data_9HGU # _entry.id 9HGU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.407 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9HGU pdb_00009hgu 10.2210/pdb9hgu/pdb WWPDB D_1292143306 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-12-03 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9HGU _pdbx_database_status.recvd_initial_deposition_date 2024-11-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 2 _pdbx_contact_author.email roman.jakob@unibas.ch _pdbx_contact_author.name_first Roman _pdbx_contact_author.name_last Jakob _pdbx_contact_author.name_mi P. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-6451-8656 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jakob, R.P.' 1 0000-0002-6451-8656 'Ernst, B.' 2 0000-0001-5787-2297 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'E-selectin complexed with glycomimetic ligand BW990' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jakob, R.P.' 1 0000-0002-6451-8656 primary 'Ernst, B.' 2 0000-0001-5787-2297 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man E-selectin 31305.760 1 ? ? ? ? 2 non-polymer syn 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208 7 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? 4 non-polymer syn ;(2~{S})-3-cyclohexyl-2-[(2~{R},3~{S},4~{S},5~{R},6~{R})-2-(hydroxymethyl)-6-[(1~{R},2~{R})-2-[(2~{S},3~{S},4~{R},5~{S},6~{S})-6-methyl-3,4,5-tris(oxidanyl)oxan-2-yl]oxycyclohexyl]oxy-3,5-bis(oxidanyl)oxan-4-yl]oxy-~{N},~{N}-dimethyl-propanamide ; 605.715 1 ? ? ? ? 5 water nat water 18.015 22 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;CD62 antigen-like family member E,Endothelial leukocyte adhesion molecule 1,ELAM-1,Leukocyte-endothelial cell adhesion molecule 2,LECAM2 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGE PNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCT ALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGS FPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKA ; _entity_poly.pdbx_seq_one_letter_code_can ;WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGE PNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCT ALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGS FPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 3 'CALCIUM ION' CA 4 ;(2~{S})-3-cyclohexyl-2-[(2~{R},3~{S},4~{S},5~{R},6~{R})-2-(hydroxymethyl)-6-[(1~{R},2~{R})-2-[(2~{S},3~{S},4~{R},5~{S},6~{S})-6-methyl-3,4,5-tris(oxidanyl)oxan-2-yl]oxycyclohexyl]oxy-3,5-bis(oxidanyl)oxan-4-yl]oxy-~{N},~{N}-dimethyl-propanamide ; A1IUQ 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 TRP n 1 2 SER n 1 3 TYR n 1 4 ASN n 1 5 THR n 1 6 SER n 1 7 THR n 1 8 GLU n 1 9 ALA n 1 10 MET n 1 11 THR n 1 12 TYR n 1 13 ASP n 1 14 GLU n 1 15 ALA n 1 16 SER n 1 17 ALA n 1 18 TYR n 1 19 CYS n 1 20 GLN n 1 21 GLN n 1 22 ARG n 1 23 TYR n 1 24 THR n 1 25 HIS n 1 26 LEU n 1 27 VAL n 1 28 ALA n 1 29 ILE n 1 30 GLN n 1 31 ASN n 1 32 LYS n 1 33 GLU n 1 34 GLU n 1 35 ILE n 1 36 GLU n 1 37 TYR n 1 38 LEU n 1 39 ASN n 1 40 SER n 1 41 ILE n 1 42 LEU n 1 43 SER n 1 44 TYR n 1 45 SER n 1 46 PRO n 1 47 SER n 1 48 TYR n 1 49 TYR n 1 50 TRP n 1 51 ILE n 1 52 GLY n 1 53 ILE n 1 54 ARG n 1 55 LYS n 1 56 VAL n 1 57 ASN n 1 58 ASN n 1 59 VAL n 1 60 TRP n 1 61 VAL n 1 62 TRP n 1 63 VAL n 1 64 GLY n 1 65 THR n 1 66 GLN n 1 67 LYS n 1 68 PRO n 1 69 LEU n 1 70 THR n 1 71 GLU n 1 72 GLU n 1 73 ALA n 1 74 LYS n 1 75 ASN n 1 76 TRP n 1 77 ALA n 1 78 PRO n 1 79 GLY n 1 80 GLU n 1 81 PRO n 1 82 ASN n 1 83 ASN n 1 84 ARG n 1 85 GLN n 1 86 LYS n 1 87 ASP n 1 88 GLU n 1 89 ASP n 1 90 CYS n 1 91 VAL n 1 92 GLU n 1 93 ILE n 1 94 TYR n 1 95 ILE n 1 96 LYS n 1 97 ARG n 1 98 GLU n 1 99 LYS n 1 100 ASP n 1 101 VAL n 1 102 GLY n 1 103 MET n 1 104 TRP n 1 105 ASN n 1 106 ASP n 1 107 GLU n 1 108 ARG n 1 109 CYS n 1 110 SER n 1 111 LYS n 1 112 LYS n 1 113 LYS n 1 114 LEU n 1 115 ALA n 1 116 LEU n 1 117 CYS n 1 118 TYR n 1 119 THR n 1 120 ALA n 1 121 ALA n 1 122 CYS n 1 123 THR n 1 124 ASN n 1 125 THR n 1 126 SER n 1 127 CYS n 1 128 SER n 1 129 GLY n 1 130 HIS n 1 131 GLY n 1 132 GLU n 1 133 CYS n 1 134 VAL n 1 135 GLU n 1 136 THR n 1 137 ILE n 1 138 ASN n 1 139 ASN n 1 140 TYR n 1 141 THR n 1 142 CYS n 1 143 LYS n 1 144 CYS n 1 145 ASP n 1 146 PRO n 1 147 GLY n 1 148 PHE n 1 149 SER n 1 150 GLY n 1 151 LEU n 1 152 LYS n 1 153 CYS n 1 154 GLU n 1 155 GLN n 1 156 ILE n 1 157 VAL n 1 158 ASN n 1 159 CYS n 1 160 THR n 1 161 ALA n 1 162 LEU n 1 163 GLU n 1 164 SER n 1 165 PRO n 1 166 GLU n 1 167 HIS n 1 168 GLY n 1 169 SER n 1 170 LEU n 1 171 VAL n 1 172 CYS n 1 173 SER n 1 174 HIS n 1 175 PRO n 1 176 LEU n 1 177 GLY n 1 178 ASN n 1 179 PHE n 1 180 SER n 1 181 TYR n 1 182 ASN n 1 183 SER n 1 184 SER n 1 185 CYS n 1 186 SER n 1 187 ILE n 1 188 SER n 1 189 CYS n 1 190 ASP n 1 191 ARG n 1 192 GLY n 1 193 TYR n 1 194 LEU n 1 195 PRO n 1 196 SER n 1 197 SER n 1 198 MET n 1 199 GLU n 1 200 THR n 1 201 MET n 1 202 GLN n 1 203 CYS n 1 204 MET n 1 205 SER n 1 206 SER n 1 207 GLY n 1 208 GLU n 1 209 TRP n 1 210 SER n 1 211 ALA n 1 212 PRO n 1 213 ILE n 1 214 PRO n 1 215 ALA n 1 216 CYS n 1 217 ASN n 1 218 VAL n 1 219 VAL n 1 220 GLU n 1 221 CYS n 1 222 ASP n 1 223 ALA n 1 224 VAL n 1 225 THR n 1 226 ASN n 1 227 PRO n 1 228 ALA n 1 229 ASN n 1 230 GLY n 1 231 PHE n 1 232 VAL n 1 233 GLU n 1 234 CYS n 1 235 PHE n 1 236 GLN n 1 237 ASN n 1 238 PRO n 1 239 GLY n 1 240 SER n 1 241 PHE n 1 242 PRO n 1 243 TRP n 1 244 ASN n 1 245 THR n 1 246 THR n 1 247 CYS n 1 248 THR n 1 249 PHE n 1 250 ASP n 1 251 CYS n 1 252 GLU n 1 253 GLU n 1 254 GLY n 1 255 PHE n 1 256 GLU n 1 257 LEU n 1 258 MET n 1 259 GLY n 1 260 ALA n 1 261 GLN n 1 262 SER n 1 263 LEU n 1 264 GLN n 1 265 CYS n 1 266 THR n 1 267 SER n 1 268 SER n 1 269 GLY n 1 270 ASN n 1 271 TRP n 1 272 ASP n 1 273 ASN n 1 274 GLU n 1 275 LYS n 1 276 PRO n 1 277 THR n 1 278 CYS n 1 279 LYS n 1 280 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 280 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SELE, ELAM1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Cricetulus griseus' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 10029 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line 'CHO cells' _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1IUQ non-polymer . ;(2~{S})-3-cyclohexyl-2-[(2~{R},3~{S},4~{S},5~{R},6~{R})-2-(hydroxymethyl)-6-[(1~{R},2~{R})-2-[(2~{S},3~{S},4~{R},5~{S},6~{S})-6-methyl-3,4,5-tris(oxidanyl)oxan-2-yl]oxycyclohexyl]oxy-3,5-bis(oxidanyl)oxan-4-yl]oxy-~{N},~{N}-dimethyl-propanamide ; ? 