 122 GLN n 1 123 TYR n 1 124 LEU n 1 125 LEU n 1 126 ASN n 1 127 TRP n 1 128 CYS n 1 129 VAL n 1 130 GLN n 1 131 ILE n 1 132 ALA n 1 133 LYS n 1 134 GLY n 1 135 MET n 1 136 ASN n 1 137 TYR n 1 138 LEU n 1 139 GLU n 1 140 ASP n 1 141 ARG n 1 142 ARG n 1 143 LEU n 1 144 VAL n 1 145 HIS n 1 146 ARG n 1 147 ASP n 1 148 LEU n 1 149 ALA n 1 150 ALA n 1 151 ARG n 1 152 ASN n 1 153 VAL n 1 154 LEU n 1 155 VAL n 1 156 LYS n 1 157 THR n 1 158 PRO n 1 159 GLN n 1 160 HIS n 1 161 VAL n 1 162 LYS n 1 163 ILE n 1 164 THR n 1 165 ASP n 1 166 PHE n 1 167 GLY n 1 168 LEU n 1 169 ALA n 1 170 LYS n 1 171 LEU n 1 172 LEU n 1 173 GLY n 1 174 ALA n 1 175 GLU n 1 176 GLU n 1 177 LYS n 1 178 GLU n 1 179 TYR n 1 180 HIS n 1 181 ALA n 1 182 GLU n 1 183 GLY n 1 184 GLY n 1 185 LYS n 1 186 VAL n 1 187 PRO n 1 188 ILE n 1 189 LYS n 1 190 TRP n 1 191 MET n 1 192 ALA n 1 193 LEU n 1 194 GLU n 1 195 SER n 1 196 ILE n 1 197 LEU n 1 198 HIS n 1 199 ARG n 1 200 ILE n 1 201 TYR n 1 202 THR n 1 203 HIS n 1 204 GLN n 1 205 SER n 1 206 ASP n 1 207 VAL n 1 208 TRP n 1 209 SER n 1 210 TYR n 1 211 GLY n 1 212 VAL n 1 213 THR n 1 214 VAL n 1 215 TRP n 1 216 GLU n 1 217 LEU n 1 218 MET n 1 219 THR n 1 220 PHE n 1 221 GLY n 1 222 SER n 1 223 LYS n 1 224 PRO n 1 225 TYR n 1 226 ASP n 1 227 GLY n 1 228 ILE n 1 229 PRO n 1 230 ALA n 1 231 SER n 1 232 GLU n 1 233 ILE n 1 234 SER n 1 235 SER n 1 236 ILE n 1 237 LEU n 1 238 GLU n 1 239 LYS n 1 240 GLY n 1 241 GLU n 1 242 ARG n 1 243 LEU n 1 244 PRO n 1 245 GLN n 1 246 PRO n 1 247 PRO n 1 248 ILE n 1 249 CYS n 1 250 THR n 1 251 ILE n 1 252 ASP n 1 253 VAL n 1 254 TYR n 1 255 MET n 1 256 ILE n 1 257 MET n 1 258 ARG n 1 259 LYS n 1 260 CYS n 1 261 TRP n 1 262 MET n 1 263 ILE n 1 264 ASP n 1 265 ALA n 1 266 ASP n 1 267 SER n 1 268 ARG n 1 269 PRO n 1 270 LYS n 1 271 PHE n 1 272 ARG n 1 273 GLU n 1 274 LEU n 1 275 ILE n 1 276 ILE n 1 277 GLU n 1 278 PHE n 1 279 SER n 1 280 LYS n 1 281 MET n 1 282 ALA n 1 283 ARG n 1 284 ASP n 1 285 PRO n 1 286 GLN n 1 287 ARG n 1 288 TYR n 1 289 LEU n 1 290 VAL n 1 291 ILE n 1 292 GLN n 1 293 GLY n 1 294 ASP n 1 295 GLU n 1 296 ARG n 1 297 MET n 1 298 HIS n 1 299 LEU n 1 300 PRO n 1 301 SER n 1 302 PRO n 1 303 THR n 1 304 ASP n 1 305 SER n 1 306 ASN n 1 307 PHE n 1 308 TYR n 1 309 ARG n 1 310 ALA n 1 311 LEU n 1 312 MET n 1 313 ASP n 1 314 GLU n 1 315 GLU n 1 316 ASP n 1 317 MET n 1 318 ASP n 1 319 ASP n 1 320 VAL n 1 321 VAL n 1 322 ASP n 1 323 ALA n 1 324 ASP n 1 325 GLU n 1 326 TYR n 1 327 LEU n 1 328 ILE n 1 329 PRO n 1 330 GLN n 1 331 GLN n 1 332 GLY n 1 333 HIS n 1 334 HIS n 1 335 HIS n 1 336 HIS n 1 337 HIS n 1 338 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 338 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'EGFR, ERBB, ERBB1, HER1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1IMS non-polymer . '3-[(3-chloranyl-2-methoxy-phenyl)amino]-2-[3-[[(2S)-oxolan-2-yl]methoxy]pyridin-4-yl]-1,5,6,7-tetrahydropyrrolo[3,2-c]pyridin-4-one' ? 'C24 H25 Cl N4 O4' 468.933 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 694 ? ? ? A . n A 1 2 SER 2 695 ? ? ? A . n A 1 3 GLY 3 696 ? ? ? A . n A 1 4 GLU 4 697 ? ? ? A . n A 1 5 ALA 5 698 ? ? ? A . n A 1 6 PRO 6 699 ? ? ? A . n A 1 7 ASN 7 700 ? ? ? A . n A 1 8 GLN 8 701 ? ? ? A . n A 1 9 ALA 9 702 702 ALA ALA A . n A 1 10 LEU 10 703 703 LEU LEU A . n A 1 11 LEU 11 704 704 LEU LEU A . n A 1 12 ARG 12 705 705 ARG ARG A . n A 1 13 ILE 13 706 706 ILE ILE A . n A 1 14 LEU 14 707 707 LEU LEU A . n A 1 15 LYS 15 708 708 LYS LYS A . n A 1 16 GLU 16 709 709 GLU GLU A . n A 1 17 THR 17 710 710 THR THR A . n A 1 18 GLU 18 711 711 GLU GLU A . n A 1 19 PHE 19 712 712 PHE PHE A . n A 1 20 LYS 20 713 713 LYS LYS A . n A 1 21 LYS 21 714 714 LYS LYS A . n A 1 22 ILE 22 715 715 ILE ILE A . n A 1 23 LYS 23 716 716 LYS LYS A . n A 1 24 VAL 24 717 717 VAL VAL A . n A 1 25 LEU 25 718 718 LEU LEU A . n A 1 26 GLY 26 719 719 GLY GLY A . n A 1 27 SER 27 720 720 SER SER A . n A 1 28 GLY 28 721 721 GLY GLY A . n A 1 29 ALA 29 722 722 ALA ALA A . n A 1 30 PHE 30 723 723 PHE PHE A . n A 1 31 GLY 31 724 724 GLY GLY A . n A 1 32 THR 32 725 725 THR THR A . n A 1 33 VAL 33 726 726 VAL VAL A . n A 1 34 TYR 34 727 727 TYR TYR A . n A 1 35 LYS 35 728 728 LYS LYS A . n A 1 36 GLY 36 729 729 GLY GLY A . n A 1 37 LEU 37 730 730 LEU LEU A . n A 1 38 TRP 38 731 731 TRP TRP A . n A 1 39 ILE 39 732 732 ILE ILE A . n A 1 40 PRO 40 733 733 PRO PRO A . n A 1 41 GLU 41 734 734 GLU GLU A . n A 1 42 GLY 42 735 735 GLY GLY A . n A 1 43 GLU 43 736 736 GLU GLU A . n A 1 44 LYS 44 737 737 LYS LYS A . n A 1 45 VAL 45 738 738 VAL VAL A . n A 1 46 LYS 46 739 739 LYS LYS A . n A 1 47 ILE 47 740 740 ILE ILE A . n A 1 48 PRO 48 741 741 PRO PRO A . n A 1 49 VAL 49 742 742 VAL VAL A . n A 1 50 ALA 50 743 743 ALA ALA A . n A 1 51 ILE 51 744 744 ILE ILE A . n A 1 52 LYS 52 745 745 LYS LYS A . n A 1 53 GLU 53 746 746 GLU GLU A . n A 1 54 LEU 54 747 747 LEU LEU A . n A 1 55 ARG 55 748 ? ? ? A . n A 1 56 GLU 56 749 ? ? ? A . n A 1 57 ALA 57 750 ? ? ? A . n A 1 58 THR 58 751 ? ? ? A . n A 1 59 SER 59 752 ? ? ? A . n A 1 60 PRO 60 753 ? ? ? A . n A 1 61 LYS 61 754 ? ? ? A . n A 1 62 ALA 62 755 755 ALA ALA A . n A 1 63 ASN 63 756 756 ASN ASN A . n A 1 64 LYS 64 757 757 LYS LYS A . n A 1 65 GLU 65 758 758 GLU GLU A . n A 1 66 ILE 66 759 759 ILE ILE A . n A 1 67 LEU 67 760 760 LEU LEU A . n A 1 68 ASP 68 761 761 ASP ASP A . n A 1 69 GLU 69 762 762 GLU GLU A . n A 1 70 ALA 70 763 763 ALA ALA A . n A 1 71 TYR 71 764 764 TYR TYR A . n A 1 72 VAL 72 765 765 VAL VAL A . n A 1 73 MET 73 766 766 MET MET A . n A 1 74 ALA 74 767 767 ALA ALA A . n A 1 75 SER 75 768 768 SER SER A . n A 1 76 VAL 76 769 769 VAL VAL A . n A 1 77 ASP 77 770 770 ASP ASP A . n A 1 78 ASN 78 770 770 ASN ASN A A n A 1 79 PRO 79 770 770 PRO PRO A B n A 1 80 GLY 80 770 770 GLY GLY A C n A 1 81 ASN 81 771 771 ASN ASN A . n A 1 82 PRO 82 772 772 PRO PRO A . n A 1 83 HIS 83 773 773 HIS HIS A . n A 1 84 VAL 84 774 774 VAL VAL A . n A 1 85 CYS 85 775 775 CYS CYS A . n A 1 86 ARG 86 776 776 ARG ARG A . n A 1 87 LEU 87 777 777 LEU LEU A . n A 1 88 LEU 88 778 778 LEU LEU A . n A 1 89 GLY 89 779 779 GLY GLY A . n A 1 90 ILE 90 780 780 ILE ILE A . n A 1 91 CYS 91 781 781 CYS CYS A . n A 1 92 LEU 92 782 782 LEU LEU A . n A 1 93 THR 93 783 783 THR THR A . n A 1 94 SER 94 784 784 SER SER A . n A 1 95 THR 95 785 785 THR THR A . n A 1 96 VAL 96 786 786 VAL VAL A . n A 1 97 GLN 97 787 787 GLN GLN A . n A 1 98 LEU 98 788 788 LEU LEU A . n A 1 99 ILE 99 789 789 ILE ILE A . n A 1 100 THR 100 790 790 THR THR A . n A 1 101 GLN 101 791 791 GLN GLN A . n A 1 102 LEU 102 792 792 LEU LEU A . n A 1 103 MET 103 793 793 MET MET A . n A 1 104 PRO 104 794 794 PRO PRO A . n A 1 105 PHE 105 795 795 PHE PHE A . n A 1 106 GLY 106 796 796 GLY GLY A . n A 1 107 CYS 107 797 797 CYS CYS A . n A 1 108 LEU 108 798 798 LEU LEU A . n A 1 109 LEU 109 799 799 LEU LEU A . n A 1 110 ASP 110 800 800 ASP ASP A . n A 1 111 TYR 111 801 801 TYR TYR A . n A 1 112 VAL 112 802 802 VAL VAL A . n A 1 113 ARG 113 803 803 ARG ARG A . n A 1 114 GLU 114 804 804 GLU GLU A . n A 1 115 HIS 115 805 805 HIS HIS A . n A 1 116 LYS 116 806 806 LYS LYS A . n A 1 117 ASP 117 807 807 ASP ASP A . n A 1 118 ASN 118 808 808 ASN ASN A . n A 1 119 ILE 119 809 809 ILE ILE A . n A 1 120 GLY 120 810 810 GLY GLY A . n A 1 121 SER 121 811 811 SER SER A . n A 1 122 GLN 122 812 812 GLN GLN A . n A 1 123 TYR 123 813 813 TYR TYR A . n A 1 124 LEU 124 814 814 LEU LEU A . n A 1 125 LEU 125 815 815 LEU LEU A . n A 1 126 ASN 126 816 816 ASN ASN A . n A 1 127 TRP 127 817 817 TRP TRP A . n A 1 128 CYS 128 818 818 CYS CYS A . n A 1 129 VAL 129 819 819 VAL VAL A . n A 1 130 GLN 130 820 820 GLN GLN A . n A 1 131 ILE 131 821 821 ILE ILE A . n A 1 132 ALA 132 822 822 ALA ALA A . n A 1 133 LYS 133 823 823 LYS LYS A . n A 1 134 GLY 134 824 824 GLY GLY A . n A 1 135 MET 135 825 825 MET MET A . n A 1 136 ASN 136 826 826 ASN ASN A . n A 1 137 TYR 137 827 827 TYR TYR A . n A 1 138 LEU 138 828 828 LEU LEU A . n A 1 139 GLU 139 829 829 GLU GLU A . n A 1 140 ASP 140 830 830 ASP ASP A . n A 1 141 ARG 141 831 831 ARG ARG A . n A 1 142 ARG 142 832 832 ARG ARG A . n A 1 143 LEU 143 833 833 LEU LEU A . n A 1 144 VAL 144 834 834 VAL VAL A . n A 1 145 HIS 145 835 835 HIS HIS A . n A 1 146 ARG 146 836 836 ARG ARG A . n A 1 147 ASP 147 837 837 ASP ASP A . n A 1 148 LEU 148 838 838 LEU LEU A . n A 1 149 ALA 149 839 839 ALA ALA A . n A 1 150 ALA 150 840 840 ALA ALA A . n A 1 151 ARG 151 841 841 ARG ARG A . n A 1 152 ASN 152 842 842 ASN ASN A . n A 1 153 VAL 153 843 843 VAL VAL A . n A 1 154 LEU 154 844 844 LEU LEU A . n A 1 155 VAL 155 845 845 VAL VAL A . n A 1 156 LYS 156 846 846 LYS LYS A . n A 1 157 THR 157 847 847 THR THR A . n A 1 158 PRO 158 848 848 PRO PRO A . n A 1 159 GLN 159 849 849 GLN GLN A . n A 1 160 HIS 160 850 850 HIS HIS A . n A 1 161 VAL 161 851 851 VAL VAL A . n A 1 162 LYS 162 852 852 LYS LYS A . n A 1 163 ILE 163 853 853 ILE ILE A . n A 1 164 THR 164 854 854 THR THR A . n A 1 165 ASP 165 855 855 ASP ASP A . n A 1 166 PHE 166 856 856 PHE PHE A . n A 1 167 GLY 167 857 857 GLY GLY A . n A 1 168 LEU 168 858 858 LEU LEU A . n A 1 169 ALA 169 859 859 ALA ALA A . n A 1 170 LYS 170 860 860 LYS LYS A . n A 1 171 LEU 171 861 861 LEU LEU A . n A 1 172 LEU 172 862 862 LEU LEU A . n A 1 173 GLY 173 863 863 GLY GLY A . n A 1 174 ALA 174 864 864 ALA ALA A . n A 1 175 GLU 175 865 865 GLU GLU A . n A 1 176 GLU 176 866 866 GLU GLU A . n A 1 177 LYS 177 867 867 LYS LYS A . n A 1 178 GLU 178 868 868 GLU GLU A . n A 1 179 TYR 179 869 869 TYR TYR A . n A 1 180 HIS 180 870 870 HIS HIS A . n A 1 181 ALA 181 871 871 ALA ALA A . n A 1 182 GLU 182 872 872 GLU GLU A . n A 1 183 GLY 183 873 873 GLY GLY A . n A 1 184 GLY 184 874 874 GLY GLY A . n A 1 185 LYS 185 875 875 LYS LYS A . n A 1 186 VAL 186 876 876 VAL VAL A . n A 1 187 PRO 187 877 877 PRO PRO A . n A 1 188 ILE 188 878 878 ILE ILE A . n A 1 189 LYS 189 879 879 LYS LYS A . n A 1 190 TRP 190 880 880 TRP TRP A . n A 1 191 MET 191 881 881 MET MET A . n A 1 192 ALA 192 882 882 ALA ALA A . n A 1 193 LEU 193 883 883 LEU LEU A . n A 1 194 GLU 194 884 884 GLU GLU A . n A 1 195 SER 195 885 885 SER SER A . n A 1 196 ILE 196 886 886 ILE ILE A . n A 1 197 LEU 197 887 887 LEU LEU A . n A 1 198 HIS 198 888 888 HIS HIS A . n A 1 199 ARG 199 889 889 ARG ARG A . n A 1 200 ILE 200 890 890 ILE ILE A . n A 1 201 TYR 201 891 891 TYR TYR A . n A 1 202 THR 202 892 892 THR THR A . n A 1 203 HIS 203 893 893 HIS HIS A . n A 1 204 GLN 204 894 894 GLN GLN A . n A 1 205 SER 205 895 895 SER SER A . n A 1 206 ASP 206 896 896 ASP ASP A . n A 1 207 VAL 207 897 897 VAL VAL A . n A 1 208 TRP 208 898 898 TRP TRP A . n A 1 209 SER 209 899 899 SER SER A . n A 1 210 TYR 210 900 900 TYR TYR A . n A 1 211 GLY 211 901 901 GLY GLY A . n A 1 212 VAL 212 902 902 VAL VAL A . n A 1 213 THR 213 903 903 THR THR A . n A 1 214 VAL 214 904 904 VAL VAL A . n A 1 215 TRP 215 905 905 TRP TRP A . n A 1 216 GLU 216 906 906 GLU GLU A . n A 1 217 LEU 217 907 907 LEU LEU A . n A 1 218 MET 218 908 908 MET MET A . n A 1 219 THR 219 909 909 THR THR A . n A 1 220 PHE 220 910 910 PHE PHE A . n A 1 221 GLY 221 911 911 GLY GLY A . n A 1 222 SER 222 912 912 SER SER A . n A 1 223 LYS 223 913 913 LYS LYS A . n A 1 224 PRO 224 914 914 PRO PRO A . n A 1 225 TYR 225 915 915 TYR TYR A . n A 1 226 ASP 226 916 916 ASP ASP A . n A 1 227 GLY 227 917 917 GLY GLY A . n A 1 228 ILE 228 918 918 ILE ILE A . n A 1 229 PRO 229 919 919 PRO PRO A . n A 1 230 ALA 230 920 920 ALA ALA A . n A 1 231 SER 231 921 921 SER SER A . n A 1 232 GLU 232 922 922 GLU GLU A . n A 1 233 ILE 233 923 923 ILE ILE A . n A 1 234 SER 234 924 924 SER SER A . n A 1 235 SER 235 925 925 SER SER A . n A 1 236 ILE 236 926 926 ILE ILE A . n A 1 237 LEU 237 927 927 LEU LEU A . n A 1 238 GLU 238 928 928 GLU GLU A . n A 1 239 LYS 239 929 929 LYS LYS A . n A 1 240 GLY 240 930 930 GLY GLY A . n A 1 241 GLU 241 931 931 GLU GLU A . n A 1 242 ARG 242 932 932 ARG ARG A . n A 1 243 LEU 243 933 933 LEU LEU A . n A 1 244 PRO 244 934 934 PRO PRO A . n A 1 245 GLN 245 935 935 GLN GLN A . n A 1 246 PRO 246 936 936 PRO PRO A . n A 1 247 PRO 247 937 937 PRO PRO A . n A 1 248 ILE 248 938 938 ILE ILE A . n A 1 249 CYS 249 939 939 CYS CYS A . n A 1 250 THR 250 940 940 THR THR A . n A 1 251 ILE 251 941 941 ILE ILE A . n A 1 252 ASP 252 942 942 ASP ASP A . n A 1 253 VAL 253 943 943 VAL VAL A . n A 1 254 TYR 254 944 944 TYR TYR A . n A 1 255 MET 255 945 945 MET MET A . n A 1 256 ILE 256 946 946 ILE ILE A . n A 1 257 MET 257 947 947 MET MET A . n A 1 258 ARG 258 948 948 ARG ARG A . n A 1 259 LYS 259 949 949 LYS LYS A . n A 1 260 CYS 260 950 950 CYS CYS A . n A 1 261 TRP 261 951 951 TRP TRP A . n A 1 262 MET 262 952 952 MET MET A . n A 1 263 ILE 263 953 953 ILE ILE A . n A 1 264 ASP 264 954 954 ASP ASP A . n A 1 265 ALA 265 955 955 ALA ALA A . n A 1 266 ASP 266 956 956 ASP ASP A . n A 1 267 SER 267 957 957 SER SER A . n A 1 268 ARG 268 958 958 ARG ARG A . n A 1 269 PRO 269 959 959 PRO PRO A . n A 1 270 LYS 270 960 960 LYS LYS A . n A 1 271 PHE 271 961 961 PHE PHE A . n A 1 272 ARG 272 962 962 ARG ARG A . n A 1 273 GLU 273 963 963 GLU GLU A . n A 1 274 LEU 274 964 964 LEU LEU A . n A 1 275 ILE 275 965 965 ILE ILE A . n A 1 276 ILE 276 966 966 ILE ILE A . n A 1 277 GLU 277 967 967 GLU GLU A . n A 1 278 PHE 278 968 968 PHE PHE A . n A 1 279 SER 279 969 969 SER SER A . n A 1 280 LYS 280 970 970 LYS LYS A . n A 1 281 MET 281 971 971 MET MET A . n A 1 282 ALA 282 972 972 ALA ALA A . n A 1 283 ARG 283 973 973 ARG ARG A . n A 1 284 ASP 284 974 974 ASP