data_9HHW # _entry.id 9HHW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.402 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9HHW pdb_00009hhw 10.2210/pdb9hhw/pdb WWPDB D_1292143354 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-01-08 ? 2 'Structure model' 1 1 2025-02-26 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.year' 3 2 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9HHW _pdbx_database_status.recvd_initial_deposition_date 2024-11-22 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 knapp@pharmchem.uni-frankfurt.de Stefan Knapp ? 'principal investigator/group leader' 0000-0001-5995-6494 3 matthias.gehringer@uni-tuebingen.de Matthias Gehringer ? 'principal investigator/group leader' 0000-0003-0163-3419 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wang, G.' 1 0000-0003-2896-3928 'Seidler, N.' 2 0009-0007-4405-2397 'Gehringer, M.' 3 0000-0003-0163-3419 'Knapp, S.' 4 0000-0001-5995-6494 'Structural Genomics Consortium (SGC)' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country GE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Angew.Chem.Int.Ed.Engl. _citation.journal_id_ASTM ACIEAY _citation.journal_id_CSD 0179 _citation.journal_id_ISSN 1521-3773 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 64 _citation.language ? _citation.page_first e202419736 _citation.page_last e202419736 _citation.title ;Probing the Protein Kinases' Cysteinome by Covalent Fragments. ; _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/anie.202419736 _citation.pdbx_database_id_PubMed 39716901 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, G.' 1 ? primary 'Seidler, N.J.' 2 0009-0007-4405-2397 primary 'Rohm, S.' 3 0000-0003-3999-712X primary 'Pan, Y.' 4 ? primary 'Liang, X.J.' 5 ? primary 'Haarer, L.' 6 ? primary 'Berger, B.T.' 7 0000-0002-3314-2617 primary 'Sivashanmugam, S.A.' 8 ? primary 'Wydra, V.R.' 9 0009-0004-3295-0526 primary 'Forster, M.' 10 ? primary 'Laufer, S.A.' 11 0000-0001-6952-1486 primary 'Chaikuad, A.' 12 0000-0003-1120-2209 primary 'Gehringer, M.' 13 0000-0003-0163-3419 primary 'Knapp, S.' 14 0000-0001-5995-6494 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tau-tubulin kinase 1' 35515.031 1 2.7.11.1 ? ? ? 2 non-polymer syn '~{N}-[2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yl)phenyl]propanamide' 265.310 1 ? ? ? ? 3 water nat water 18.015 18 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Brain-derived tau kinase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNMSGGGEQADILPANYVVKDRWKVLKKIGGGGFGEIYEAMDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVC RFIGCGRNEKFNYVVMQLQGRNLADLRRSQPRGTFTLSTTLRLGKQILESIEAIHSVGFLHRDIKPSNFAMGRLPSTYRK CYMLDFGLARQYTNTTGDVRPPRNVAGFRGTVRYASVNAHKNREMGRHDDLWSLFYMLVEFAVGQLPWRKIKDKEQVGMI