'C29 H51 N O12' 605.715 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 TRP 1 1 1 TRP TRP A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 MET 10 10 10 MET MET A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 HIS 25 25 25 HIS HIS A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 TRP 50 50 50 TRP TRP A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 TRP 60 60 60 TRP TRP A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 TRP 62 62 62 TRP TRP A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 GLN 66 66 66 GLN GLN A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 TRP 76 76 76 TRP TRP A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 PRO 78 78 78 PRO PRO A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 ARG 84 84 84 ARG ARG A . n A 1 85 GLN 85 85 85 GLN GLN A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 CYS 90 90 90 CYS CYS A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 TYR 94 94 94 TYR TYR A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 MET 103 103 103 MET MET A . n A 1 104 TRP 104 104 104 TRP TRP A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 ARG 108 108 108 ARG ARG A . n A 1 109 CYS 109 109 109 CYS CYS A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 CYS 117 117 117 CYS CYS A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 ALA 120 120 120 ALA ALA A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 CYS 122 122 122 CYS CYS A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 SER 126 126 126 SER SER A . n A 1 127 CYS 127 127 127 CYS CYS A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 HIS 130 130 130 HIS HIS A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 CYS 133 133 133 CYS CYS A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 THR 136 136 136 THR THR A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 ASN 138 138 138 ASN ASN A . n A 1 139 ASN 139 139 139 ASN ASN A . n A 1 140 TYR 140 140 140 TYR TYR A . n A 1 141 THR 141 141 141 THR THR A . n A 1 142 CYS 142 142 142 CYS CYS A . n A 1 143 LYS 143 143 143 LYS LYS A . n A 1 144 CYS 144 144 144 CYS CYS A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 PRO 146 146 146 PRO PRO A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 PHE 148 148 148 PHE PHE A . n A 1 149 SER 149 149 149 SER SER A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 CYS 153 153 153 CYS CYS A . n A 1 154 GLU 154 154 154 GLU GLU A . n A 1 155 GLN 155 155 155 GLN GLN A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 VAL 157 157 157 VAL VAL A . n A 1 158 ASN 158 158 158 ASN ASN A . n A 1 159 CYS 159 159 159 CYS CYS A . n A 1 160 THR 160 160 160 THR THR A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 SER 164 164 164 SER SER A . n A 1 165 PRO 165 165 165 PRO PRO A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 HIS 167 167 167 HIS HIS A . n A 1 168 GLY 168 168 168 GLY GLY A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 VAL 171 171 171 VAL VAL A . n A 1 172 CYS 172 172 172 CYS CYS A . n A 1 173 SER 173 173 173 SER SER A . n A 1 174 HIS 174 174 174 HIS HIS A . n A 1 175 PRO 175 175 175 PRO PRO A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 GLY 177 177 177 GLY GLY A . n A 1 178 ASN 178 178 178 ASN ASN A . n A 1 179 PHE 179 179 179 PHE PHE A . n A 1 180 SER 180 180 180 SER SER A . n A 1 181 TYR 181 181 181 TYR TYR A . n A 1 182 ASN 182 182 182 ASN ASN A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 SER 184 184 184 SER SER A . n A 1 185 CYS 185 185 185 CYS CYS A . n A 1 186 SER 186 186 186 SER SER A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 SER 188 188 188 SER SER A . n A 1 189 CYS 189 189 189 CYS CYS A . n A 1 190 ASP 190 190 190 ASP ASP A . n A 1 191 ARG 191 191 191 ARG ARG A . n A 1 192 GLY 192 192 192 GLY GLY A . n A 1 193 TYR 193 193 193 TYR TYR A . n A 1 194 LEU 194 194 194 LEU LEU A . n A 1 195 PRO 195 195 195 PRO PRO A . n A 1 196 SER 196 196 196 SER SER A . n A 1 197 SER 197 197 197 SER SER A . n A 1 198 MET 198 198 198 MET MET A . n A 1 199 GLU 199 199 199 GLU GLU A . n A 1 200 THR 200 200 200 THR THR A . n A 1 201 MET 201 201 201 MET MET A . n A 1 202 GLN 202 202 202 GLN GLN A . n A 1 203 CYS 203 203 203 CYS CYS A . n A 1 204 MET 204 204 204 MET MET A . n A 1 205 SER 205 205 205 SER SER A . n A 1 206 SER 206 206 206 SER SER A . n A 1 207 GLY 207 207 207 GLY GLY A . n A 1 208 GLU 208 208 208 GLU GLU A . n A 1 209 TRP 209 209 209 TRP TRP A . n A 1 210 SER 210 210 210 SER SER A . n A 1 211 ALA 211 211 211 ALA ALA A . n A 1 212 PRO 212 212 212 PRO PRO A . n A 1 213 ILE 213 213 213 ILE ILE A . n A 1 214 PRO 214 214 214 PRO PRO A . n A 1 215 ALA 215 215 215 ALA ALA A . n A 1 216 CYS 216 216 216 CYS CYS A . n A 1 217 ASN 217 217 217 ASN ASN A . n A 1 218 VAL 218 218 218 VAL VAL A . n A 1 219 VAL 219 219 219 VAL VAL A . n A 1 220 GLU 220 220 220 GLU GLU A . n A 1 221 CYS 221 221 221 CYS CYS A . n A 1 222 ASP 222 222 222 ASP ASP A . n A 1 223 ALA 223 223 223 ALA ALA A . n A 1 224 VAL 224 224 224 VAL VAL A . n A 1 225 THR 225 225 225 THR THR A . n A 1 226 ASN 226 226 226 ASN ASN A . n A 1 227 PRO 227 227 227 PRO PRO A . n A 1 228 ALA 228 228 228 ALA ALA A . n A 1 229 ASN 229 229 229 ASN ASN A . n A 1 230 GLY 230 230 230 GLY GLY A . n A 1 231 PHE 231 231 231 PHE PHE A . n A 1 232 VAL 232 232 232 VAL VAL A . n A 1 233 GLU 233 233 233 GLU GLU A . n A 1 234 CYS 234 234 234 CYS CYS A . n A 1 235 PHE 235 235 235 PHE PHE A . n A 1 236 GLN 236 236 236 GLN GLN A . n A 1 237 ASN 237 237 237 ASN ASN A . n A 1 238 PRO 238 238 238 PRO PRO A . n A 1 239 GLY 239 239 239 GLY GLY A . n A 1 240 SER 240 240 240 SER SER A . n A 1 241 PHE 241 241 241 PHE PHE A . n A 1 242 PRO 242 242 242 PRO PRO A . n A 1 243 TRP 243 243 243 TRP TRP A . n A 1 244 ASN 244 244 244 ASN ASN A . n A 1 245 THR 245 245 245 THR THR A . n A 1 246 THR 246 246 246 THR THR A . n A 1 247 CYS 247 247 247 CYS CYS A . n A 1 248 THR 248 248 248 THR THR A . n A 1 249 PHE 249 249 249 PHE PHE A . n A 1 250 ASP 250 250 250 ASP ASP A . n A 1 251 CYS 251 251 251 CYS CYS A . n A 1 252 GLU 252 252 252 GLU GLU A . n A 1 253 GLU 253 253 253 GLU GLU A . n A 1 254 GLY 254 254 254 GLY GLY A . n A 1 255 PHE 255 255 255 PHE PHE A . n A 1 256 GLU 256 256 256 GLU GLU A . n A 1 257 LEU 257 257 257 LEU LEU A . n A 1 258 MET 258 258 258 MET MET A . n A 1 259 GLY 259 259 259 GLY GLY A . n A 1 260 ALA 260 260 260 ALA ALA A . n A 1 261 GLN 261 261 261 GLN GLN A . n A 1 262 SER 262 262 262 SER SER A . n A 1 263 LEU 263 263 263 LEU LEU A . n A 1 264 GLN 264 264 264 GLN GLN A . n A 1 265 CYS 265 265 265 CYS CYS A . n A 1 266 THR 266 266 266 THR THR A . n A 1 267 SER 267 267 267 SER SER A . n A 1 268 SER 268 268 268 SER SER A . n A 1 269 GLY 269 269 269 GLY GLY A . n A 1 270 ASN 270 270 270 ASN ASN A . n A 1 271 TRP 271 271 271 TRP TRP A . n A 1 272 ASP 272 272 272 ASP ASP A . n A 1 273 ASN 273 273 273 ASN ASN A . n A 1 274 GLU 274 274 274 GLU GLU A . n A 1 275 LYS 275 275 275 LYS LYS A . n A 1 276 PRO 276 276 276 PRO PRO A . n A 1 277 THR 277 277 277 THR THR A . n A 1 278 CYS 278 278 278 CYS CYS A . n A 1 279 LYS 279 279 279 LYS LYS A . n A 1 280 ALA 280 280 280 ALA ALA A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1IUQ _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1IUQ _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NAG 1 301 281 NAG NAG A . C 2 NAG 1 302 282 NAG NAG A . D 2 NAG 1 303 283 NAG NAG A . E 2 NAG 1 304 284 NAG NAG A . F 2 NAG 1 305 285 NAG NAG A . G 2 NAG 1 306 286 NAG NAG A . H 2 NAG 1 307 287 NAG NAG A . I 3 CA 1 308 302 CA CA A . J 3 CA 1 309 303 CA CA A . K 4 A1IUQ 1 310 1 A1IUQ DRG A . L 5 HOH 1 401 81 HOH HOH A . L 5 HOH 2 402 177 HOH HOH A . L 5 HOH 3 403 193 HOH HOH A . L 5 HOH 4 404 246 HOH HOH A . L 5 HOH 5 405 130 HOH HOH A . L 5 HOH 6 406 75 HOH HOH A . L 5 HOH 7 407 73 HOH HOH A . L 5 HOH 8 408 221 HOH HOH A . L 5 HOH 9 409 9 HOH HOH A . L 5 HOH 10 410 55 HOH HOH A . L 5 HOH 11 411 51 HOH HOH A . L 5 HOH 12 412 7 HOH HOH A . L 5 HOH 13 413 4 HOH HOH A . L 5 HOH 14 414 29 HOH HOH A . L 5 HOH 15 415 106 HOH HOH A . L 5 HOH 16 416 141 HOH HOH A . L 5 HOH 17 417 87 HOH HOH A . L 5 HOH 18 418 63 HOH HOH A . L 5 HOH 19 419 56 HOH HOH A . L 5 HOH 20 420 143 HOH HOH A . L 5 HOH 21 421 194 HOH HOH A . L 5 HOH 22 422 172 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.21rc1_5127: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 94.12 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9HGU _cell.details ? _cell.formula_units_Z ? _cell.length_a 92.740 _cell.length_a_esd ? _cell.length_b 72.820 _cell.length_b_esd ? _cell.length_c 52.340 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9HGU _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9HGU _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.82 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 56.31 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.2 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M CaCl2, 0.1 M Mops pH 6.2, 11-14% PEG8000, after microseeding' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-04-14 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.999988 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.999988 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate 60.9 _reflns.entry_id 9HGU _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.3 _reflns.d_resolution_low 57.22 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15051 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.2 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.049 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.058 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.3 _reflns_shell.d_res_low 2.4 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.8 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1848 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.2 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.89 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.53 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 95.7 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.07 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9HGU _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.30 _refine.ls_d_res_low 57.22 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15051 _refine.ls_number_reflns_R_free 1182 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.81 _refine.ls_percent_reflns_R_free 7.85 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2313 _refine.ls_R_factor_R_free 0.2694 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2280 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 38.67 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.41 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2179 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 142 _refine_hist.number_atoms_solvent 22 _refine_hist.number_atoms_total 2343 _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 57.22 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.004 ? 2374 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.783 ? 3233 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 20.493 ? 836 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.045 ? 369 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 407 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.30 2.40 . . 123 1725 96.00 . . . . 0.3968 . . . . . . . . . . . 0.4750 'X-RAY DIFFRACTION' 2.40 2.53 . . 144 1712 96.00 . . . . 0.3377 . . . . . . . . . . . 0.4386 'X-RAY DIFFRACTION' 2.53 2.69 . . 143 1706 95.00 . . . . 0.3283 . . . . . . . . . . . 0.3792 'X-RAY DIFFRACTION' 2.69 2.90 . . 171 1728 98.00 . . . . 0.3044 . . . . . . . . . . . 0.3428 'X-RAY DIFFRACTION' 2.90 3.19 . . 126 1765 98.00 . . . . 0.2678 . . . . . . . . . . . 0.3455 'X-RAY DIFFRACTION' 3.19 3.65 . . 163 1715 97.00 . . . . 0.2455 . . . . . . . . . . . 0.2888 'X-RAY DIFFRACTION' 3.65 4.60 . . 151 1731 97.00 . . . . 0.1909 . . . . . . . . . . . 0.2261 'X-RAY DIFFRACTION' 4.60 57.22 . . 161 1787 97.00 . . . . 0.1894 . . . . . . . . . . . 0.2197 # _struct.entry_id 9HGU _struct.title 'E-selectin complexed with glycomimetic ligand BW990' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9HGU _struct_keywords.text 'selectin, glycomimetic, CELL ADHESION' _struct_keywords.pdbx_keywords 'CELL ADHESION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? I N N 3 ? J N N 3 ? K N N 4 ? L N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LYAM2_HUMAN _struct_ref.pdbx_db_accession P16581 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGE PNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCT ALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGS FPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKA ; _struct_ref.pdbx_align_begin 22 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9HGU _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 280 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P16581 _struct_ref_seq.db_align_beg 22 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 301 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 280 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1670 ? 1 MORE 17 ? 1 'SSA (A^2)' 17640 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 11 ? ARG A 22 ? THR A 11 ARG A 22 1 ? 12 HELX_P HELX_P2 AA2 ASN A 31 ? LEU A 42 ? ASN A 31 LEU A 42 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 19 SG ? ? ? 1_555 A CYS 117 SG ? ? A CYS 19 A CYS 117 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf2 disulf ? ? A CYS 90 SG ? ? ? 1_555 A CYS 109 SG ? ? A CYS 90 A CYS 109 1_555 ? ? ? ? ? ? ? 2.043 ? ? disulf3 disulf ? ? A CYS 122 SG ? ? ? 1_555 A CYS 133 SG ? ? A CYS 122 A CYS 133 1_555 ? ? ? ? ? ? ? 2.042 ? ? disulf4 disulf ? ? A CYS 127 SG ? ? ? 1_555 A CYS 142 SG ? ? A CYS 127 A CYS 142 1_555 ? ? ? ? ? ? ? 2.044 ? ? disulf5 disulf ? ? A CYS 144 SG ? ? ? 1_555 A CYS 153 SG ? ? A CYS 144 A CYS 153 1_555 ? ? ? ? ? ? ? 2.040 ? ? disulf6 disulf ? ? A CYS 159 SG ? ? ? 1_555 A CYS 203 SG ? ? A CYS 159 A CYS 203 1_555 ? ? ? ? ? ? ? 