ASP A . n A 1 285 PRO 285 975 975 PRO PRO A . n A 1 286 GLN 286 976 976 GLN GLN A . n A 1 287 ARG 287 977 977 ARG ARG A . n A 1 288 TYR 288 978 978 TYR TYR A . n A 1 289 LEU 289 979 979 LEU LEU A . n A 1 290 VAL 290 980 980 VAL VAL A . n A 1 291 ILE 291 981 981 ILE ILE A . n A 1 292 GLN 292 982 982 GLN GLN A . n A 1 293 GLY 293 983 983 GLY GLY A . n A 1 294 ASP 294 984 984 ASP ASP A . n A 1 295 GLU 295 985 985 GLU GLU A . n A 1 296 ARG 296 986 986 ARG ARG A . n A 1 297 MET 297 987 987 MET MET A . n A 1 298 HIS 298 988 988 HIS HIS A . n A 1 299 LEU 299 989 989 LEU LEU A . n A 1 300 PRO 300 990 990 PRO PRO A . n A 1 301 SER 301 991 991 SER SER A . n A 1 302 PRO 302 992 992 PRO PRO A . n A 1 303 THR 303 993 993 THR THR A . n A 1 304 ASP 304 994 994 ASP ASP A . n A 1 305 SER 305 995 995 SER SER A . n A 1 306 ASN 306 996 996 ASN ASN A . n A 1 307 PHE 307 997 997 PHE PHE A . n A 1 308 TYR 308 998 998 TYR TYR A . n A 1 309 ARG 309 999 999 ARG ARG A . n A 1 310 ALA 310 1000 1000 ALA ALA A . n A 1 311 LEU 311 1001 ? ? ? A . n A 1 312 MET 312 1002 ? ? ? A . n A 1 313 ASP 313 1003 ? ? ? A . n A 1 314 GLU 314 1004 ? ? ? A . n A 1 315 GLU 315 1005 ? ? ? A . n A 1 316 ASP 316 1006 ? ? ? A . n A 1 317 MET 317 1007 ? ? ? A . n A 1 318 ASP 318 1008 ? ? ? A . n A 1 319 ASP 319 1009 ? ? ? A . n A 1 320 VAL 320 1010 ? ? ? A . n A 1 321 VAL 321 1011 ? ? ? A . n A 1 322 ASP 322 1012 ? ? ? A . n A 1 323 ALA 323 1013 ? ? ? A . n A 1 324 ASP 324 1014 ? ? ? A . n A 1 325 GLU 325 1015 1015 GLU GLU A . n A 1 326 TYR 326 1016 1016 TYR TYR A . n A 1 327 LEU 327 1017 1017 LEU LEU A . n A 1 328 ILE 328 1018 1018 ILE ILE A . n A 1 329 PRO 329 1019 1019 PRO PRO A . n A 1 330 GLN 330 1020 ? ? ? A . n A 1 331 GLN 331 1021 ? ? ? A . n A 1 332 GLY 332 1022 ? ? ? A . n A 1 333 HIS 333 1023 ? ? ? A . n A 1 334 HIS 334 1024 ? ? ? A . n A 1 335 HIS 335 1025 ? ? ? A . n A 1 336 HIS 336 1026 ? ? ? A . n A 1 337 HIS 337 1027 ? ? ? A . n A 1 338 HIS 338 1028 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1IMS _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1IMS _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 A1IMS 1 2001 2001 A1IMS SCN A . C 3 HOH 1 2101 18 HOH HOH A . C 3 HOH 2 2102 77 HOH HOH A . C 3 HOH 3 2103 81 HOH HOH A . C 3 HOH 4 2104 71 HOH HOH A . C 3 HOH 5 2105 11 HOH HOH A . C 3 HOH 6 2106 13 HOH HOH A . C 3 HOH 7 2107 9 HOH HOH A . C 3 HOH 8 2108 15 HOH HOH A . C 3 HOH 9 2109 68 HOH HOH A . C 3 HOH 10 2110 28 HOH HOH A . C 3 HOH 11 2111 30 HOH HOH A . C 3 HOH 12 2112 23 HOH HOH A . C 3 HOH 13 2113 64 HOH HOH A . C 3 HOH 14 2114 35 HOH HOH A . C 3 HOH 15 2115 73 HOH HOH A . C 3 HOH 16 2116 33 HOH HOH A . C 3 HOH 17 2117 8 HOH HOH A . C 3 HOH 18 2118 32 HOH HOH A . C 3 HOH 19 2119 2 HOH HOH A . C 3 HOH 20 2120 84 HOH HOH A . C 3 HOH 21 2121 7 HOH HOH A . C 3 HOH 22 2122 4 HOH HOH A . C 3 HOH 23 2123 85 HOH HOH A . C 3 HOH 24 2124 16 HOH HOH A . C 3 HOH 25 2125 83 HOH HOH A . C 3 HOH 26 2126 44 HOH HOH A . C 3 HOH 27 2127 52 HOH HOH A . C 3 HOH 28 2128 10 HOH HOH A . C 3 HOH 29 2129 22 HOH HOH A . C 3 HOH 30 2130 72 HOH HOH A . C 3 HOH 31 2131 59 HOH HOH A . C 3 HOH 32 2132 38 HOH HOH A . C 3 HOH 33 2133 79 HOH HOH A . C 3 HOH 34 2134 92 HOH HOH A . C 3 HOH 35 2135 78 HOH HOH A . C 3 HOH 36 2136 99 HOH HOH A . C 3 HOH 37 2137 42 HOH HOH A . C 3 HOH 38 2138 1 HOH HOH A . C 3 HOH 39 2139 17 HOH HOH A . C 3 HOH 40 2140 87 HOH HOH A . C 3 HOH 41 2141 106 HOH HOH A . C 3 HOH 42 2142 39 HOH HOH A . C 3 HOH 43 2143 46 HOH HOH A . C 3 HOH 44 2144 65 HOH HOH A . C 3 HOH 45 2145 25 HOH HOH A . C 3 HOH 46 2146 70 HOH HOH A . C 3 HOH 47 2147 14 HOH HOH A . C 3 HOH 48 2148 27 HOH HOH A . C 3 HOH 49 2149 96 HOH HOH A . C 3 HOH 50 2150 53 HOH HOH A . C 3 HOH 51 2151 69 HOH HOH A . C 3 HOH 52 2152 97 HOH HOH A . C 3 HOH 53 2153 34 HOH HOH A . C 3 HOH 54 2154 57 HOH HOH A . C 3 HOH 55 2155 43 HOH HOH A . C 3 HOH 56 2156 103 HOH HOH A . C 3 HOH 57 2157 49 HOH HOH A . C 3 HOH 58 2158 55 HOH HOH A . C 3 HOH 59 2159 50 HOH HOH A . C 3 HOH 60 2160 80 HOH HOH A . C 3 HOH 61 2161 29 HOH HOH A . C 3 HOH 62 2162 5 HOH HOH A . C 3 HOH 63 2163 36 HOH HOH A . C 3 HOH 64 2164 31 HOH HOH A . C 3 HOH 65 2165 95 HOH HOH A . C 3 HOH 66 2166 58 HOH HOH A . C 3 HOH 67 2167 88 HOH HOH A . C 3 HOH 68 2168 89 HOH HOH A . C 3 HOH 69 2169 41 HOH HOH A . C 3 HOH 70 2170 37 HOH HOH A . C 3 HOH 71 2171 66 HOH HOH A . C 3 HOH 72 2172 12 HOH HOH A . C 3 HOH 73 2173 3 HOH HOH A . C 3 HOH 74 2174 60 HOH HOH A . C 3 HOH 75 2175 26 HOH HOH A . C 3 HOH 76 2176 100 HOH HOH A . C 3 HOH 77 2177 24 HOH HOH A . C 3 HOH 78 2178 51 HOH HOH A . C 3 HOH 79 2179 21 HOH HOH A . C 3 HOH 80 2180 104 HOH HOH A . C 3 HOH 81 2181 62 HOH HOH A . C 3 HOH 82 2182 75 HOH HOH A . C 3 HOH 83 2183 6 HOH HOH A . C 3 HOH 84 2184 48 HOH HOH A . C 3 HOH 85 2185 47 HOH HOH A . C 3 HOH 86 2186 102 HOH HOH A . C 3 HOH 87 2187 19 HOH HOH A . C 3 HOH 88 2188 94 HOH HOH A . C 3 HOH 89 2189 86 HOH HOH A . C 3 HOH 90 2190 91 HOH HOH A . C 3 HOH 91 2191 76 HOH HOH A . C 3 HOH 92 2192 101 HOH HOH A . C 3 HOH 93 2193 67 HOH HOH A . C 3 HOH 94 2194 93 HOH HOH A . C 3 HOH 95 2195 82 HOH HOH A . C 3 HOH 96 2196 45 HOH HOH A . C 3 HOH 97 2197 61 HOH HOH A . C 3 HOH 98 2198 74 HOH HOH A . C 3 HOH 99 2199 105 HOH HOH A . C 3 HOH 100 2200 54 HOH HOH A . C 3 HOH 101 2201 40 HOH HOH A . C 3 HOH 102 2202 63 HOH HOH A . C 3 HOH 103 2203 56 HOH HOH A . C 3 HOH 104 2204 90 HOH HOH A . C 3 HOH 105 2205 20 HOH HOH A . C 3 HOH 106 2206 98 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? '1.1.7 20201211' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 'Jun 1, 2017' 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.4 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? STARANISO ? ? ? 2.3.54 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.11.8 6 # _cell.angle_alpha 90 _cell.angle_alpha_esd ? _cell.angle_beta 90 _cell.angle_beta_esd ? _cell.angle_gamma 90 _cell.angle_gamma_esd ? _cell.entry_id 9GL7 _cell.details ? _cell.formula_units_Z ? _cell.length_a 39.744 _cell.length_a_esd ? _cell.length_b 105.781 _cell.length_b_esd ? _cell.length_c 174.454 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9GL7 _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9GL7 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.37 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.11 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Magnesium Chloride, 0.1 M TRIS-HCl pH 8.5, 20% w/v PEG 4000' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-02-04 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.965459 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE MASSIF-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.965459 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MASSIF-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9GL7 