KEKYEHRMLLKHMPSEFHLFLDHIASLDYFTKPDYQLIMSVFENSMKERGIAENEAFDWEKAGTDALLS ; _entity_poly.pdbx_seq_one_letter_code_can ;MNMSGGGEQADILPANYVVKDRWKVLKKIGGGGFGEIYEAMDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVC RFIGCGRNEKFNYVVMQLQGRNLADLRRSQPRGTFTLSTTLRLGKQILESIEAIHSVGFLHRDIKPSNFAMGRLPSTYRK CYMLDFGLARQYTNTTGDVRPPRNVAGFRGTVRYASVNAHKNREMGRHDDLWSLFYMLVEFAVGQLPWRKIKDKEQVGMI KEKYEHRMLLKHMPSEFHLFLDHIASLDYFTKPDYQLIMSVFENSMKERGIAENEAFDWEKAGTDALLS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '~{N}-[2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yl)phenyl]propanamide' A1IU7 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 MET n 1 4 SER n 1 5 GLY n 1 6 GLY n 1 7 GLY n 1 8 GLU n 1 9 GLN n 1 10 ALA n 1 11 ASP n 1 12 ILE n 1 13 LEU n 1 14 PRO n 1 15 ALA n 1 16 ASN n 1 17 TYR n 1 18 VAL n 1 19 VAL n 1 20 LYS n 1 21 ASP n 1 22 ARG n 1 23 TRP n 1 24 LYS n 1 25 VAL n 1 26 LEU n 1 27 LYS n 1 28 LYS n 1 29 ILE n 1 30 GLY n 1 31 GLY n 1 32 GLY n 1 33 GLY n 1 34 PHE n 1 35 GLY n 1 36 GLU n 1 37 ILE n 1 38 TYR n 1 39 GLU n 1 40 ALA n 1 41 MET n 1 42 ASP n 1 43 LEU n 1 44 LEU n 1 45 THR n 1 46 ARG n 1 47 GLU n 1 48 ASN n 1 49 VAL n 1 50 ALA n 1 51 LEU n 1 52 LYS n 1 53 VAL n 1 54 GLU n 1 55 SER n 1 56 ALA n 1 57 GLN n 1 58 GLN n 1 59 PRO n 1 60 LYS n 1 61 GLN n 1 62 VAL n 1 63 LEU n 1 64 LYS n 1 65 MET n 1 66 GLU n 1 67 VAL n 1 68 ALA n 1 69 VAL n 1 70 LEU n 1 71 LYS n 1 72 LYS n 1 73 LEU n 1 74 GLN n 1 75 GLY n 1 76 LYS n 1 77 ASP n 1 78 HIS n 1 79 VAL n 1 80 CYS n 1 81 ARG n 1 82 PHE n 1 83 ILE n 1 84 GLY n 1 85 CYS n 1 86 GLY n 1 87 ARG n 1 88 ASN n 1 89 GLU n 1 90 LYS n 1 91 PHE n 1 92 ASN n 1 93 TYR n 1 94 VAL n 1 95 VAL n 1 96 MET n 1 97 GLN n 1 98 LEU n 1 99 GLN n 1 100 GLY n 1 101 ARG n 1 102 ASN n 1 103 LEU n 1 104 ALA n 1 105 ASP n 1 106 LEU n 1 107 ARG n 1 108 ARG n 1 109 SER n 1 110 GLN n 1 111 PRO n 1 112 ARG n 1 113 GLY n 1 114 THR n 1 115 PHE n 1 116 THR n 1 117 LEU n 1 118 SER n 1 119 THR n 1 120 THR n 1 121 LEU n 1 122 ARG n 1 123 LEU n 1 124 GLY n 1 125 LYS n 1 126 GLN n 1 127 ILE n 1 128 LEU n 1 129 GLU n 1 130 SER n 1 131 ILE n 1 132 GLU n 1 133 ALA n 1 134 ILE n 1 135 HIS n 1 136 SER n 1 137 VAL n 1 138 GLY n 1 139 PHE n 1 140 LEU n 1 141 HIS n 1 142 ARG n 1 143 ASP n 1 144 ILE n 1 145 LYS n 1 146 PRO n 1 147 SER n 1 148 ASN n 1 149 PHE n 1 150 ALA n 1 151 MET n 1 152 GLY n 1 153 ARG n 1 154 LEU n 1 155 PRO n 1 156 SER n 1 157 THR n 1 158 TYR n 1 159 ARG n 1 160 LYS n 1 161 CYS n 1 162 TYR n 1 163 MET n 1 164 LEU n 1 165 ASP n 1 166 PHE n 1 167 GLY n 1 168 LEU n 1 169 ALA n 1 170 ARG n 1 171 GLN n 1 172 TYR n 1 173 THR n 1 174 ASN n 1 175 THR n 1 176 THR n 1 177 GLY n 1 178 ASP n 1 179 VAL n 1 180 ARG n 1 181 PRO n 1 182 PRO n 1 183 ARG n 1 184 ASN n 1 185 VAL n 1 186 ALA n 1 187 GLY n 1 188 PHE n 1 189 