2.036 ? ? disulf7 disulf ? ? A CYS 172 SG ? ? ? 1_555 A CYS 185 SG ? ? A CYS 172 A CYS 185 1_555 ? ? ? ? ? ? ? 2.040 ? ? disulf8 disulf ? ? A CYS 189 SG ? ? ? 1_555 A CYS 216 SG ? ? A CYS 189 A CYS 216 1_555 ? ? ? ? ? ? ? 2.047 ? ? disulf9 disulf ? ? A CYS 221 SG ? ? ? 1_555 A CYS 265 SG ? ? A CYS 221 A CYS 265 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf10 disulf ? ? A CYS 234 SG ? ? ? 1_555 A CYS 247 SG ? ? A CYS 234 A CYS 247 1_555 ? ? ? ? ? ? ? 2.049 ? ? disulf11 disulf ? ? A CYS 251 SG ? ? ? 1_555 A CYS 278 SG ? ? A CYS 251 A CYS 278 1_555 ? ? ? ? ? ? ? 2.032 ? ? covale1 covale one ? A ASN 4 ND2 ? ? ? 1_555 F NAG . C1 ? ? A ASN 4 A NAG 305 1_555 ? ? ? ? ? ? ? 1.443 ? N-Glycosylation covale2 covale one ? A ASN 124 ND2 ? ? ? 1_555 G NAG . C1 ? ? A ASN 124 A NAG 306 1_555 ? ? ? ? ? ? ? 1.442 ? N-Glycosylation covale3 covale one ? A ASN 139 ND2 ? ? ? 1_555 C NAG . C1 ? ? A ASN 139 A NAG 302 1_555 ? ? ? ? ? ? ? 1.444 ? N-Glycosylation covale4 covale one ? A ASN 158 ND2 ? ? ? 1_555 D NAG . C1 ? ? A ASN 158 A NAG 303 1_555 ? ? ? ? ? ? ? 1.440 ? N-Glycosylation covale5 covale one ? A ASN 178 ND2 ? ? ? 1_555 E NAG . C1 ? ? A ASN 178 A NAG 304 1_555 ? ? ? ? ? ? ? 1.436 ? N-Glycosylation covale6 covale one ? A ASN 182 ND2 ? ? ? 1_555 B NAG . C1 ? ? A ASN 182 A NAG 301 1_555 ? ? ? ? ? ? ? 1.439 ? N-Glycosylation covale7 covale one ? A ASN 244 ND2 ? ? ? 1_555 H NAG . C1 ? ? A ASN 244 A NAG 307 1_555 ? ? ? ? ? ? ? 1.436 ? N-Glycosylation metalc1 metalc ? ? A GLU 80 OE1 ? ? ? 1_555 I CA . CA ? ? A GLU 80 A CA 308 1_555 ? ? ? ? ? ? ? 2.712 ? ? metalc2 metalc ? ? A ASN 82 OD1 ? ? ? 1_555 I CA . CA ? ? A ASN 82 A CA 308 1_555 ? ? ? ? ? ? ? 2.336 ? ? metalc3 metalc ? ? A GLU 88 OE1 ? ? ? 1_555 I CA . CA ? ? A GLU 88 A CA 308 1_555 ? ? ? ? ? ? ? 2.934 ? ? metalc4 metalc ? ? A ASN 105 OD1 ? ? ? 1_555 I CA . CA ? ? A ASN 105 A CA 308 1_555 ? ? ? ? ? ? ? 2.431 ? ? metalc5 metalc ? ? A ASP 106 O ? ? ? 1_555 I CA . CA ? ? A ASP 106 A CA 308 1_555 ? ? ? ? ? ? ? 2.565 ? ? metalc6 metalc ? ? A ASP 106 OD1 ? ? ? 1_555 I CA . CA ? ? A ASP 106 A CA 308 1_555 ? ? ? ? ? ? ? 2.361 ? ? metalc7 metalc ? ? A GLY 168 O ? ? ? 1_555 J CA . CA ? ? A GLY 168 A CA 309 1_555 ? ? ? ? ? ? ? 2.690 ? ? metalc8 metalc ? ? I CA . CA ? ? ? 1_555 K A1IUQ . OBM ? ? A CA 308 A A1IUQ 310 1_555 ? ? ? ? ? ? ? 2.556 ? ? metalc9 metalc ? ? I CA . CA ? ? ? 1_555 K A1IUQ . OBO ? ? A CA 308 A A1IUQ 310 1_555 ? ? ? ? ? ? ? 2.338 ? ? metalc10 metalc ? ? J CA . CA ? ? ? 1_555 L HOH . O ? ? A CA 309 A HOH 419 1_555 ? ? ? ? ? ? ? 2.614 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 80 ? A GLU 80 ? 1_555 CA ? I CA . ? A CA 308 ? 1_555 OD1 ? A ASN 82 ? A ASN 82 ? 1_555 75.9 ? 2 OE1 ? A GLU 80 ? A GLU 80 ? 1_555 CA ? I CA . ? A CA 308 ? 1_555 OE1 ? A GLU 88 ? A GLU 88 ? 1_555 138.6 ? 3 OD1 ? A ASN 82 ? A ASN 82 ? 1_555 CA ? I CA . ? A CA 308 ? 1_555 OE1 ? A GLU 88 ? A GLU 88 ? 1_555 67.5 ? 4 OE1 ? A GLU 80 ? A GLU 80 ? 1_555 CA ? I CA . ? A CA 308 ? 1_555 OD1 ? A ASN 105 ? A ASN 105 ? 1_555 69.3 ? 5 OD1 ? A ASN 82 ? A ASN 82 ? 1_555 CA ? I CA . ? A CA 308 ? 1_555 OD1 ? A ASN 105 ? A ASN 105 ? 1_555 145.2 ? 6 OE1 ? A GLU 88 ? A GLU 88 ? 1_555 CA ? I CA . ? A CA 308 ? 1_555 OD1 ? A ASN 105 ? A ASN 105 ? 1_555 144.5 ? 7 OE1 ? A GLU 80 ? A GLU 80 ? 1_555 CA ? I CA . ? A CA 308 ? 1_555 O ? A ASP 106 ? A ASP 106 ? 1_555 125.7 ? 8 OD1 ? A ASN 82 ? A ASN 82 ? 1_555 CA ? I CA . ? A CA 308 ? 1_555 O ? A ASP 106 ? A ASP 106 ? 1_555 133.8 ? 9 OE1 ? A GLU 88 ? A GLU 88 ? 1_555 CA ? I CA . ? A CA 308 ? 1_555 O ? A ASP 106 ? A ASP 106 ? 1_555 73.2 ? 10 OD1 ? A ASN 105 ? A ASN 105 ? 1_555 CA ? I CA . ? A CA 308 ? 1_555 O ? A ASP 106 ? A ASP 106 ? 1_555 71.5 ? 11 OE1 ? A GLU 80 ? A GLU 80 ? 1_555 CA ? I CA . ? A CA 308 ? 1_555 OD1 ? A ASP 106 ? A ASP 106 ? 1_555 69.5 ? 12 OD1 ? A ASN 82 ? A ASN 82 ? 1_555 CA ? I CA . ? A CA 308 ? 1_555 OD1 ? A ASP 106 ? A ASP 106 ? 1_555 82.8 ? 13 OE1 ? A GLU 88 ? A GLU 88 ? 1_555 CA ? I CA . ? A CA 308 ? 1_555 OD1 ? A ASP 106 ? A ASP 106 ? 1_555 86.9 ? 14 OD1 ? A ASN 105 ? A ASN 105 ? 1_555 CA ? I CA . ? A CA 308 ? 1_555 OD1 ? A ASP 106 ? A ASP 106 ? 1_555 85.8 ? 15 O ? A ASP 106 ? A ASP 106 ? 1_555 CA ? I CA . ? A CA 308 ? 1_555 OD1 ? A ASP 106 ? A ASP 106 ? 1_555 71.6 ? 16 OE1 ? A GLU 80 ? A GLU 80 ? 1_555 CA ? I CA . ? A CA 308 ? 1_555 OBM ? K A1IUQ . ? A A1IUQ 310 ? 1_555 73.1 ? 17 OD1 ? A ASN 82 ? A ASN 82 ? 1_555 CA ? I CA . ? A CA 308 ? 1_555 OBM ? K A1IUQ . ? A A1IUQ 310 ? 1_555 87.1 ? 18 OE1 ? A GLU 88 ? A GLU 88 ? 1_555 CA ? I CA . ? A CA 308 ? 1_555 OBM ? K A1IUQ . ? A A1IUQ 310 ? 1_555 121.9 ? 19 OD1 ? A ASN 105 ? A ASN 105 ? 1_555 CA ? I CA . ? A CA 308 ? 1_555 OBM ? K A1IUQ . ? A A1IUQ 310 ? 1_555 82.3 ? 20 O ? A ASP 106 ? A ASP 106 ? 1_555 CA ? I CA . ? A CA 308 ? 1_555 OBM ? K A1IUQ . ? A A1IUQ 310 ? 1_555 135.5 ? 21 OD1 ? A ASP 106 ? A ASP 106 ? 1_555 CA ? I CA . ? A CA 308 ? 1_555 OBM ? K A1IUQ . ? A A1IUQ 310 ? 1_555 142.7 ? 22 OE1 ? A GLU 80 ? A GLU 80 ? 1_555 CA ? I CA . ? A CA 308 ? 1_555 OBO ? K A1IUQ . ? A A1IUQ 310 ? 1_555 132.7 ? 23 OD1 ? A ASN 82 ? A ASN 82 ? 1_555 CA ? I CA . ? A CA 308 ? 1_555 OBO ? K A1IUQ . ? A A1IUQ 310 ? 1_555 127.6 ? 24 OE1 ? A GLU 88 ? A GLU 88 ? 1_555 CA ? I CA . ? A CA 308 ? 1_555 OBO ? K A1IUQ . ? A A1IUQ 310 ? 1_555 86.5 ? 25 OD1 ? A ASN 105 ? A ASN 105 ? 1_555 CA ? I CA . ? A CA 308 ? 1_555 OBO ? K A1IUQ . ? A A1IUQ 310 ? 1_555 78.7 ? 26 O ? A ASP 106 ? A ASP 106 ? 1_555 CA ? I CA . ? A CA 308 ? 1_555 OBO ? K A1IUQ . ? A A1IUQ 310 ? 1_555 71.2 ? 27 OD1 ? A ASP 106 ? A ASP 106 ? 1_555 CA ? I CA . ? A CA 308 ? 1_555 OBO ? K A1IUQ . ? A A1IUQ 310 ? 1_555 142.6 ? 28 OBM ? K A1IUQ . ? A A1IUQ 310 ? 1_555 CA ? I CA . ? A CA 308 ? 1_555 OBO ? K A1IUQ . ? A A1IUQ 310 ? 1_555 68.7 ? 29 O ? A GLY 168 ? A GLY 168 ? 1_555 CA ? J CA . ? A CA 309 ? 1_555 O ? L HOH . ? A HOH 419 ? 1_555 105.5 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 NAG B . ? ASN A 182 ? NAG A 301 ? 1_555 ASN A 182 ? 1_555 C1 ND2 ASN 1 NAG N-Glycosylation Carbohydrate 2 NAG C . ? ASN A 139 ? NAG A 302 ? 1_555 ASN A 139 ? 1_555 C1 ND2 ASN 1 NAG N-Glycosylation Carbohydrate 3 NAG D . ? ASN A 158 ? NAG A 303 ? 1_555 ASN A 158 ? 1_555 C1 ND2 ASN 1 NAG N-Glycosylation Carbohydrate 4 NAG E . ? ASN A 178 ? NAG A 304 ? 1_555 ASN A 178 ? 1_555 C1 ND2 ASN 1 NAG N-Glycosylation Carbohydrate 5 NAG F . ? ASN A 4 ? NAG A 305 ? 1_555 ASN A 4 ? 1_555 C1 ND2 ASN 1 NAG N-Glycosylation Carbohydrate 6 NAG G . ? ASN A 124 ? NAG A 306 ? 1_555 ASN A 124 ? 1_555 C1 ND2 ASN 1 NAG N-Glycosylation Carbohydrate 7 NAG H . ? ASN A 244 ? NAG A 307 ? 1_555 ASN A 244 ? 1_555 C1 ND2 ASN 1 NAG N-Glycosylation Carbohydrate 8 CYS A 19 ? CYS A 117 ? CYS A 19 ? 1_555 CYS A 117 ? 1_555 SG SG . . . None 'Disulfide bridge' 9 CYS A 90 ? CYS A 109 ? CYS A 90 ? 1_555 CYS A 109 ? 1_555 SG SG . . . None 'Disulfide bridge' 10 CYS A 122 ? CYS A 133 ? CYS A 122 ? 