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.878 _reflns.d_resolution_low 34.222 _reflns.details ;Some remarks regarding the mmCIF items written, the PDB Exchange Dictionary (PDBx/mmCIF) Version 5.0 supporting the data files in the current PDB archive (dictionary version 5.325, last updated 2020-04-13: http://mmcif.wwpdb.org/dictionaries/mmcif_pdbx_v50.dic/Index/) and the actual quantities provided by MRFANA (https://github.com/githubgphl/MRFANA) from the autoPROC package (https://www.globalphasing.com/autoproc/). In general, the mmCIF categories here should provide items that are currently used in the PDB archive. If there are alternatives, the one recommended by the PDB developers has been selected. The distinction between *_all and *_obs quantities is not always clear: often only one version is actively used within the PDB archive (or is the one recommended by PDB developers). The intention of distinguishing between classes of reflections before and after some kind of observation criterion was applied, can in principle be useful - but such criteria change in various ways through the data processing procedure (rejection of overloaded or too partial reflections, outlier/misfit rejection during scaling etc) and there is no retrospect computation of data scaling/merging statistics for the reflections used in the final refinement (where another observation criterion might have been applied). Typical data processing will usually only provide one version of statistics at various stages and these are given in the recommended item here, irrespective of the "_all" and "_obs" connotation, see e.g. the use of _reflns.pdbx_Rmerge_I_obs, _reflns.pdbx_Rrim_I_all and _reflns.pdbx_Rpim_I_all. Please note that all statistics related to "merged intensities" (or "merging") are based on inverse-variance weighting of the individual measurements making up a symmetry-unique reflection. This is standard for several decades now, even if some of the dictionary definitions seem to suggest that a simple "mean" or "average" intensity is being used instead. R-values are always given for all symmetry-equivalent reflections following Friedel's law, i.e. Bijvoet pairs are not treated separately (since we want to describe the overall mean intensity and not the mean I(+) and I(-) here). The Rrim metric is identical to the Rmeas R-value and only differs in name. _reflns.pdbx_number_measured_all is the number of measured intensities just before the final merging step (at which point no additional rejection takes place). _reflns.number_obs is the number of symmetry-unique observations, i.e. the result of merging those measurements via inverse-variance weighting. _reflns.pdbx_netI_over_sigmaI is based on the merged intensities (_reflns.number_obs) as expected. _reflns.pdbx_redundancy is synonymous with "multiplicity". The per-shell item _reflns_shell.number_measured_all corresponds to the overall value _reflns.pdbx_number_measured_all. The per-shell item _reflns_shell.number_unique_all corresponds to the overall value _reflns.number_obs. The per-shell item _reflns_shell.percent_possible_all corresponds to the overall value _reflns.percent_possible_obs. The per-shell item _reflns_shell.meanI_over_sigI_obs corresponds to the overall value given as _reflns.pdbx_netI_over_sigmaI. But be aware of the incorrect definition of the former in the current dictionary! ; _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 16502 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 82.1 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.50 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.76 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.3233 _reflns.pdbx_Rpim_I_all 0.1672 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 74289 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.944 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.2739 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 5.050 34.222 ? 13.20 6359 6359 ? 1649 1649 ? ? ? ? ? ? ? ? ? ? ? 3.86 ? ? ? 0.1367 0.0729 ? 1 ? 0.981 ? ? 96.9 ? 0.1143 ? ? ? ? ? ? ? ? ? 3.973 5.050 ? 12.23 6697 6697 ? 1650 1650 ? ? ? ? ? ? ? ? ? ? ? 4.06 ? ? ? 0.2139 0.1162 ? 2 ? 0.935 ? ? 96.8 ? 0.1777 ? ? ? ? ? ? ? ? ? 3.460 3.973 ? 10.38 7006 7006 ? 1652 1652 ? ? ? ? ? ? ? ? ? ? ? 4.24 ? ? ? 0.3083 0.1628 ? 3 ? 0.876 ? ? 97.5 ? 0.2593 ? ? ? ? ? ? ? ? ? 3.118 3.460 ? 7.83 6307 6307 ? 1650 1650 ? ? ? ? ? ? ? ? ? ? ? 3.82 ? ? ? 0.4271 0.2286 ? 4 ? 0.804 ? ? 91.0 ? 0.3571 ? ? ? ? ? ? ? ? ? 2.837 3.117 ? 6.84 7272 7272 ? 1650 1650 ? ? ? ? ? ? ? ? ? ? ? 4.41 ? ? ? 0.4693 0.2334 ? 5 ? 0.789 ? ? 75.4 ? 0.4035 ? ? ? ? ? ? ? ? ? 2.627 2.837 ? 5.37 7571 7571 ? 1650 1650 ? ? ? ? ? ? ? ? ? ? ? 4.59 ? ? ? 0.7135 0.3534 ? 6 ? 0.651 ? ? 71.3 ? 0.6141 ? ? ? ? ? ? ? ? ? 2.450 2.627 ? 4.09 7777 7777 ? 1650 1650 ? ? ? ? ? ? ? ? ? ? ? 4.71 ? ? ? 1.1120 0.5557 ? 7 ? 0.461 ? ? 72.4 ? 0.9544 ? ? ? ? ? ? ? ? ? 2.281 2.450 ? 3.43 7656 7656 ? 1651 1651 ? ? ? ? ? ? ? ? ? ? ? 4.64 ? ? ? 1.2197 0.6179 ? 8 ? 0.301 ? ? 71.1 ? 1.0404 ? ? ? ? ? ? ? ? ? 2.117 2.281 ? 2.51 7982 7982 ? 1650 1650 ? ? ? ? ? ? ? ? ? ? ? 4.84 ? ? ? 1.3299 0.6378 ? 9 ? 0.404 ? ? 84.9 ? 1.1580 ? ? ? ? ? ? ? ? ? 1.878 2.117 ? 1.77 9662 9662 ? 1650 1650 ? ? ? ? ? ? ? ? ? ? ? 5.86 ? ? ? 1.6575 0.7033 ? 10 ? 0.477 ? ? 76.4 ? 1.4958 ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] -13.353 _refine.aniso_B[1][2] 0 _refine.aniso_B[1][3] 0 _refine.aniso_B[2][2] -3.0164 _refine.aniso_B[2][3] 0 _refine.aniso_B[3][3] 16.3693 _refine.B_iso_max ? _refine.B_iso_mean 46.26 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.849 _refine.correlation_coeff_Fo_to_Fc_free 0.843 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9GL7 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.878 _refine.ls_d_res_low 34.22 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16502 _refine.ls_number_reflns_R_free 794 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 53.9 _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2693 _refine.ls_R_factor_R_free 0.2869 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2683 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI 0.261 _refine.pdbx_overall_SU_R_Blow_DPI 0.409 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 9GL7 _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.39 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.878 _refine_hist.d_res_low 34.22 _refine_hist.number_atoms_solvent 106 _refine_hist.number_atoms_total 2550 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2411 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 33 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 5008 ? t_bond_d 2 HARMONIC 'X-RAY DIFFRACTION' ? 0.97 ? 