ARG n 1 190 GLY n 1 191 THR n 1 192 VAL n 1 193 ARG n 1 194 TYR n 1 195 ALA n 1 196 SER n 1 197 VAL n 1 198 ASN n 1 199 ALA n 1 200 HIS n 1 201 LYS n 1 202 ASN n 1 203 ARG n 1 204 GLU n 1 205 MET n 1 206 GLY n 1 207 ARG n 1 208 HIS n 1 209 ASP n 1 210 ASP n 1 211 LEU n 1 212 TRP n 1 213 SER n 1 214 LEU n 1 215 PHE n 1 216 TYR n 1 217 MET n 1 218 LEU n 1 219 VAL n 1 220 GLU n 1 221 PHE n 1 222 ALA n 1 223 VAL n 1 224 GLY n 1 225 GLN n 1 226 LEU n 1 227 PRO n 1 228 TRP n 1 229 ARG n 1 230 LYS n 1 231 ILE n 1 232 LYS n 1 233 ASP n 1 234 LYS n 1 235 GLU n 1 236 GLN n 1 237 VAL n 1 238 GLY n 1 239 MET n 1 240 ILE n 1 241 LYS n 1 242 GLU n 1 243 LYS n 1 244 TYR n 1 245 GLU n 1 246 HIS n 1 247 ARG n 1 248 MET n 1 249 LEU n 1 250 LEU n 1 251 LYS n 1 252 HIS n 1 253 MET n 1 254 PRO n 1 255 SER n 1 256 GLU n 1 257 PHE n 1 258 HIS n 1 259 LEU n 1 260 PHE n 1 261 LEU n 1 262 ASP n 1 263 HIS n 1 264 ILE n 1 265 ALA n 1 266 SER n 1 267 LEU n 1 268 ASP n 1 269 TYR n 1 270 PHE n 1 271 THR n 1 272 LYS n 1 273 PRO n 1 274 ASP n 1 275 TYR n 1 276 GLN n 1 277 LEU n 1 278 ILE n 1 279 MET n 1 280 SER n 1 281 VAL n 1 282 PHE n 1 283 GLU n 1 284 ASN n 1 285 SER n 1 286 MET n 1 287 LYS n 1 288 GLU n 1 289 ARG n 1 290 GLY n 1 291 ILE n 1 292 ALA n 1 293 GLU n 1 294 ASN n 1 295 GLU n 1 296 ALA n 1 297 PHE n 1 298 ASP n 1 299 TRP n 1 300 GLU n 1 301 LYS n 1 302 ALA n 1 303 GLY n 1 304 THR n 1 305 ASP n 1 306 ALA n 1 307 LEU n 1 308 LEU n 1 309 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 309 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TTBK1, BDTK, KIAA1855' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1IU7 non-polymer . '~{N}-[2-(1~{H}-pyrrolo[2,3-b]pyridin-5-yl)phenyl]propanamide' ? 'C16 H15 N3 O' 265.310 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 12 ? ? ? A . n A 1 2 ASN 2 13 ? ? ? A . n A 1 3 MET 3 14 ? ? ? A . n A 1 4 SER 4 15 ? ? ? A . n A 1 5 GLY 5 16 ? ? ? A . n A 1 6 GLY 6 17 ? ? ? A . n A 1 7 GLY 7 18 ? ? ? A . n A 1 8 GLU 8 19 ? ? ? A . n A 1 9 GLN 9 20 ? ? ? A . n A 1 10 ALA 10 21 21 ALA ALA A . n A 1 11 ASP 11 22 22 ASP ASP A . n A 1 12 ILE 12 23 23 ILE ILE A . n A 1 13 LEU 13 24 24 LEU LEU A . n A 1 14 PRO 14 25 25 PRO PRO A . n A 1 15 ALA 15 26 26 ALA ALA A . n A 1 16 ASN 16 27 27 ASN ASN A . n A 1 17 TYR 17 28 28 TYR TYR A . n A 1 18 VAL 18 29 29 VAL VAL A . n A 1 19 VAL 19 30 30 VAL VAL A . n A 1 20 LYS 20 31 31 LYS LYS A . n A 1 21 ASP 21 32 32 ASP ASP A . n A 1 22 ARG 22 33 33 ARG ARG A . n A 1 23 TRP 23 34 34 TRP TRP A . n A 1 24 LYS 24 35 35 LYS LYS A . n A 1 25 VAL 25 36 36 VAL VAL A . n A 1 26 LEU 26 37 37 LEU LEU A . n A 1 27 LYS 27 38 38 LYS LYS A . n A 1 28 LYS 28 39 39 LYS LYS A . n A 1 29 ILE 29 40 40 ILE ILE A . n A 1 30 GLY 30 41 41 GLY GLY A . n A 1 31 GLY 31 42 42 GLY GLY A . n