1_555 CYS A 133 ? 1_555 SG SG . . . None 'Disulfide bridge' 11 CYS A 127 ? CYS A 142 ? CYS A 127 ? 1_555 CYS A 142 ? 1_555 SG SG . . . None 'Disulfide bridge' 12 CYS A 144 ? CYS A 153 ? CYS A 144 ? 1_555 CYS A 153 ? 1_555 SG SG . . . None 'Disulfide bridge' 13 CYS A 159 ? CYS A 203 ? CYS A 159 ? 1_555 CYS A 203 ? 1_555 SG SG . . . None 'Disulfide bridge' 14 CYS A 172 ? CYS A 185 ? CYS A 172 ? 1_555 CYS A 185 ? 1_555 SG SG . . . None 'Disulfide bridge' 15 CYS A 189 ? CYS A 216 ? CYS A 189 ? 1_555 CYS A 216 ? 1_555 SG SG . . . None 'Disulfide bridge' 16 CYS A 221 ? CYS A 265 ? CYS A 221 ? 1_555 CYS A 265 ? 1_555 SG SG . . . None 'Disulfide bridge' 17 CYS A 234 ? CYS A 247 ? CYS A 234 ? 1_555 CYS A 247 ? 1_555 SG SG . . . None 'Disulfide bridge' 18 CYS A 251 ? CYS A 278 ? CYS A 251 ? 1_555 CYS A 278 ? 1_555 SG SG . . . None 'Disulfide bridge' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLU _struct_mon_prot_cis.label_seq_id 80 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLU _struct_mon_prot_cis.auth_seq_id 80 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 81 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 81 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -1.81 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 5 ? AA3 ? 2 ? AA4 ? 2 ? AA5 ? 3 ? AA6 ? 2 ? AA7 ? 3 ? AA8 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA6 1 2 ? anti-parallel AA7 1 2 ? anti-parallel AA7 2 3 ? anti-parallel AA8 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 2 ? THR A 5 ? SER A 2 THR A 5 AA1 2 LEU A 114 ? THR A 119 ? LEU A 114 THR A 119 AA1 3 TYR A 49 ? VAL A 56 ? TYR A 49 VAL A 56 AA1 4 VAL A 59 ? TRP A 62 ? VAL A 59 TRP A 62 AA1 5 LYS A 67 ? PRO A 68 ? LYS A 67 PRO A 68 AA2 1 HIS A 25 ? LEU A 26 ? HIS A 25 LEU A 26 AA2 2 LEU A 114 ? THR A 119 ? LEU A 114 THR A 119 AA2 3 TYR A 49 ? VAL A 56 ? TYR A 49 VAL A 56 AA2 4 CYS A 90 ? ILE A 93 ? CYS A 90 ILE A 93 AA2 5 TRP A 104 ? GLU A 107 ? TRP A 104 GLU A 107 AA3 1 GLY A 131 ? GLU A 135 ? GLY A 131 GLU A 135 AA3 2 TYR A 140 ? CYS A 144 ? TYR A 140 CYS A 144 AA4 1 PHE A 148 ? SER A 149 ? PHE A 148 SER A 149 AA4 2 GLN A 155 ? ILE A 156 ? GLN A 155 ILE A 156 AA5 1 GLY A 168 ? SER A 173 ? GLY A 168 SER A 173 AA5 2 SER A 184 ? CYS A 189 ? SER A 184 CYS A 189 AA5 3 MET A 201 ? GLN A 202 ? MET A 201 GLN A 202 AA6 1 TYR A 193 ? PRO A 195 ? TYR A 193 PRO A 195 AA6 2 CYS A 216 ? VAL A 218 ? CYS A 216 VAL A 218 AA7 1 PHE A 231 ? GLU A 233 ? PHE A 231 GLU A 233 AA7 2 THR A 246 ? ASP A 250 ? THR A 246 ASP A 250 AA7 3 SER A 262 ? GLN A 264 ? SER A 262 GLN A 264 AA8 1 GLU A 256 ? MET A 258 ? GLU A 256 MET A 258 AA8 2 THR A 277 ? LYS A 279 ? THR A 277 LYS A 279 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N SER A 2 ? N SER A 2 O THR A 119 ? O THR A 119 AA1 2 3 O LEU A 114 ? O LEU A 114 N TRP A 50 ? N TRP A 50 AA1 3 4 N VAL A 56 ? N VAL A 56 O VAL A 59 ? O VAL A 59 AA1 4 5 N TRP A 62 ? N TRP A 62 O LYS A 67 ? O LYS A 67 AA2 1 2 N HIS A 25 ? N HIS A 25 O TYR A 118 ? O TYR A 118 AA2 2 3 O LEU A 114 ? O LEU A 114 N TRP A 50 ? N TRP A 50 AA2 3 4 N TYR A 49 ? N TYR A 49 O ILE A 93 ? O ILE A 93 AA2 4 5 N CYS A 90 ? N CYS A 90 O GLU A 107 ? O GLU A 107 AA3 1 2 N GLU A 132 ? N GLU A 132 O LYS A 143 ? O LYS A 143 AA4 1 2 N SER A 149 ? N SER A 149 O GLN A 155 ? O GLN A 155 AA5 1 2 N SER A 173 ? N SER A 173 O SER A 184 ? O SER A 184 AA5 2 3 N CYS A 185 ? N CYS A 185 O MET A 201 ? O MET A 201 AA6 1 2 N LEU A 194 ? N LEU A 194 O ASN A 217 ? O ASN A 217 AA7 1 2 N GLU A 233 ? N GLU A 233 O THR A 248 ? O THR A 248 AA7 2 3 N CYS A 247 ? N CYS A 247 O LEU A 263 ? O LEU A 263 AA8 1 2 N MET A 258 ? N MET A 258 O THR A 277 ? O THR A 277 # _pdbx_entry_details.entry_id 9HGU _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 24 ? ? -129.66 -168.65 2 1 ALA A 28 ? ? -153.01 -17.10 3 1 TYR A 48 ? ? 62.99 -162.56 4 1 ASN A 75 ? ? -147.78 40.78 5 1 GLN A 85 ? ? -79.04 -150.29 6 1 ASN A 139 ? ? -157.21 -131.26 7 1 ASN A 244 ? ? 90.26 -3.52 8 1 CYS A 251 ? ? -90.73 -150.07 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 410 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id L _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -15.5535 -16.1035 35.9317 0.6992 ? -0.0991 ? 0.1183 ? 0.6486 ? 0.0882 ? 0.6849 ? 3.8489 ? -0.3949 ? -0.4229 ? 3.2009 ? -3.3288 ? 2.0618 ? 0.3031 ? -0.1025 ? 0.5535 ? 1.0630 ? 0.0017 ? 0.4783 ? -1.7345 ? -1.5457 ? 0.0382 ? 2 'X-RAY DIFFRACTION' ? refined -16.8518 -29.5878 37.2801 0.5688 ? -0.1368 ? -0.0295 ? 0.3877 ? 0.1506 ? 0.6005 ? 6.7872 ? 2.0908 ? -1.3252 ? 3.0735 ? -0.9016 ? 5.0364 ? 0.1096 ? -0.5009 ? -1.5465 ? 0.5529 ? -0.2801 ? -0.4422 ? 0.7307 ? -0.3194 ? 0.0525 ? 3 'X-RAY DIFFRACTION' ? refined -8.7096 -6.3131 8.0158 0.9306 ? -0.0561 ? 0.0868 ? 0.5674 ? 0.0777 ? 0.5403 ? 0.2993 ? 0.4192 ? 0.2851 ? 1.5932 ? -5.6797 ? 8.7659 ? 0.0202 ? 0.3870 ? 0.0738 ? 0.1438 ? 0.3070 ? 0.3031 ? -1.0624 ? -0.4997 ? -0.0323 ? 4 'X-RAY DIFFRACTION' ? refined -9.2119 4.4766 -16.6226 0.8816 ? 0.0481 ? 0.0492 ? 0.6235 ? 0.0450 ? 0.4626 ? 1.5582 ? 1.0900 ? 0.2926 ? 0.2757 ? -0.6917 ? 7.4694 ? 0.0727 ? 0.3235 ? -0.0107 ? 0.1690 ? -0.0576 ? 0.1373 ? 0.1348 ? -0.3873 ? -0.1309 ? 5 'X-RAY DIFFRACTION' ? refined -6.6821 17.8378 -51.3930 1.5195 ? 0.0161 ? 0.1148 ? 0.5600 ? 0.0405 ? 0.5138 ? 3.9032 ? 0.1764 ? 0.4029 ? 1.7136 ? -2.3048 ? 5.0347 ? -0.0372 ? 0.1744 ? 0.4328 ? -2.0954 ? 0.3119 ? -0.4459 ? -1.8761 ? -0.0957 ? 0.2128 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 1 through 31 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 32 through 115 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 116 through 167 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 168 through 218 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 219 through 280 ) ; # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1IUQ C4 C N S 1 A1IUQ C5 C N R 2 A1IUQ C6 C N N 3 A1IUQ C3 C N S 4 A1IUQ C1 C N R 5 A1IUQ C2 C N R 6 A1IUQ CAA C N N 7 A1IUQ CAB C N N 8 A1IUQ CAC C N N 9 A1IUQ CAD C N N 10 A1IUQ CAE C N N 11 A1IUQ CAF C N N 12 A1IUQ CAG C N N 13 A1IUQ CAH C N S 14 A1IUQ CAI C N N 15 A1IUQ CAL C N N 16 A1IUQ CAN C N N 17 A1IUQ CBA C N R 18 A1IUQ CBB C N N 19 A1IUQ CBC C N N 20 A1IUQ CBD C N N 21 A1IUQ CBE C N N 22 A1IUQ CBF C N R 23 A1IUQ CBH C N S 24 A1IUQ CBJ C N S 25 A1IUQ CBK C N N 26 A1IUQ CBL C N S 27 A1IUQ CBN C N R 28 A1IUQ CBP C N S 29 A1IUQ NAK N N N 30 A1IUQ O1 O N N 31 A1IUQ O2 O N N 32 A1IUQ O3 O N N 33 A1IUQ O4 O N N 34 A1IUQ O5 O N N 35 A1IUQ O6 O N N 36 A1IUQ OAJ O N N 37 A1IUQ OBG O N N 38 A1IUQ OBI O N N 39 A1IUQ OBM O N N 40 A1IUQ OBO O N N 41 A1IUQ OBQ O N N 42 A1IUQ H1 H N N 43 A1IUQ H2 H N N 44 A1IUQ H3 H N N 45 A1IUQ H4 H N N 46 A1IUQ H5 H N N 47 A1IUQ H6 H N N 48 A1IUQ H7 H N N 49 A1IUQ H8 H N N 50 A1IUQ H9 H N N 51 A1IUQ H10 H N N 52 A1IUQ H11 H N N 53 A1IUQ H12 H N N 54 A1IUQ H13 H N N 55 A1IUQ H14 H