9090 ? t_angle_deg 2 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1490 ? t_dihedral_angle_d 2 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? 778 ? t_gen_planes 5 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 2525 ? t_it 10 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 321 ? t_chiral_improper_torsion 5 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? 4107 ? t_ideal_dist_contact 4 SEMIHARMONIC 'X-RAY DIFFRACTION' ? 2.88 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 14.6 ? ? ? t_other_torsion ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.88 _refine_ls_shell.d_res_low 1.98 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs 424 _refine_ls_shell.number_reflns_R_free 17 _refine_ls_shell.number_reflns_R_work ? _refine_ls_shell.percent_reflns_obs 9.35 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs 0.2791 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2773 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.3168 # _struct.entry_id 9GL7 _struct.title ;EGFR Exon20 insertion mutant NPG bound with (S)-3-((3-chloro-2-methoxyphenyl)amino)-2-(3-((tetrahydrofuran-2-yl)methoxy)pyridin-4-yl)-1,5,6,7-tetrahydro-4H-pyrrolo[3,2-c]pyridin-4-one ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9GL7 _struct_keywords.text 'Kinase, Inhibitor, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EGFR_HUMAN _struct_ref.pdbx_db_accession P00533 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHV CRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKIT DFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLP QPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDAD EYLIPQQG ; _struct_ref.pdbx_align_begin 695 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9GL7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 332 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00533 _struct_ref_seq.db_align_beg 695 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1022 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 695 _struct_ref_seq.pdbx_auth_seq_align_end 1022 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9GL7 MET A 1 ? UNP P00533 ? ? 'initiating methionine' 694 1 1 9GL7 ASN A 78 A UNP P00533 ? ? insertion 770 2 1 9GL7 PRO A 79 B UNP P00533 ? ? insertion 770 3 1 9GL7 GLY A 80 C UNP P00533 ? ? insertion 770 4 1 9GL7 ARG A 258 ? UNP P00533 VAL 948 'engineered mutation' 948 5 1 9GL7 HIS A 333 ? UNP P00533 ? ? 'expression tag' 1023 6 1 9GL7 HIS A 334 ? UNP P00533 ? ? 'expression tag' 1024 7 1 9GL7 HIS A 335 ? UNP P00533 ? ? 'expression tag' 1025 8 1 9GL7 HIS A 336 ? UNP P00533 ? ? 'expression tag' 1026 9 1 9GL7 HIS A 337 ? UNP P00533 ? ? 'expression tag' 1027 10 1 9GL7 HIS A 338 ? UNP P00533 ? ? 'expression tag' 1028 11 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 920 ? 1 MORE -7 ? 1 'SSA (A^2)' 14530 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 15 ? THR A 17 ? LYS A 708 THR A 710 5 ? 3 HELX_P HELX_P2 AA2 ASN A 63 ? VAL A 76 ? ASN A 756 VAL A 769 1 ? 14 HELX_P HELX_P3 AA3 CYS A 107 ? HIS A 115 ? CYS A 797 HIS A 805 1 ? 9 HELX_P HELX_P4 AA4 LYS A 116 ? ILE A 119 ? LYS A 806 ILE A 809 5 ? 4 HELX_P HELX_P5 AA5 GLY A 120 ? ARG A 141 ? GLY A 810 ARG A 831 1 ? 22 HELX_P HELX_P6 AA6 ALA A 149 ? ARG A 151 ? ALA A 839 ARG A 841 5 ? 3 HELX_P HELX_P7 AA7 PRO A 187 ? MET A 191 ? PRO A 877 MET A 881 5 ? 5 HELX_P HELX_P8 AA8 ALA A 192 ? ARG A 199 ? ALA A 882 ARG A 889 1 ? 8 HELX_P HELX_P9 AA9 THR A 202 ? THR A 219 ? THR A 892 THR A 909 1 ? 18 HELX_P HELX_P10 AB1 PRO A 229 ? SER A 231 ? PRO A 919 SER A 921 5 ? 3 HELX_P HELX_P11 AB2 GLU A 232 ? LYS A 239 ? GLU A 922 LYS A 929 1 ? 8 HELX_P HELX_P12 AB3 THR A 250 ? TRP A 261 ? THR A 940 TRP A 951 1 ? 12 HELX_P HELX_P13 AB4 ASP A 264 ? ARG A 268 ? ASP A 954 ARG A 958 5 ? 5 HELX_P HELX_P14 AB5 LYS A 270 ? ASP A 284 ? LYS A 960 ASP A 974 1 ? 15 HELX_P HELX_P15 AB6 ASP A 284 ? LEU A 289 ? ASP A 974 LEU A 979 1 ? 6 HELX_P HELX_P16 AB7 GLY A 293 ? MET A 297 ? GLY A 983 MET A 987 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASN _struct_mon_prot_cis.label_seq_id 78 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code A _struct_mon_prot_cis.auth_comp_id ASN _struct_mon_prot_cis.auth_seq_id 770 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 79 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 B _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 770 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 3.28 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 19 ? GLY A 28 ? PHE A 712 GLY A 721 AA1 2 GLY A 31 ? TRP A 38 ? GLY A 724 TRP A 731 AA1 3 ILE A 47 ? GLU A 53 ? ILE A 740 GLU A 746 AA1 4 VAL A 96 ? GLN A 101 ? VAL A 786 GLN A 791 AA1 5 LEU A 87 ? LEU A 92 ? LEU A 777 LEU A 782 AA2 1 LEU A 143 ? VAL A 144 ? LEU A 833 VAL A 834 AA2 2 LYS A 170 ? LEU A 171 ? LYS A 860 LEU A 861 AA3 1 VAL A 153 ? THR A 157 ? VAL A 843 THR A 847 AA3 2 HIS A 160 ? ILE A 163 ? HIS A 850 ILE A 853 AA4 1 TYR A 179 ? HIS A 180 ? TYR A 869 HIS A 870 AA4 2 ILE A 200 ? TYR A 201 ? ILE A 890 TYR A 891 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LYS A 23 ? N LYS A 716 O LYS A 35 ? O LYS A 728 AA1 2 3 N THR A 32 ? N THR A 725 O GLU A 53 ? O GLU A 746 AA1 3 4 N ALA A 50 ? N ALA A 743 O THR A 100 ? O THR A 790 AA1 4 5 O GLN A 97 ? O GLN A 787 N CYS A 91 ? N CYS A 781 AA2 1 2 N VAL A 144 ? N VAL A 834 O LYS A 170 ? O LYS A 860 AA3 1 2 N LEU A 154 ? N LEU A 844 O LYS A 162 ? O LYS A 852 AA4 1 2 N TYR A 179 ? N TYR A 869 O TYR A 201 ? O TYR A 891 # _pdbx_entry_details.entry_id 9GL7 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 783 ? ? -96.02 -124.08 2 1 HIS A 805 ? ? -94.58 30.53 3 1 ASN A 808 ? ? -140.94 10.95 4 1 ARG A 836 ? ? 64.53 -6.85 5 1 ASP A 855 ? ? 64.25 98.42 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method ? _pdbx_refine_tls.origin_x 2.1618 _pdbx_refine_tls.origin_y 14.4604 _pdbx_refine_tls.origin_z -19.4314 _pdbx_refine_tls.T[1][1] -0.304 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0079 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0279 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] -0.1146 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0177 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.2949 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 0.258 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.4042 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.0796 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.4722 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.1734 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 3.1974 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.1353 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.1822 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.0302 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.1822 