A 1 32 GLY 32 43 43 GLY GLY A . n A 1 33 GLY 33 44 44 GLY GLY A . n A 1 34 PHE 34 45 45 PHE PHE A . n A 1 35 GLY 35 46 46 GLY GLY A . n A 1 36 GLU 36 47 47 GLU GLU A . n A 1 37 ILE 37 48 48 ILE ILE A . n A 1 38 TYR 38 49 49 TYR TYR A . n A 1 39 GLU 39 50 50 GLU GLU A . n A 1 40 ALA 40 51 51 ALA ALA A . n A 1 41 MET 41 52 52 MET MET A . n A 1 42 ASP 42 53 53 ASP ASP A . n A 1 43 LEU 43 54 54 LEU LEU A . n A 1 44 LEU 44 55 55 LEU LEU A . n A 1 45 THR 45 56 56 THR THR A . n A 1 46 ARG 46 57 57 ARG ARG A . n A 1 47 GLU 47 58 58 GLU GLU A . n A 1 48 ASN 48 59 59 ASN ASN A . n A 1 49 VAL 49 60 60 VAL VAL A . n A 1 50 ALA 50 61 61 ALA ALA A . n A 1 51 LEU 51 62 62 LEU LEU A . n A 1 52 LYS 52 63 63 LYS LYS A . n A 1 53 VAL 53 64 64 VAL VAL A . n A 1 54 GLU 54 65 65 GLU GLU A . n A 1 55 SER 55 66 66 SER SER A . n A 1 56 ALA 56 67 67 ALA ALA A . n A 1 57 GLN 57 68 68 GLN GLN A . n A 1 58 GLN 58 69 69 GLN GLN A . n A 1 59 PRO 59 70 70 PRO PRO A . n A 1 60 LYS 60 71 71 LYS LYS A . n A 1 61 GLN 61 72 72 GLN GLN A . n A 1 62 VAL 62 73 73 VAL VAL A . n A 1 63 LEU 63 74 74 LEU LEU A . n A 1 64 LYS 64 75 75 LYS LYS A . n A 1 65 MET 65 76 76 MET MET A . n A 1 66 GLU 66 77 77 GLU GLU A . n A 1 67 VAL 67 78 78 VAL VAL A . n A 1 68 ALA 68 79 79 ALA ALA A . n A 1 69 VAL 69 80 80 VAL VAL A . n A 1 70 LEU 70 81 81 LEU LEU A . n A 1 71 LYS 71 82 82 LYS LYS A . n A 1 72 LYS 72 83 83 LYS LYS A . n A 1 73 LEU 73 84 84 LEU LEU A . n A 1 74 GLN 74 85 85 GLN GLN A . n A 1 75 GLY 75 86 86 GLY GLY A . n A 1 76 LYS 76 87 87 LYS LYS A . n A 1 77 ASP 77 88 88 ASP ASP A . n A 1 78 HIS 78 89 89 HIS HIS A . n A 1 79 VAL 79 90 90 VAL VAL A . n A 1 80 CYS 80 91 91 CYS CYS A . n A 1 81 ARG 81 92 92 ARG ARG A . n A 1 82 PHE 82 93 93 PHE PHE A . n A 1 83 ILE 83 94 94 ILE ILE A . n A 1 84 GLY 84 95 95 GLY GLY A . n A 1 85 CYS 85 96 96 CYS CYS A . n A 1 86 GLY 86 97 97 GLY GLY A . n A 1 87 ARG 87 98 98 ARG ARG A . n A 1 88 ASN 88 99 99 ASN ASN A . n A 1 89 GLU 89 100 100 GLU GLU A . n A 1 90 LYS 90 101 101 LYS LYS A . n A 1 91 PHE 91 102 102 PHE PHE A . n A 1 92 ASN 92 103 103 ASN ASN A . n A 1 93 TYR 93 104 104 TYR TYR A . n A 1 94 VAL 94 105 105 VAL VAL A . n A 1 95 VAL 95 106 106 VAL VAL A . n A 1 96 MET 96 107 107 MET MET A . n A 1 97 GLN 97 108 108 GLN GLN A . n A 1 98 LEU 98 109 109 LEU LEU A . n A 1 99 GLN 99 110 110 GLN GLN A . n A 1 100 GLY 100 111 111 GLY GLY A . n A 1 101 ARG 101 112 112 ARG ARG A . n A 1 102 ASN 102 113 113 ASN ASN A . n A 1 103 LEU 103 114 114 LEU LEU A . n A 1 104 ALA 104 115 115 ALA ALA A . n A 1 105 ASP 105 116 116 ASP ASP A . n A 1 106 LEU 106 117 117 LEU LEU A . n A 1 107 ARG 107 118 118 ARG ARG A . n A 1 108 ARG 108 119 119 ARG ARG A . n A 1 109 SER 109 120 120 SER SER A . n A 1 110 GLN 110 121 121 GLN GLN A . n A 1 111 