N N 56 A1IUQ H15 H N N 57 A1IUQ H16 H N N 58 A1IUQ H17 H N N 59 A1IUQ H18 H N N 60 A1IUQ H19 H N N 61 A1IUQ H20 H N N 62 A1IUQ H21 H N N 63 A1IUQ H22 H N N 64 A1IUQ H23 H N N 65 A1IUQ H24 H N N 66 A1IUQ H25 H N N 67 A1IUQ H26 H N N 68 A1IUQ H27 H N N 69 A1IUQ H28 H N N 70 A1IUQ H29 H N N 71 A1IUQ H30 H N N 72 A1IUQ H31 H N N 73 A1IUQ H32 H N N 74 A1IUQ H33 H N N 75 A1IUQ H34 H N N 76 A1IUQ H35 H N N 77 A1IUQ H36 H N N 78 A1IUQ H37 H N N 79 A1IUQ H38 H N N 80 A1IUQ H39 H N N 81 A1IUQ H40 H N N 82 A1IUQ H41 H N N 83 A1IUQ H42 H N N 84 A1IUQ H43 H N N 85 A1IUQ H44 H N N 86 A1IUQ H45 H N N 87 A1IUQ H46 H N N 88 A1IUQ H47 H N N 89 A1IUQ H48 H N N 90 A1IUQ H49 H N N 91 A1IUQ H50 H N N 92 A1IUQ H51 H N N 93 ALA N N N N 94 ALA CA C N S 95 ALA C C N N 96 ALA O O N N 97 ALA CB C N N 98 ALA OXT O N N 99 ALA H H N N 100 ALA H2 H N N 101 ALA HA H N N 102 ALA HB1 H N N 103 ALA HB2 H N N 104 ALA HB3 H N N 105 ALA HXT H N N 106 ARG N N N N 107 ARG CA C N S 108 ARG C C N N 109 ARG O O N N 110 ARG CB C N N 111 ARG CG C N N 112 ARG CD C N N 113 ARG NE N N N 114 ARG CZ C N N 115 ARG NH1 N N N 116 ARG NH2 N N N 117 ARG OXT O N N 118 ARG H H N N 119 ARG H2 H N N 120 ARG HA H N N 121 ARG HB2 H N N 122 ARG HB3 H N N 123 ARG HG2 H N N 124 ARG HG3 H N N 125 ARG HD2 H N N 126 ARG HD3 H N N 127 ARG HE H N N 128 ARG HH11 H N N 129 ARG HH12 H N N 130 ARG HH21 H N N 131 ARG HH22 H N N 132 ARG HXT H N N 133 ASN N N N N 134 ASN CA C N S 135 ASN C C N N 136 ASN O O N N 137 ASN CB C N N 138 ASN CG C N N 139 ASN OD1 O N N 140 ASN ND2 N N N 141 ASN OXT O N N 142 ASN H H N N 143 ASN H2 H N N 144 ASN HA H N N 145 ASN HB2 H N N 146 ASN HB3 H N N 147 ASN HD21 H N N 148 ASN HD22 H N N 149 ASN HXT H N N 150 ASP N N N N 151 ASP CA C N S 152 ASP C C N N 153 ASP O O N N 154 ASP CB C N N 155 ASP CG C N N 156 ASP OD1 O N N 157 ASP OD2 O N N 158 ASP OXT O N N 159 ASP H H N N 160 ASP H2 H N N 161 ASP HA H N N 162 ASP HB2 H N N 163 ASP HB3 H N N 164 ASP HD2 H N N 165 ASP HXT H N N 166 CA CA CA N N 167 CYS N N N N 168 CYS CA C N R 169 CYS C C N N 170 CYS O O N N 171 CYS CB C N N 172 CYS SG S N N 173 CYS OXT O N N 174 CYS H H N N 175 CYS H2 H N N 176 CYS HA H N N 177 CYS HB2 H N N 178 CYS HB3 H N N 179 CYS HG H N N 180 CYS HXT H N N 181 GLN N N N N 182 GLN CA C N S 183 GLN C C N N 184 GLN O O N N 185 GLN CB C N N 186 GLN CG C N N 187 GLN CD C N N 188 GLN OE1 O N N 189 GLN NE2 N N N 190 GLN OXT O N N 191 GLN H H N N 192 GLN H2 H N N 193 GLN HA H N N 194 GLN HB2 H N N 195 GLN HB3 H N N 196 GLN HG2 H N N 197 GLN HG3 H N N 198 GLN HE21 H N N 199 GLN HE22 H N N 200 GLN HXT H N N 201 GLU N N N N 202 GLU CA C N S 203 GLU C C N N 204 GLU O O N N 205 GLU CB C N N 206 GLU CG C N N 207 GLU CD C N N 208 GLU OE1 O N N 209 GLU OE2 O N N 210 GLU OXT O N N 211 GLU H H N N 212 GLU H2 H N N 213 GLU HA H N N 214 GLU HB2 H N N 215 GLU HB3 H N N 216 GLU HG2 H N N 217 GLU HG3 H N N 218 GLU HE2 H N N 219 GLU HXT H N N 220 GLY N N N N 221 GLY CA C N N 222 GLY C C N N 223 GLY O O N N 224 GLY OXT O N N 225 GLY H H N N 226 GLY H2 H N N 227 GLY HA2 H N N 228 GLY HA3 H N N 229 GLY HXT H N N 230 HIS N N N N 231 HIS CA C N S 232 HIS C C N N 233 HIS O O N N 234 HIS CB C N N 235 HIS CG C Y N 236 HIS ND1 N Y N 237 HIS CD2 C Y N 238 HIS CE1 C Y N 239 HIS NE2 N Y N 240 HIS OXT O N N 241 HIS H H N N 242 HIS H2 H N N 243 HIS HA H N N 244 HIS HB2 H N N 245 HIS HB3 H N N 246 HIS HD1 H N N 247 HIS HD2 H N N 248 HIS HE1 H N N 249 HIS HE2 H N N 250 HIS HXT H N N 251 HOH O O N N 252 HOH H1 H N N 253 HOH H2 H N N 254 ILE N N N N 255 ILE CA C N S 256 ILE C C N N 257 ILE O O N N 258 ILE CB C N S 259 ILE CG1 C N N 260 ILE CG2 C N N 261 ILE CD1 C N N 262 ILE OXT O N N 263 ILE H H N N 264 ILE H2 H N N 265 ILE HA H N N 266 ILE HB H N N 267 ILE HG12 H N N 268 ILE HG13 H N N 269 ILE HG21 H N N 270 ILE HG22 H N N 271 ILE HG23 H N N 272 ILE HD11 H N N 273 ILE HD12 H N N 274 ILE HD13 H N N 275 ILE HXT H N N 276 LEU N N N N 277 LEU CA C N S 278 LEU C C N N 279 LEU O O N N 280 LEU CB C N N 281 LEU CG C N N 282 LEU CD1 C N N 283 LEU CD2 C N N 284 LEU OXT O N N 285 LEU H H N N 286 LEU H2 H N N 287 LEU HA H N N 288 LEU HB2 H N N 289 LEU HB3 H N N 290 LEU HG H N N 291 LEU HD11 H N N 292 LEU HD12 H N N 293 LEU HD13 H N N 294 LEU HD21 H N N 295 LEU HD22 H N N 296 LEU HD23 H N N 297 LEU HXT H N N 298 LYS N N N N 299 LYS CA C N S 300 LYS C C N N 301 LYS O O N N 302 LYS CB C N N 303 LYS CG C N N 304 LYS CD C N N 305 LYS CE C N N 306 LYS NZ N N N 307 LYS OXT O N N 308 LYS H H N N 309 LYS H2 H N N 310 LYS HA H N N 311 LYS HB2 H N N 312 LYS HB3 H N N 313 LYS HG2 H N N 314 LYS HG3 H N N 315 LYS HD2 H N N 316 LYS HD3 H N N 317 LYS HE2 H N N 318 LYS HE3 H N N 319 LYS HZ1 H N N 320 LYS HZ2 H N N 321 LYS HZ3 H N N 322 LYS HXT H N N 323 MET N N N N 324 MET CA C N S 325 MET C C N N 326 MET O O N N 327 MET CB C N N 328 MET CG C N N 329 MET SD S N N 330 MET CE C N N 331 MET OXT O N N 332 MET H H N N 333 MET H2 H N N 334 MET HA H N N 335 MET HB2 H N N 336 MET HB3 H N N 337 MET HG2 H N N 338 MET HG3 H N N 339 MET HE1 H N N 340 MET HE2 H N N 341 MET HE3 H N N 342 MET HXT H N N 343 NAG C1 C N R 344 NAG C2 C N R 345 NAG C3 C N R 346 NAG C4 C N S 347 NAG C5 C N R 348 NAG C6 C N N 349 NAG C7 C N N 350 NAG C8 C N N 351 NAG N2 N N N 352 NAG O1 O N N 353 NAG O3 O N N 354 NAG O4 O N N 355 NAG O5 O N N 356 NAG O6 O N N 357 NAG O7 O N N 358 NAG H1 H N N 359 NAG H2 H N N 360 NAG H3 H N N 361 NAG H4 H N N 362 NAG H5 H N N 363 NAG H61 H N N 364 NAG H62 H N N 365 NAG H81 H N N 366 NAG H82 H N N 367 NAG H83 H N N 368 NAG HN2 H N N 369 NAG HO1 H N N 370 NAG HO3 H N N 371 NAG HO4 H N N 372 NAG HO6 H N N 373 PHE N N N N 374 PHE CA C N S 375 PHE C C N N 376 PHE O O N N 377 PHE CB C N N 378 PHE CG C Y N 379 PHE CD1 C Y N 380 PHE CD2 C Y N 381 PHE CE1 C Y N 382 PHE CE2 C Y N 383 PHE CZ C Y N 384 PHE OXT O N N 385 PHE H H N N 386 PHE H2 H N N 387 PHE HA H N N 388 PHE HB2 H N N 389 PHE HB3 H N N 390 PHE HD1 H N N 391 PHE HD2 H N N 392 PHE HE1 H N N 393 PHE HE2 H N N 394 PHE HZ H N N 395 PHE HXT H N N 396 PRO N N N N 397 PRO CA C N S 398 PRO C C N N 399 PRO O O N N 400 PRO CB C N N 401 PRO CG C N N 402 PRO CD C N N 403 PRO OXT O N N 404 PRO H H N N 405 PRO HA H N N 406 PRO HB2 H N N 407 PRO HB3 H N N 408 PRO HG2 H N N 409 PRO HG3 H N N 410 PRO HD2 H N N 411 PRO HD3 H N N 412 PRO HXT H N N 413 SER N N N N 414 SER CA C N S 415 SER C C N N 416 SER O O N N 417 SER CB C N N 418 SER OG O N N 419 SER OXT O N N 420 SER H H N N 421 SER H2 H N N 422 SER HA H N N 423 SER HB2 H N N 424 SER HB3 H N N 425 SER HG H N N 426 SER HXT H N N 427 THR N N N N 428 THR CA C N S 429 THR C C N N 430 THR O O N N 431 THR CB C N R 432 THR OG1 O N N 433 THR CG2 C N N 434 THR OXT O N N 435 THR H H N N 436 THR H2 H N N 437 THR HA H N N 438 THR HB H N N 439 THR HG1 H N N 440 THR HG21 H N N 441 THR HG22 H N N 442 THR HG23 H N N 443 THR HXT H N N 444 TRP N N N N 445 TRP