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.0208 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.1049 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.0302 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.1049 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.1145 _pdbx_refine_tls.S[3][3]_esd ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 702 ? ? ? A 1019 ? ? '{ A|* }' 2 'X-RAY DIFFRACTION' 1 ? ? A 2001 ? ? ? A 2001 ? ? '{ A|* }' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 694 ? A MET 1 2 1 Y 1 A SER 695 ? A SER 2 3 1 Y 1 A GLY 696 ? A GLY 3 4 1 Y 1 A GLU 697 ? A GLU 4 5 1 Y 1 A ALA 698 ? A ALA 5 6 1 Y 1 A PRO 699 ? A PRO 6 7 1 Y 1 A ASN 700 ? A ASN 7 8 1 Y 1 A GLN 701 ? A GLN 8 9 1 Y 1 A ARG 748 ? A ARG 55 10 1 Y 1 A GLU 749 ? A GLU 56 11 1 Y 1 A ALA 750 ? A ALA 57 12 1 Y 1 A THR 751 ? A THR 58 13 1 Y 1 A SER 752 ? A SER 59 14 1 Y 1 A PRO 753 ? A PRO 60 15 1 Y 1 A LYS 754 ? A LYS 61 16 1 Y 1 A LEU 1001 ? A LEU 311 17 1 Y 1 A MET 1002 ? A MET 312 18 1 Y 1 A ASP 1003 ? A ASP 313 19 1 Y 1 A GLU 1004 ? A GLU 314 20 1 Y 1 A GLU 1005 ? A GLU 315 21 1 Y 1 A ASP 1006 ? A ASP 316 22 1 Y 1 A MET 1007 ? A MET 317 23 1 Y 1 A ASP 1008 ? A ASP 318 24 1 Y 1 A ASP 1009 ? A ASP 319 25 1 Y 1 A VAL 1010 ? A VAL 320 26 1 Y 1 A VAL 1011 ? A VAL 321 27 1 Y 1 A ASP 1012 ? A ASP 322 28 1 Y 1 A ALA 1013 ? A ALA 323 29 1 Y 1 A ASP 1014 ? A ASP 324 30 1 Y 1 A GLN 1020 ? A GLN 330 31 1 Y 1 A GLN 1021 ? A GLN 331 32 1 Y 1 A GLY 1022 ? A GLY 332 33 1 Y 1 A HIS 1023 ? A HIS 333 34 1 Y 1 A HIS 1024 ? A HIS 334 35 1 Y 1 A HIS 1025 ? A HIS 335 36 1 Y 1 A HIS 1026 ? A HIS 336 37 1 Y 1 A HIS 1027 ? A HIS 337 38 1 Y 1 A HIS 1028 ? A HIS 338 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1IMS C C N N 1 A1IMS N N N N 2 A1IMS CL CL N N 3 A1IMS C2 C Y N 4 A1IMS C3 C Y N 5 A1IMS C4 C Y N 6 A1IMS C5 C Y N 7 A1IMS C6 C Y N 8 A1IMS C1 C Y N 9 A1IMS O O N N 10 A1IMS C7 C Y N 11 A1IMS C13 C Y N 12 A1IMS N2 N Y N 13 A1IMS C9 C Y N 14 A1IMS C10 C N N 15 A1IMS C11 C N N 16 A1IMS N1 N N N 17 A1IMS C12 C N N 18 A1IMS O1 O N N 19 A1IMS C8 C Y N 20 A1IMS C14 C Y N 21 A1IMS C18 C Y N 22 A1IMS C17 C Y N 23 A1IMS N3 N Y N 24 A1IMS C16 C Y N 25 A1IMS C15 C Y N 26 A1IMS O2 O N N 27 A1IMS C19 C N N 28 A1IMS C20 C N S 29 A1IMS O3 O N N 30 A1IMS C23 C N N 31 A1IMS C22 C N N 32 A1IMS C21 C N N 33 A1IMS H3 H N N 34 A1IMS H4 H N N 35 A1IMS H2 H N N 36 A1IMS H8 H N N 37 A1IMS H5 H N N 38 A1IMS H6 H N N 39 A1IMS H7 H N N 40 A1IMS H H N N 41 A1IMS H10 H N N 42 A1IMS H9 H N N 43 A1IMS H12 H N N 44 A1IMS H11 H N N 45 A1IMS H13 H N N 46 A1IMS H16 H N N 47 A1IMS H15 H N N 48 A1IMS H14 H N N 49 A1IMS H17 H N N 50 A1IMS H18 H N N 51 A1IMS H1 H N N 52 A1IMS H24 H N N 53 A1IMS H23 H N N 54 A1IMS H22 H N N 55 A1IMS H21 H N N 56 A1IMS H20 H N N 57 A1IMS H19 H N N 58 ALA N N N N 59 ALA CA C N S 60 ALA C C N N 61 ALA O O N N 62 ALA CB C N N 63 ALA OXT O N N 64 ALA H H N N 65 ALA H2 H N N 66 ALA HA H N N 67 ALA HB1 H N N 68 ALA HB2 H N N 69 ALA HB3 H N N 70 ALA HXT H N N 71 ARG N N N N 72 ARG CA C N S 73 ARG C C N N 74 ARG O O N N 75 ARG CB C N N 76 ARG CG C N N 77 ARG CD C N N 78 ARG NE N N N 79 ARG CZ C N N 80 ARG NH1 N N N 81 ARG NH2 N N N 82 ARG OXT O N N 83 ARG H H N N 84 ARG H2 H N N 85 ARG HA H N N 86 ARG HB2 H N N 87 ARG HB3 H N N 88 ARG HG2 H N N 89 ARG HG3 H N N 90 ARG HD2 H N N 91 ARG HD3 H N N 92 ARG HE H N N 93 ARG HH11 H N N 94 ARG HH12 H N N 95 ARG HH21 H N N 96 ARG HH22 H N N 97 ARG HXT H N N 98 ASN N N N N 99 ASN CA C N S 100 ASN C C N N 101 ASN O O N N 102 ASN CB C N N 103 ASN CG C N N 104 ASN OD1 O N N 105 ASN ND2 N N N 106 ASN OXT O N N 107 ASN H H N N 108 ASN H2 H N N 109 ASN HA H N N 110 ASN HB2 H N N 111 ASN HB3 H N N 112 ASN HD21 H N N 113 ASN HD22 H N N 114 ASN HXT H N N 115 ASP N N N N 116 ASP CA C N S 117 ASP C C N N 118 ASP O O N N 119 ASP CB C N N 120 ASP CG C N N 121 ASP OD1 O N N 122 ASP OD2 O N N 123 ASP OXT O N N 124 ASP H H N N 125 ASP H2 H N N 126 ASP HA H N N 127 ASP HB2 H N N 128 ASP HB3 H N N 129 ASP HD2 H N N 130 ASP HXT H N N 131 CYS N N N N 132 CYS CA C N R 133 CYS C C N N 134 CYS O O N N 135 CYS CB C N N 136 CYS SG S N N 137 CYS OXT O N N 138 CYS H H N N 139 CYS H2 H N N 140 CYS HA H N N 141 CYS HB2 H N N 142 CYS HB3 H N N 143 CYS HG H N N 144 CYS HXT H N N 145 GLN N N N N 146 GLN CA C N S 147 GLN C C N N 148 GLN O O N N 149 GLN CB C N N 150 GLN CG C N N 151 GLN CD C N N 152 GLN OE1 O N N 153 GLN NE2 N N N 154 GLN OXT O N N 155 GLN H H N N 156 GLN H2 H N N 157 GLN HA H N N 158 GLN HB2 H N N 159 GLN HB3 H N N 160 GLN HG2 H N N 161 GLN HG3 H N N 162 GLN HE21 H N N 163 GLN HE22 H N N 164 GLN HXT H N N 165 GLU N N N N 166 GLU CA C N S 167 GLU C C N N 168 GLU O O N N 169 GLU CB C N N 170 GLU CG C N N 171 GLU CD C N N 172 GLU OE1 O N N 173 GLU OE2 O N N 174 GLU OXT O N N 175 GLU H H N N 176 GLU H2 H N N 177 GLU HA H N N 178 GLU HB2 H N N 179 GLU HB3 H N N 180 GLU HG2 H N N 181 GLU HG3 H N N 182 GLU HE2 H N N 183 GLU HXT H N N 184 GLY N N N N 185 GLY CA C N N 186 GLY C C N N 187 GLY O O N N 188 GLY OXT O N N 189 GLY H H N N 190 GLY H2 H N N 191 GLY HA2 H N N 192 GLY HA3 H N N 193 GLY HXT H N N 194 HIS N N N N 195 HIS CA C N S 196 HIS C C N N 197 HIS O O N N 198 HIS CB C N N 199 HIS CG C Y N 200 HIS ND1 N Y N 201 HIS CD2 C Y N 202 HIS CE1 C Y N 203 HIS NE2 N Y N 204 HIS OXT O N N 205 HIS H H N N 206 HIS H2 H N N 207 HIS HA H N N 208 HIS HB2 H N N 209 HIS HB3 H N N 210 HIS HD1 H N N 211 HIS HD2 H N N 212 HIS HE1 H N N 213 HIS HE2 H N N 214 HIS HXT H N N 215 HOH O O N N 216 HOH H1 H N N 217 HOH H2 H N N 218 ILE N N N N 219 ILE CA C N S 220 ILE C C N N 221 ILE O O N N 222 ILE CB C N S 223 ILE CG1 C N N 224 ILE CG2 C N N 225 ILE CD1 C N N 226 ILE OXT O N N 227 ILE H H N N 228 ILE H2 H N N 229 ILE HA H N N 230 ILE HB H N N 231 ILE HG12 H N N 232 ILE HG13 H N N 233 ILE HG21 H N N 234 ILE HG22 H N N 235 ILE HG23 H N N 236 ILE HD11 H N N 237 ILE HD12 H N N 238 ILE HD13 H N N 239 ILE HXT H N N 240 LEU N N N N 241 LEU CA C N S 242 LEU C C N N 243 LEU O O N N 244 LEU CB C N N 245 LEU CG C N N 246 LEU CD1 C N N 247 LEU CD2 C N N 248 LEU OXT O N N 249 LEU H H N N 250 LEU H2 H N N 251 LEU HA H N N 252 LEU HB2 H N N 253 LEU HB3 H N N 254 LEU HG H N N 255 LEU HD11 H N N 256 LEU HD12 H N N 257 LEU HD13 H N N 258 LEU HD21 H N N 259 LEU HD22 H N N 260 LEU HD23 H N N 261 LEU HXT H N N 262 LYS N N N N 263 LYS CA C N S 264 LYS C C N N 265 LYS O O N N 266 LYS CB C N N 267 LYS CG C N N 268 LYS CD C N N 269 LYS CE C N N 270 LYS NZ N N N 271 LYS OXT O N N 272 LYS H H N N 273 LYS H2 H N N 274 LYS HA H N N 275 LYS HB2 H N N 276 LYS HB3 H N N 277 LYS HG2 H N N 278 LYS HG3 H N N 279 LYS HD2 H N N 280 LYS HD3 H N N 281 LYS HE2 H N N 282 LYS HE3 H N N 283 LYS HZ1 H N N 284 LYS HZ2 H N N 285 LYS HZ3 H N N 286 LYS HXT H N N 287 