PRO 111 122 122 PRO PRO A . n A 1 112 ARG 112 123 123 ARG ARG A . n A 1 113 GLY 113 124 124 GLY GLY A . n A 1 114 THR 114 125 125 THR THR A . n A 1 115 PHE 115 126 126 PHE PHE A . n A 1 116 THR 116 127 127 THR THR A . n A 1 117 LEU 117 128 128 LEU LEU A . n A 1 118 SER 118 129 129 SER SER A . n A 1 119 THR 119 130 130 THR THR A . n A 1 120 THR 120 131 131 THR THR A . n A 1 121 LEU 121 132 132 LEU LEU A . n A 1 122 ARG 122 133 133 ARG ARG A . n A 1 123 LEU 123 134 134 LEU LEU A . n A 1 124 GLY 124 135 135 GLY GLY A . n A 1 125 LYS 125 136 136 LYS LYS A . n A 1 126 GLN 126 137 137 GLN GLN A . n A 1 127 ILE 127 138 138 ILE ILE A . n A 1 128 LEU 128 139 139 LEU LEU A . n A 1 129 GLU 129 140 140 GLU GLU A . n A 1 130 SER 130 141 141 SER SER A . n A 1 131 ILE 131 142 142 ILE ILE A . n A 1 132 GLU 132 143 143 GLU GLU A . n A 1 133 ALA 133 144 144 ALA ALA A . n A 1 134 ILE 134 145 145 ILE ILE A . n A 1 135 HIS 135 146 146 HIS HIS A . n A 1 136 SER 136 147 147 SER SER A . n A 1 137 VAL 137 148 148 VAL VAL A . n A 1 138 GLY 138 149 149 GLY GLY A . n A 1 139 PHE 139 150 150 PHE PHE A . n A 1 140 LEU 140 151 151 LEU LEU A . n A 1 141 HIS 141 152 152 HIS HIS A . n A 1 142 ARG 142 153 153 ARG ARG A . n A 1 143 ASP 143 154 154 ASP ASP A . n A 1 144 ILE 144 155 155 ILE ILE A . n A 1 145 LYS 145 156 156 LYS LYS A . n A 1 146 PRO 146 157 157 PRO PRO A . n A 1 147 SER 147 158 158 SER SER A . n A 1 148 ASN 148 159 159 ASN ASN A . n A 1 149 PHE 149 160 160 PHE PHE A . n A 1 150 ALA 150 161 161 ALA ALA A . n A 1 151 MET 151 162 162 MET MET A . n A 1 152 GLY 152 163 163 GLY GLY A . n A 1 153 ARG 153 164 164 ARG ARG A . n A 1 154 LEU 154 165 165 LEU LEU A . n A 1 155 PRO 155 166 166 PRO PRO A . n A 1 156 SER 156 167 167 SER SER A . n A 1 157 THR 157 168 168 THR THR A . n A 1 158 TYR 158 169 169 TYR TYR A . n A 1 159 ARG 159 170 170 ARG ARG A . n A 1 160 LYS 160 171 171 LYS LYS A . n A 1 161 CYS 161 172 172 CYS CYS A . n A 1 162 TYR 162 173 173 TYR TYR A . n A 1 163 MET 163 174 174 MET MET A . n A 1 164 LEU 164 175 175 LEU LEU A . n A 1 165 ASP 165 176 176 ASP ASP A . n A 1 166 PHE 166 177 177 PHE PHE A . n A 1 167 GLY 167 178 178 GLY GLY A . n A 1 168 LEU 168 179 179 LEU LEU A . n A 1 169 ALA 169 180 180 ALA ALA A . n A 1 170 ARG 170 181 181 ARG ARG A . n A 1 171 GLN 171 182 182 GLN GLN A . n A 1 172 TYR 172 183 183 TYR TYR A . n A 1 173 THR 173 184 184 THR THR A . n A 1 174 ASN 174 185 185 ASN ASN A . n A 1 175 THR 175 186 186 THR THR A . n A 1 176 THR 176 187 187 THR THR A . n A 1 177 GLY 177 188 188 GLY GLY A . n A 1 178 ASP 178 189 189 ASP ASP A . n A 1 179 VAL 179 190 190 VAL VAL A . n A 1 180 ARG 180 191 191 ARG ARG A . n A 1 181 PRO 181 192 192 PRO PRO A . n A 1 182 PRO 182 193 193 PRO PRO A . n A 1 183 ARG 183 194 194 ARG ARG A . n