CA C N S 446 TRP C C N N 447 TRP O O N N 448 TRP CB C N N 449 TRP CG C Y N 450 TRP CD1 C Y N 451 TRP CD2 C Y N 452 TRP NE1 N Y N 453 TRP CE2 C Y N 454 TRP CE3 C Y N 455 TRP CZ2 C Y N 456 TRP CZ3 C Y N 457 TRP CH2 C Y N 458 TRP OXT O N N 459 TRP H H N N 460 TRP H2 H N N 461 TRP HA H N N 462 TRP HB2 H N N 463 TRP HB3 H N N 464 TRP HD1 H N N 465 TRP HE1 H N N 466 TRP HE3 H N N 467 TRP HZ2 H N N 468 TRP HZ3 H N N 469 TRP HH2 H N N 470 TRP HXT H N N 471 TYR N N N N 472 TYR CA C N S 473 TYR C C N N 474 TYR O O N N 475 TYR CB C N N 476 TYR CG C Y N 477 TYR CD1 C Y N 478 TYR CD2 C Y N 479 TYR CE1 C Y N 480 TYR CE2 C Y N 481 TYR CZ C Y N 482 TYR OH O N N 483 TYR OXT O N N 484 TYR H H N N 485 TYR H2 H N N 486 TYR HA H N N 487 TYR HB2 H N N 488 TYR HB3 H N N 489 TYR HD1 H N N 490 TYR HD2 H N N 491 TYR HE1 H N N 492 TYR HE2 H N N 493 TYR HH H N N 494 TYR HXT H N N 495 VAL N N N N 496 VAL CA C N S 497 VAL C C N N 498 VAL O O N N 499 VAL CB C N N 500 VAL CG1 C N N 501 VAL CG2 C N N 502 VAL OXT O N N 503 VAL H H N N 504 VAL H2 H N N 505 VAL HA H N N 506 VAL HB H N N 507 VAL HG11 H N N 508 VAL HG12 H N N 509 VAL HG13 H N N 510 VAL HG21 H N N 511 VAL HG22 H N N 512 VAL HG23 H N N 513 VAL HXT H N N 514 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1IUQ CAA CAB sing N N 1 A1IUQ CAA CAF sing N N 2 A1IUQ CAB CAC sing N N 3 A1IUQ OBM CBL sing N N 4 A1IUQ O4 C4 sing N N 5 A1IUQ OAJ CAI doub N N 6 A1IUQ CAG CAF sing N N 7 A1IUQ CAG CAH sing N N 8 A1IUQ CAF CAE sing N N 9 A1IUQ CAC CAD sing N N 10 A1IUQ O6 C6 sing N N 11 A1IUQ CBK CBJ sing N N 12 A1IUQ CBL CBJ sing N N 13 A1IUQ CBL CBN sing N N 14 A1IUQ OBO CBN sing N N 15 A1IUQ O3 CAH sing N N 16 A1IUQ O3 C3 sing N N 17 A1IUQ C4 C3 sing N N 18 A1IUQ C4 C5 sing N N 19 A1IUQ CAI CAH sing N N 20 A1IUQ CAI NAK sing N N 21 A1IUQ C6 C5 sing N N 22 A1IUQ CBJ OBI sing N N 23 A1IUQ CAE CAD sing N N 24 A1IUQ CBN CBP sing N N 25 A1IUQ C3 C2 sing N N 26 A1IUQ C5 O5 sing N N 27 A1IUQ CAL NAK sing N N 28 A1IUQ NAK CAN sing N N 29 A1IUQ C2 O2 sing N N 30 A1IUQ C2 C1 sing N N 31 A1IUQ OBI CBH sing N N 32 A1IUQ CBP OBQ sing N N 33 A1IUQ CBP CBH sing N N 34 A1IUQ O5 C1 sing N N 35 A1IUQ CBH OBG sing N N 36 A1IUQ C1 O1 sing N N 37 A1IUQ OBG CBF sing N N 38 A1IUQ O1 CBA sing N N 39 A1IUQ CBF CBA sing N N 40 A1IUQ CBF CBE sing N N 41 A1IUQ CBA CBB sing N N 42 A1IUQ CBE CBD sing N N 43 A1IUQ CBB CBC sing N N 44 A1IUQ CBD CBC sing N N 45 A1IUQ C4 H1 sing N N 46 A1IUQ C5 H2 sing N N 47 A1IUQ C6 H3 sing N N 48 A1IUQ C6 H4 sing N N 49 A1IUQ C3 H5 sing N N 50 A1IUQ C1 H6 sing N N 51 A1IUQ C2 H7 sing N N 52 A1IUQ CAA H8 sing N N 53 A1IUQ CAA H9 sing N N 54 A1IUQ CAB H10 sing N N 55 A1IUQ CAB H11 sing N N 56 A1IUQ CAC H12 sing N N 57 A1IUQ CAC H13 sing N N 58 A1IUQ CAD H14 sing N N 59 A1IUQ CAD H15 sing N N 60 A1IUQ CAE H16 sing N N 61 A1IUQ CAE H17 sing N N 62 A1IUQ CAF H18 sing N N 63 A1IUQ CAG H19 sing N N 64 A1IUQ CAG H20 sing N N 65 A1IUQ CAH H21 sing N N 66 A1IUQ CAL H22 sing N N 67 A1IUQ CAL H23 sing N N 68 A1IUQ CAL H24 sing N N 69 A1IUQ CAN H25 sing N N 70 A1IUQ CAN H26 sing N N 71 A1IUQ CAN H27 sing N N 72 A1IUQ CBA H28 sing N N 73 A1IUQ CBB H29 sing N N 74 A1IUQ CBB H30 sing N N 75 A1IUQ CBC H31 sing N N 76 A1IUQ CBC H32 sing N N 77 A1IUQ CBD H33 sing N N 78 A1IUQ CBD H34 sing N N 79 A1IUQ CBE H35 sing N N 80 A1IUQ CBE H36 sing N N 81 A1IUQ CBF H37 sing N N 82 A1IUQ CBH H38 sing N N 83 A1IUQ CBJ H39 sing N N 84 A1IUQ CBK H40 sing N N 85 A1IUQ CBK H41 sing N N 86 A1IUQ CBK H42 sing N N 87 A1IUQ CBL H43 sing N N 88 A1IUQ CBN H44 sing N N 89 A1IUQ CBP H45 sing N N 90 A1IUQ O2 H46 sing N N 91 A1IUQ O4 H47 sing N N 92 A1IUQ O6 H48 sing N N 93 A1IUQ OBM H49 sing N N 94 A1IUQ OBO H50 sing N N 95 A1IUQ OBQ H51 sing N N 96 ALA N CA sing N N 97 ALA N H sing N N 98 ALA N H2 sing N N 99 ALA CA C sing N N 100 ALA CA CB sing N N 101 ALA CA HA sing N N 102 ALA C O doub N N 103 ALA C OXT sing N N 104 ALA CB HB1 sing N N 105 ALA CB HB2 sing N N 106 ALA CB HB3 sing N N 107 ALA OXT HXT sing N N 108 ARG N CA sing N N 109 ARG N H sing N N 110 ARG N H2 sing N N 111 ARG CA C sing N N 112 ARG CA CB sing N N 113 ARG CA HA sing N N 114 ARG C O doub N N 115 ARG C OXT sing N N 116 ARG CB CG sing N N 117 ARG CB HB2 sing N N 118 ARG CB HB3 sing N N 119 ARG CG CD sing N N 120 ARG CG HG2 sing N N 121 ARG CG HG3 sing N N 122 ARG CD NE sing N N 123 ARG CD HD2 sing N N 124 ARG CD HD3 sing N N 125 ARG NE CZ sing N N 126 ARG NE HE sing N N 127 ARG CZ NH1 sing N N 128 ARG CZ NH2 doub N N 129 ARG NH1 HH11 sing N N 130 ARG NH1 HH12 sing N N 131 ARG NH2 HH21 sing N N 132 ARG NH2 HH22 sing N N 133 ARG OXT HXT sing N N 134 ASN N CA sing N N 135 ASN N H sing N N 136 ASN N H2 sing N N 137 ASN CA C sing N N 138 ASN CA CB sing N N 139 ASN CA HA sing N N 140 ASN C O doub N N 141 ASN C OXT sing N N 142 ASN CB CG sing N N 143 ASN CB HB2 sing N N 144 ASN CB HB3 sing N N 145 ASN CG OD1 doub N N 146 ASN CG ND2 sing N N 147 ASN ND2 HD21 sing N N 148 ASN ND2 HD22 sing N N 149 ASN OXT HXT sing N N 150 ASP N CA sing N N 151 ASP N H sing N N 152 ASP N H2 sing N N 153 ASP CA C sing N N 154 ASP CA CB sing N N 155 ASP CA HA sing N N 156 ASP C O doub N N 157 ASP C OXT sing N N 158 ASP CB CG sing N N 159 ASP CB HB2 sing N N 160 ASP CB HB3 sing N N 161 ASP CG OD1 doub N N 162 ASP CG OD2 sing N N 163 ASP OD2 HD2 sing N N 164 ASP OXT HXT sing N N 165 CYS N CA sing N N 166 CYS N H sing N N 167 CYS N H2 sing N N 168 CYS CA C sing N N 169 CYS CA CB sing N N 170 CYS CA HA sing N N 171 CYS C O doub N N 172 CYS C OXT sing N N 173 CYS CB SG sing N N 174 CYS CB HB2 sing N N 175 CYS CB HB3 sing N N 176 CYS SG HG sing N N 177 CYS OXT HXT sing N N 178 GLN N CA sing N N 179 GLN N H sing N N 180 GLN N H2 sing N N 181 GLN CA C sing N N 182 GLN CA CB sing N N 183 GLN CA HA sing N N 184 GLN C O doub N N 185 GLN C OXT sing N N 186 GLN CB CG sing N N 187 GLN CB HB2 sing N N 188 GLN CB HB3 sing N N 189 GLN CG CD sing N N 190 GLN CG HG2 sing N N 191 GLN CG HG3 sing N N 192 GLN CD OE1 doub N N 193 GLN CD NE2 sing N N 194 GLN NE2 HE21 sing N N 195 GLN NE2 HE22 sing N N 196 GLN OXT HXT sing N N 197 GLU N CA sing N N 198 GLU N H sing N N 199 GLU N H2 sing N N 200 GLU CA C sing N N 201 GLU CA CB sing N N 202 GLU CA HA sing N N 203 GLU C O doub N N 204 GLU C OXT sing N N 205 GLU CB CG sing N N 206 GLU CB HB2 sing N N 207 GLU CB HB3 sing N N 208 GLU CG CD sing N N 209 GLU CG HG2 sing N N 210 GLU CG HG3 sing N N 211 GLU CD OE1 doub N N 212 GLU CD OE2 sing N N 213 GLU OE2 HE2 sing N N 214 GLU OXT HXT sing N N 215 GLY N CA sing N N 216 GLY N H sing N N 217 GLY N H2 sing N N 218 GLY CA C sing N N 219 GLY CA HA2 sing N N 220 GLY CA HA3 sing N N 221 GLY C O doub N N 222 GLY C OXT sing N N 223 GLY OXT HXT sing N N 224 HIS N CA sing N N 225 HIS N H sing N N 226 HIS N H2 sing N N 227 HIS CA C sing N N 228 HIS CA CB sing N N 229 HIS CA HA sing N N 230 HIS C O doub