MET N N N N 288 MET CA C N S 289 MET C C N N 290 MET O O N N 291 MET CB C N N 292 MET CG C N N 293 MET SD S N N 294 MET CE C N N 295 MET OXT O N N 296 MET H H N N 297 MET H2 H N N 298 MET HA H N N 299 MET HB2 H N N 300 MET HB3 H N N 301 MET HG2 H N N 302 MET HG3 H N N 303 MET HE1 H N N 304 MET HE2 H N N 305 MET HE3 H N N 306 MET HXT H N N 307 PHE N N N N 308 PHE CA C N S 309 PHE C C N N 310 PHE O O N N 311 PHE CB C N N 312 PHE CG C Y N 313 PHE CD1 C Y N 314 PHE CD2 C Y N 315 PHE CE1 C Y N 316 PHE CE2 C Y N 317 PHE CZ C Y N 318 PHE OXT O N N 319 PHE H H N N 320 PHE H2 H N N 321 PHE HA H N N 322 PHE HB2 H N N 323 PHE HB3 H N N 324 PHE HD1 H N N 325 PHE HD2 H N N 326 PHE HE1 H N N 327 PHE HE2 H N N 328 PHE HZ H N N 329 PHE HXT H N N 330 PRO N N N N 331 PRO CA C N S 332 PRO C C N N 333 PRO O O N N 334 PRO CB C N N 335 PRO CG C N N 336 PRO CD C N N 337 PRO OXT O N N 338 PRO H H N N 339 PRO HA H N N 340 PRO HB2 H N N 341 PRO HB3 H N N 342 PRO HG2 H N N 343 PRO HG3 H N N 344 PRO HD2 H N N 345 PRO HD3 H N N 346 PRO HXT H N N 347 SER N N N N 348 SER CA C N S 349 SER C C N N 350 SER O O N N 351 SER CB C N N 352 SER OG O N N 353 SER OXT O N N 354 SER H H N N 355 SER H2 H N N 356 SER HA H N N 357 SER HB2 H N N 358 SER HB3 H N N 359 SER HG H N N 360 SER HXT H N N 361 THR N N N N 362 THR CA C N S 363 THR C C N N 364 THR O O N N 365 THR CB C N R 366 THR OG1 O N N 367 THR CG2 C N N 368 THR OXT O N N 369 THR H H N N 370 THR H2 H N N 371 THR HA H N N 372 THR HB H N N 373 THR HG1 H N N 374 THR HG21 H N N 375 THR HG22 H N N 376 THR HG23 H N N 377 THR HXT H N N 378 TRP N N N N 379 TRP CA C N S 380 TRP C C N N 381 TRP O O N N 382 TRP CB C N N 383 TRP CG C Y N 384 TRP CD1 C Y N 385 TRP CD2 C Y N 386 TRP NE1 N Y N 387 TRP CE2 C Y N 388 TRP CE3 C Y N 389 TRP CZ2 C Y N 390 TRP CZ3 C Y N 391 TRP CH2 C Y N 392 TRP OXT O N N 393 TRP H H N N 394 TRP H2 H N N 395 TRP HA H N N 396 TRP HB2 H N N 397 TRP HB3 H N N 398 TRP HD1 H N N 399 TRP HE1 H N N 400 TRP HE3 H N N 401 TRP HZ2 H N N 402 TRP HZ3 H N N 403 TRP HH2 H N N 404 TRP HXT H N N 405 TYR N N N N 406 TYR CA C N S 407 TYR C C N N 408 TYR O O N N 409 TYR CB C N N 410 TYR CG C Y N 411 TYR CD1 C Y N 412 TYR CD2 C Y N 413 TYR CE1 C Y N 414 TYR CE2 C Y N 415 TYR CZ C Y N 416 TYR OH O N N 417 TYR OXT O N N 418 TYR H H N N 419 TYR H2 H N N 420 TYR HA H N N 421 TYR HB2 H N N 422 TYR HB3 H N N 423 TYR HD1 H N N 424 TYR HD2 H N N 425 TYR HE1 H N N 426 TYR HE2 H N N 427 TYR HH H N N 428 TYR HXT H N N 429 VAL N N N N 430 VAL CA C N S 431 VAL C C N N 432 VAL O O N N 433 VAL CB C N N 434 VAL CG1 C N N 435 VAL CG2 C N N 436 VAL OXT O N N 437 VAL H H N N 438 VAL H2 H N N 439 VAL HA H N N 440 VAL HB H N N 441 VAL HG11 H N N 442 VAL HG12 H N N 443 VAL HG13 H N N 444 VAL HG21 H N N 445 VAL HG22 H N N 446 VAL HG23 H N N 447 VAL HXT H N N 448 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1IMS C O sing N N 1 A1IMS O C1 sing N N 2 A1IMS C1 C2 doub Y N 3 A1IMS C3 C2 sing Y N 4 A1IMS C4 C3 doub Y N 5 A1IMS C5 C4 sing Y N 6 A1IMS C6 C5 doub Y N 7 A1IMS C1 C6 sing Y N 8 A1IMS N C6 sing N N 9 A1IMS C7 N sing N N 10 A1IMS C7 C8 sing Y N 11 A1IMS C8 C9 doub Y N 12 A1IMS C10 C9 sing N N 13 A1IMS C11 C10 sing N N 14 A1IMS N1 C11 sing N N 15 A1IMS C12 N1 sing N N 16 A1IMS C8 C12 sing N N 17 A1IMS O1 C12 doub N N 18 A1IMS C9 N2 sing Y N 19 A1IMS N2 C13 sing Y N 20 A1IMS C13 C7 doub Y N 21 A1IMS C14 C13 sing N N 22 A1IMS C14 C15 doub Y N 23 A1IMS C15 C16 sing Y N 24 A1IMS C16 N3 doub Y N 25 A1IMS N3 C17 sing Y N 26 A1IMS C17 C18 doub Y N 27 A1IMS C18 C14 sing Y N 28 A1IMS O2 C18 sing N N 29 A1IMS C19 O2 sing N N 30 A1IMS C20 C19 sing N N 31 A1IMS C20 C21 sing N N 32 A1IMS C21 C22 sing N N 33 A1IMS C22 C23 sing N N 34 A1IMS C23 O3 sing N N 35 A1IMS O3 C20 sing N N 36 A1IMS C2 CL sing N N 37 A1IMS C H3 sing N N 38 A1IMS C H4 sing N N 39 A1IMS C H2 sing N N 40 A1IMS N H8 sing N N 41 A1IMS C3 H5 sing N N 42 A1IMS C4 H6 sing N N 43 A1IMS C5 H7 sing N N 44 A1IMS N2 H sing N N 45 A1IMS C10 H10 sing N N 46 A1IMS C10 H9 sing N N 47 A1IMS C11 H12 sing N N 48 A1IMS C11 H11 sing N N 49 A1IMS N1 H13 sing N N 50 A1IMS C17 H16 sing N N 51 A1IMS C16 H15 sing N N 52 A1IMS C15 H14 sing N N 53 A1IMS C19 H17 sing N N 54 A1IMS C19 H18 sing N N 55 A1IMS C20 H1 sing N N 56 A1IMS C23 H24 sing N N 57 A1IMS C23 H23 sing N N 58 A1IMS C22 H22 sing N N 59 A1IMS C22 H21 sing N N 60 A1IMS C21 H20 sing N N 61 A1IMS C21 H19 sing N N 62 ALA N CA sing N N 63 ALA N H sing N N 64 ALA N H2 sing N N 65 ALA CA C sing N N 66 ALA CA CB sing N N 67 ALA CA HA sing N N 68 ALA C O doub N N 69 ALA C OXT sing N N 70 ALA CB HB1 sing N N 71 ALA CB HB2 sing N N 72 ALA CB HB3 sing N N 73 ALA OXT HXT sing N N 74 ARG N CA sing N N 75 ARG N H sing N N 76 ARG N H2 sing N N 77 ARG CA C sing N N 78 ARG CA CB sing N N 79 ARG CA HA sing N N 80 ARG C O doub N N 81 ARG C OXT sing N N 82 ARG CB CG sing N N 83 ARG CB HB2 sing N N 84 ARG CB HB3 sing N N 85 ARG CG CD sing N N 86 ARG CG HG2 sing N N 87 ARG CG HG3 sing N N 88 ARG CD NE sing N N 89 ARG CD HD2 sing N N 90 ARG CD HD3 sing N N 91 ARG NE CZ sing N N 92 ARG NE HE sing N N 93 ARG CZ NH1 sing N N 94 ARG CZ NH2 doub N N 95 ARG NH1 HH11 sing N N 96 ARG NH1 HH12 sing N N 97 ARG NH2 HH21 sing N N 98 ARG NH2 HH22 sing N N 99 ARG OXT HXT sing N N 100 ASN N CA sing N N 101 ASN N H sing N N 102 ASN N H2 sing N N 103 ASN CA C sing N N 104 ASN CA CB sing N N 105 ASN CA HA sing N N 106 ASN C O doub N N 107 ASN C OXT sing N N 108 ASN CB CG sing N N 109 ASN CB HB2 sing N N 110 ASN CB HB3 sing N N 111 ASN CG OD1 doub N N 112 ASN CG ND2 sing N N 113 ASN ND2 HD21 sing N N 114 ASN ND2 HD22 sing N N 115 ASN OXT HXT sing N N 116 ASP N CA sing N N 117 ASP N H sing N N 118 ASP N H2 sing N N 119 ASP CA C sing N N 120 ASP CA CB sing N N 121 ASP CA HA sing N N 122 ASP C O doub N N 123 ASP C OXT sing N N 124 ASP CB CG sing N N 125 ASP CB HB2 sing N N 126 ASP CB HB3 sing N N 127 ASP CG OD1 doub N N 128 ASP CG OD2 sing N N 129 ASP OD2 HD2 sing N N 130 ASP OXT HXT sing N N 131 CYS N CA sing N N 132 CYS N H sing N N 133 CYS N H2 sing N N 134 CYS CA C sing N N 135 CYS CA CB sing N N 136 CYS CA HA sing N N 137 CYS C O doub N N 138 CYS C OXT sing N N 139 CYS CB SG sing N N 140 CYS CB HB2 sing N N 141 CYS CB HB3 sing N N 142 CYS SG HG sing N N 143 CYS OXT HXT sing N N 144 GLN N CA sing N N 145 GLN N H sing N N 146 GLN N H2 sing N N 147 GLN CA C sing N N 148 GLN CA CB sing N N 149 GLN CA HA sing N N 150 GLN C O doub N N 151 GLN C OXT sing N N 152 GLN CB CG sing N N 153 GLN CB HB2 sing N N 154 GLN CB HB3 sing N N 155 GLN CG CD sing N N 156 GLN CG HG2 sing N N 157 GLN CG HG3 sing N N 158 GLN CD OE1 doub N N 159 GLN CD NE2 sing N N 160 GLN NE2 HE21 sing N N 161 GLN NE2 HE22 sing N N 162 GLN OXT HXT sing N N 163 GLU N CA sing N N 164 GLU N H sing N N 165 GLU N H2 sing N N 166 GLU CA C sing N N 167 GLU CA CB sing N N 168 GLU CA HA sing N N 169 GLU C O doub N N 170 GLU C OXT sing N N 171 GLU CB CG sing N N 172 GLU CB HB2 sing N N 173 GLU CB HB3 sing N N 174 GLU CG CD sing N N 175 GLU CG HG2 sing N N 176 GLU CG HG3 sing N N 177 GLU CD OE1 doub N N 178 GLU CD OE2 sing N N 179 GLU OE2 HE2 sing N N 180 GLU OXT HXT sing N N 181 GLY N CA sing N N 182 GLY N H sing N N 183 GLY N H2 sing N N 184 GLY CA C sing N N 185 GLY CA HA2 sing N N 186 GLY CA HA3 sing N N 187 GLY C O doub N N 188 GLY C OXT sing N N 189 GLY OXT HXT sing N N 190 HIS N CA sing N N 191 HIS N H sing N N 192 HIS N H2 sing N N 193 HIS CA C sing N N 194 HIS CA CB sing N N 195 HIS CA HA sing N N 196 HIS C O doub N N 197 HIS C OXT sing N N 198 HIS CB CG sing N N 199 HIS CB HB2 sing N N 200 HIS CB HB3 sing N N 201 HIS CG ND1 sing Y N 202 HIS CG CD2 doub Y N 203 HIS ND1 CE1 doub Y N 204 HIS ND1 HD1 sing N N 205 HIS CD2 NE2 sing Y N 206 HIS CD2 HD2 sing N N 207 HIS CE1 NE2 sing Y N 208 HIS CE1 HE1 sing N N 209 HIS NE2 HE2 sing N N 210 HIS OXT HXT sing N N 211 HOH O H1 sing N N 212 HOH O H2 sing N N 213 ILE N CA sing N N 214 ILE N H sing N N 215 ILE N H2 sing N N 216 ILE CA C sing N N 217 ILE CA CB sing N N 218 ILE CA HA sing N N 219 ILE C O doub N N 220 ILE C OXT sing N N 221 ILE CB CG1 sing N N 222 ILE CB CG2 sing N N 223 ILE CB HB sing N N 224 ILE CG1 CD1 sing N N 225 ILE CG1 HG12 sing N N 226 ILE CG1 HG13 sing N N 227 ILE CG2 HG21 sing N N 228 ILE CG2 HG22 sing N N 229 ILE CG2 HG23 sing N N 230 ILE CD1 HD11 sing N N 231 ILE CD1 HD12 sing N N 232 ILE CD1 HD13 sing N N 233 ILE OXT HXT sing N N 234 LEU N CA sing N N 235 LEU N H sing N N 236 LEU N H2 sing N N 237 LEU CA C sing N N 238 LEU CA CB sing N N 239 LEU CA HA sing N N 240 LEU C O doub N N 241 LEU C OXT sing N N 242 LEU CB CG sing N N 243 LEU CB HB2 sing N N 244 LEU CB HB3 sing N N 245 LEU CG CD1 sing N N 246 LEU CG CD2 sing N N 247 LEU CG HG sing N N 248 LEU CD1 HD11 sing N N 249 LEU CD1 HD12 sing N N 250 LEU CD1 HD13 sing N N 251 LEU CD2 HD21 sing N N 252 LEU CD2 HD22 sing N N 253 LEU CD2 HD23 sing N N 254 LEU OXT HXT sing N N 255 LYS N CA sing N N 256 LYS N H sing N N 257 LYS N H2 sing N N 258 LYS CA C sing N N 259 LYS CA CB sing N N 260 LYS CA HA sing N N 261 LYS C O doub N N 262 LYS C OXT sing N N 263 LYS CB CG sing N N 264 LYS CB HB2 sing N N 265 LYS CB HB3 sing N N 266 LYS CG CD sing N N 267 LYS CG HG2 sing N N 268 LYS CG HG3 sing N N 269 LYS CD CE sing N N 270 LYS CD HD2 sing N N 271 LYS CD HD3 sing N N 272 LYS CE NZ sing N N 273 LYS CE HE2 sing N N 274 LYS CE HE3 sing N N 275 LYS NZ HZ1 sing N N 276 LYS NZ HZ2 sing N N 277 LYS NZ HZ3 sing N N 278 LYS OXT HXT sing N N 279 MET N CA sing N N 280 MET N H sing N N 281 MET N H2 sing N N 282 MET CA C sing N N 283 MET CA CB sing N N 284 MET CA HA sing N N 285 MET C O doub N N 286 MET C OXT sing N N 287 MET CB CG sing N N 288 MET CB HB2 sing N N 289 MET CB HB3 sing N N 290 MET CG SD sing N N 291 MET CG HG2 sing N N 292 MET CG HG3 sing N N 293 MET SD CE sing N N 294 MET CE HE1 sing N N 295 MET CE HE2 sing N N 296 MET CE HE3 sing N N 297 MET OXT HXT sing N N 298 PHE N CA sing N N 299 PHE N H sing N N 300 PHE N H2 sing N N 301 PHE CA C sing N N 302 PHE CA CB sing N N 303 PHE CA HA sing N N 304 PHE C O doub N N 305 PHE C OXT sing N N 306 PHE CB CG sing N N 307 PHE CB HB2 sing N N 308 PHE CB HB3 sing N N 309 PHE CG CD1 doub Y N 310 PHE CG CD2 sing Y N 311 PHE CD1 CE1 sing Y N 312 PHE CD1 HD1 sing N N 313 PHE CD2 CE2 doub Y N 314 PHE CD2 HD2 sing N N 315 PHE CE1 CZ doub Y N 316 PHE CE1 HE1 sing N N 317 PHE CE2 CZ sing Y N 318 PHE CE2 HE2 sing N N 319 PHE CZ HZ sing N N 320 PHE OXT HXT sing N N 321 PRO N CA sing N N 322 PRO N CD sing N N 323 PRO N H sing N N 324 PRO CA C sing N N 325 PRO CA CB sing N N 326 PRO CA HA sing N N 327 PRO C O doub N N 328 PRO C OXT sing N N 329 PRO CB CG sing N N 330 PRO CB HB2 sing N N 331 PRO CB HB3 sing N N 332 PRO CG CD sing N N 333 PRO CG HG2 sing N N 334 PRO CG HG3 sing N N 335 PRO CD HD2 sing N N 336 PRO CD HD3 sing N N 337 PRO OXT HXT sing N N 338 SER N CA sing N N 339 SER N H sing N N 340 SER N H2 sing N N 341 SER CA C sing N N 342 SER CA CB sing N N 343 SER CA HA sing N N 344 SER C O doub N N 345 SER C OXT sing N N 346 SER CB OG sing N N 347 SER CB HB2 sing N N 348 SER CB HB3 sing N N 349 SER OG HG sing N N 350 SER OXT HXT sing N N 351 THR N CA sing N N 352 THR N H sing N N 353 THR N H2 sing N N 354 THR CA C sing N N 355 THR CA CB sing N N 356 THR CA HA sing N N 357 THR C O doub N N 358 THR C OXT sing N N 359 THR CB OG1 sing N N 360 THR CB CG2 sing N N 361 THR CB HB sing N N 362 THR OG1 HG1 sing N N 363 THR CG2 HG21 sing N N 364 THR CG2 HG22 sing N N 365 THR CG2 HG23 sing N N 366 THR OXT HXT sing N N 367 TRP N CA sing N N 368 TRP N H sing N N 369 TRP N H2 sing N N 370 TRP CA C sing N N 371 TRP CA CB sing N N 372 TRP CA HA sing N N 373 TRP C O doub N N 374 TRP C OXT sing N N 375 TRP CB CG sing N N 376 TRP CB HB2 sing N N 377 TRP CB HB3 sing N N 378 TRP CG CD1 doub Y N 379 TRP CG CD2 sing Y N 380 TRP CD1 NE1 sing Y N 381 TRP CD1 HD1 sing N N 382 TRP CD2 CE2 doub Y N 383 TRP CD2 CE3 sing Y N 384 TRP NE1 CE2 sing Y N 385 TRP NE1 HE1 sing N N 386 TRP CE2 CZ2 sing Y N 387 TRP CE3 CZ3 doub Y N 388 TRP CE3 HE3 sing N N 389 TRP CZ2 CH2 doub Y N 390 TRP CZ2 HZ2 sing N N 391 TRP CZ3 CH2 sing Y N 392 TRP CZ3 HZ3 sing N N 393 TRP CH2 HH2 sing N N 394 TRP OXT HXT sing N N 395 TYR N CA sing N N 396 TYR N H sing N N 397 TYR N H2 sing N N 398 TYR CA C sing N N 399 TYR CA CB sing N N 400 TYR CA HA sing N N 401 TYR C O doub N N 402 TYR C OXT sing N N 403 TYR CB CG sing N N 404 TYR CB HB2 sing N N 405 TYR CB HB3 sing N N 406 TYR CG CD1 doub Y N 407 TYR CG CD2 sing Y N 408 TYR CD1 CE1 sing Y N 409 TYR CD1 HD1 sing N N 410 TYR CD2 CE2 doub Y N 411 TYR CD2 HD2 sing N N 412 TYR CE1 CZ doub Y N 413 TYR CE1 HE1 sing N N 414 TYR CE2 CZ sing Y N 415 TYR CE2 HE2 sing N N 416 TYR CZ OH sing N N 417 TYR OH HH sing N N 418 TYR OXT HXT sing N N 419 VAL N CA sing N N 420 VAL N H sing N N 421 VAL N H2 sing N N 422 VAL CA C sing N N 423 VAL CA CB sing N N 424 VAL CA HA sing N N 425 VAL C O doub N N 426 VAL C OXT sing N N 427 VAL CB CG1 sing N N 428 VAL CB CG2 sing N N 429 VAL CB HB sing N N 430 VAL CG1 HG11 sing N N 431 VAL CG1 HG12 sing N N 432 VAL CG1 HG13 sing N N 433 VAL CG2 HG21 sing N N 434 VAL CG2 HG22 sing N N 435 VAL CG2 HG23 sing N N 436 VAL OXT HXT sing N N 437 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'Unpublished model' # _atom_sites.entry_id 9GL7 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.025161 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009453 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005732 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL H N O S # loop_ # loop_ #