N N 231 HIS C OXT sing N N 232 HIS CB CG sing N N 233 HIS CB HB2 sing N N 234 HIS CB HB3 sing N N 235 HIS CG ND1 sing Y N 236 HIS CG CD2 doub Y N 237 HIS ND1 CE1 doub Y N 238 HIS ND1 HD1 sing N N 239 HIS CD2 NE2 sing Y N 240 HIS CD2 HD2 sing N N 241 HIS CE1 NE2 sing Y N 242 HIS CE1 HE1 sing N N 243 HIS NE2 HE2 sing N N 244 HIS OXT HXT sing N N 245 HOH O H1 sing N N 246 HOH O H2 sing N N 247 ILE N CA sing N N 248 ILE N H sing N N 249 ILE N H2 sing N N 250 ILE CA C sing N N 251 ILE CA CB sing N N 252 ILE CA HA sing N N 253 ILE C O doub N N 254 ILE C OXT sing N N 255 ILE CB CG1 sing N N 256 ILE CB CG2 sing N N 257 ILE CB HB sing N N 258 ILE CG1 CD1 sing N N 259 ILE CG1 HG12 sing N N 260 ILE CG1 HG13 sing N N 261 ILE CG2 HG21 sing N N 262 ILE CG2 HG22 sing N N 263 ILE CG2 HG23 sing N N 264 ILE CD1 HD11 sing N N 265 ILE CD1 HD12 sing N N 266 ILE CD1 HD13 sing N N 267 ILE OXT HXT sing N N 268 LEU N CA sing N N 269 LEU N H sing N N 270 LEU N H2 sing N N 271 LEU CA C sing N N 272 LEU CA CB sing N N 273 LEU CA HA sing N N 274 LEU C O doub N N 275 LEU C OXT sing N N 276 LEU CB CG sing N N 277 LEU CB HB2 sing N N 278 LEU CB HB3 sing N N 279 LEU CG CD1 sing N N 280 LEU CG CD2 sing N N 281 LEU CG HG sing N N 282 LEU CD1 HD11 sing N N 283 LEU CD1 HD12 sing N N 284 LEU CD1 HD13 sing N N 285 LEU CD2 HD21 sing N N 286 LEU CD2 HD22 sing N N 287 LEU CD2 HD23 sing N N 288 LEU OXT HXT sing N N 289 LYS N CA sing N N 290 LYS N H sing N N 291 LYS N H2 sing N N 292 LYS CA C sing N N 293 LYS CA CB sing N N 294 LYS CA HA sing N N 295 LYS C O doub N N 296 LYS C OXT sing N N 297 LYS CB CG sing N N 298 LYS CB HB2 sing N N 299 LYS CB HB3 sing N N 300 LYS CG CD sing N N 301 LYS CG HG2 sing N N 302 LYS CG HG3 sing N N 303 LYS CD CE sing N N 304 LYS CD HD2 sing N N 305 LYS CD HD3 sing N N 306 LYS CE NZ sing N N 307 LYS CE HE2 sing N N 308 LYS CE HE3 sing N N 309 LYS NZ HZ1 sing N N 310 LYS NZ HZ2 sing N N 311 LYS NZ HZ3 sing N N 312 LYS OXT HXT sing N N 313 MET N CA sing N N 314 MET N H sing N N 315 MET N H2 sing N N 316 MET CA C sing N N 317 MET CA CB sing N N 318 MET CA HA sing N N 319 MET C O doub N N 320 MET C OXT sing N N 321 MET CB CG sing N N 322 MET CB HB2 sing N N 323 MET CB HB3 sing N N 324 MET CG SD sing N N 325 MET CG HG2 sing N N 326 MET CG HG3 sing N N 327 MET SD CE sing N N 328 MET CE HE1 sing N N 329 MET CE HE2 sing N N 330 MET CE HE3 sing N N 331 MET OXT HXT sing N N 332 NAG C1 C2 sing N N 333 NAG C1 O1 sing N N 334 NAG C1 O5 sing N N 335 NAG C1 H1 sing N N 336 NAG C2 C3 sing N N 337 NAG C2 N2 sing N N 338 NAG C2 H2 sing N N 339 NAG C3 C4 sing N N 340 NAG C3 O3 sing N N 341 NAG C3 H3 sing N N 342 NAG C4 C5 sing N N 343 NAG C4 O4 sing N N 344 NAG C4 H4 sing N N 345 NAG C5 C6 sing N N 346 NAG C5 O5 sing N N 347 NAG C5 H5 sing N N 348 NAG C6 O6 sing N N 349 NAG C6 H61 sing N N 350 NAG C6 H62 sing N N 351 NAG C7 C8 sing N N 352 NAG C7 N2 sing N N 353 NAG C7 O7 doub N N 354 NAG C8 H81 sing N N 355 NAG C8 H82 sing N N 356 NAG C8 H83 sing N N 357 NAG N2 HN2 sing N N 358 NAG O1 HO1 sing N N 359 NAG O3 HO3 sing N N 360 NAG O4 HO4 sing N N 361 NAG O6 HO6 sing N N 362 PHE N CA sing N N 363 PHE N H sing N N 364 PHE N H2 sing N N 365 PHE CA C sing N N 366 PHE CA CB sing N N 367 PHE CA HA sing N N 368 PHE C O doub N N 369 PHE C OXT sing N N 370 PHE CB CG sing N N 371 PHE CB HB2 sing N N 372 PHE CB HB3 sing N N 373 PHE CG CD1 doub Y N 374 PHE CG CD2 sing Y N 375 PHE CD1 CE1 sing Y N 376 PHE CD1 HD1 sing N N 377 PHE CD2 CE2 doub Y N 378 PHE CD2 HD2 sing N N 379 PHE CE1 CZ doub Y N 380 PHE CE1 HE1 sing N N 381 PHE CE2 CZ sing Y N 382 PHE CE2 HE2 sing N N 383 PHE CZ HZ sing N N 384 PHE OXT HXT sing N N 385 PRO N CA sing N N 386 PRO N CD sing N N 387 PRO N H sing N N 388 PRO CA C sing N N 389 PRO CA CB sing N N 390 PRO CA HA sing N N 391 PRO C O doub N N 392 PRO C OXT sing N N 393 PRO CB CG sing N N 394 PRO CB HB2 sing N N 395 PRO CB HB3 sing N N 396 PRO CG CD sing N N 397 PRO CG HG2 sing N N 398 PRO CG HG3 sing N N 399 PRO CD HD2 sing N N 400 PRO CD HD3 sing N N 401 PRO OXT HXT sing N N 402 SER N CA sing N N 403 SER N H sing N N 404 SER N H2 sing N N 405 SER CA C sing N N 406 SER CA CB sing N N 407 SER CA HA sing N N 408 SER C O doub N N 409 SER C OXT sing N N 410 SER CB OG sing N N 411 SER CB HB2 sing N N 412 SER CB HB3 sing N N 413 SER OG HG sing N N 414 SER OXT HXT sing N N 415 THR N CA sing N N 416 THR N H sing N N 417 THR N H2 sing N N 418 THR CA C sing N N 419 THR CA CB sing N N 420 THR CA HA sing N N 421 THR C O doub N N 422 THR C OXT sing N N 423 THR CB OG1 sing N N 424 THR CB CG2 sing N N 425 THR CB HB sing N N 426 THR OG1 HG1 sing N N 427 THR CG2 HG21 sing N N 428 THR CG2 HG22 sing N N 429 THR CG2 HG23 sing N N 430 THR OXT HXT sing N N 431 TRP N CA sing N N 432 TRP N H sing N N 433 TRP N H2 sing N N 434 TRP CA C sing N N 435 TRP CA CB sing N N 436 TRP CA HA sing N N 437 TRP C O doub N N 438 TRP C OXT sing N N 439 TRP CB CG sing N N 440 TRP CB HB2 sing N N 441 TRP CB HB3 sing N N 442 TRP CG CD1 doub Y N 443 TRP CG CD2 sing Y N 444 TRP CD1 NE1 sing Y N 445 TRP CD1 HD1 sing N N 446 TRP CD2 CE2 doub Y N 447 TRP CD2 CE3 sing Y N 448 TRP NE1 CE2 sing Y N 449 TRP NE1 HE1 sing N N 450 TRP CE2 CZ2 sing Y N 451 TRP CE3 CZ3 doub Y N 452 TRP CE3 HE3 sing N N 453 TRP CZ2 CH2 doub Y N 454 TRP CZ2 HZ2 sing N N 455 TRP CZ3 CH2 sing Y N 456 TRP CZ3 HZ3 sing N N 457 TRP CH2 HH2 sing N N 458 TRP OXT HXT sing N N 459 TYR N CA sing N N 460 TYR N H sing N N 461 TYR N H2 sing N N 462 TYR CA C sing N N 463 TYR CA CB sing N N 464 TYR CA HA sing N N 465 TYR C O doub N N 466 TYR C OXT sing N N 467 TYR CB CG sing N N 468 TYR CB HB2 sing N N 469 TYR CB HB3 sing N N 470 TYR CG CD1 doub Y N 471 TYR CG CD2 sing Y N 472 TYR CD1 CE1 sing Y N 473 TYR CD1 HD1 sing N N 474 TYR CD2 CE2 doub Y N 475 TYR CD2 HD2 sing N N 476 TYR CE1 CZ doub Y N 477 TYR CE1 HE1 sing N N 478 TYR CE2 CZ sing Y N 479 TYR CE2 HE2 sing N N 480 TYR CZ OH sing N N 481 TYR OH HH sing N N 482 TYR OXT HXT sing N N 483 VAL N CA sing N N 484 VAL N H sing N N 485 VAL N H2 sing N N 486 VAL CA C sing N N 487 VAL CA CB sing N N 488 VAL CA HA sing N N 489 VAL C O doub N N 490 VAL C OXT sing N N 491 VAL CB CG1 sing N N 492 VAL CB CG2 sing N N 493 VAL CB HB sing N N 494 VAL CG1 HG11 sing N N 495 VAL CG1 HG12 sing N N 496 VAL CG1 HG13 sing N N 497 VAL CG2 HG21 sing N N 498 VAL CG2 HG22 sing N N 499 VAL CG2 HG23 sing N N 500 VAL OXT HXT sing N N 501 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4CSY _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9HGU _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.010783 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000776 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013732 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019155 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CA N O S # loop_ # loop_ #