A 1 184 ASN 184 195 195 ASN ASN A . n A 1 185 VAL 185 196 196 VAL VAL A . n A 1 186 ALA 186 197 197 ALA ALA A . n A 1 187 GLY 187 198 198 GLY GLY A . n A 1 188 PHE 188 199 199 PHE PHE A . n A 1 189 ARG 189 200 200 ARG ARG A . n A 1 190 GLY 190 201 201 GLY GLY A . n A 1 191 THR 191 202 202 THR THR A . n A 1 192 VAL 192 203 203 VAL VAL A . n A 1 193 ARG 193 204 204 ARG ARG A . n A 1 194 TYR 194 205 205 TYR TYR A . n A 1 195 ALA 195 206 206 ALA ALA A . n A 1 196 SER 196 207 207 SER SER A . n A 1 197 VAL 197 208 208 VAL VAL A . n A 1 198 ASN 198 209 209 ASN ASN A . n A 1 199 ALA 199 210 210 ALA ALA A . n A 1 200 HIS 200 211 211 HIS HIS A . n A 1 201 LYS 201 212 212 LYS LYS A . n A 1 202 ASN 202 213 213 ASN ASN A . n A 1 203 ARG 203 214 214 ARG ARG A . n A 1 204 GLU 204 215 215 GLU GLU A . n A 1 205 MET 205 216 216 MET MET A . n A 1 206 GLY 206 217 217 GLY GLY A . n A 1 207 ARG 207 218 218 ARG ARG A . n A 1 208 HIS 208 219 219 HIS HIS A . n A 1 209 ASP 209 220 220 ASP ASP A . n A 1 210 ASP 210 221 221 ASP ASP A . n A 1 211 LEU 211 222 222 LEU LEU A . n A 1 212 TRP 212 223 223 TRP TRP A . n A 1 213 SER 213 224 224 SER SER A . n A 1 214 LEU 214 225 225 LEU LEU A . n A 1 215 PHE 215 226 226 PHE PHE A . n A 1 216 TYR 216 227 227 TYR TYR A . n A 1 217 MET 217 228 228 MET MET A . n A 1 218 LEU 218 229 229 LEU LEU A . n A 1 219 VAL 219 230 230 VAL VAL A . n A 1 220 GLU 220 231 231 GLU GLU A . n A 1 221 PHE 221 232 232 PHE PHE A . n A 1 222 ALA 222 233 233 ALA ALA A . n A 1 223 VAL 223 234 234 VAL VAL A . n A 1 224 GLY 224 235 235 GLY GLY A . n A 1 225 GLN 225 236 236 GLN GLN A . n A 1 226 LEU 226 237 237 LEU LEU A . n A 1 227 PRO 227 238 238 PRO PRO A . n A 1 228 TRP 228 239 239 TRP TRP A . n A 1 229 ARG 229 240 240 ARG ARG A . n A 1 230 LYS 230 241 241 LYS LYS A . n A 1 231 ILE 231 242 242 ILE ILE A . n A 1 232 LYS 232 243 243 LYS LYS A . n A 1 233 ASP 233 244 244 ASP ASP A . n A 1 234 LYS 234 245 245 LYS LYS A . n A 1 235 GLU 235 246 246 GLU GLU A . n A 1 236 GLN 236 247 247 GLN GLN A . n A 1 237 VAL 237 248 248 VAL VAL A . n A 1 238 GLY 238 249 249 GLY GLY A . n A 1 239 MET 239 250 250 MET MET A . n A 1 240 ILE 240 251 251 ILE ILE A . n A 1 241 LYS 241 252 252 LYS LYS A . n A 1 242 GLU 242 253 253 GLU GLU A . n A 1 243 LYS 243 254 254 LYS LYS A . n A 1 244 TYR 244 255 255 TYR TYR A . n A 1 245 GLU 245 256 256 GLU GLU A . n A 1 246 HIS 246 257 257 HIS HIS A . n A 1 247 ARG 247 258 258 ARG ARG A . n A 1 248 MET 248 259 259 MET MET A . n A 1 249 LEU 249 260 260 LEU LEU A . n A 1 250 LEU 250 261 261 LEU LEU A . n A 1 251 LYS 251 262 262 LYS LYS A . n A 1 252 HIS 252 263 263 HIS HIS A . n A 1 253 MET 253 264 264 MET MET A . n A 1 254 PRO 254 265 265 PRO PRO A . n A 1 255 SER 255 266 266 SER SER A . n A 1 256 GLU 256 267 267 GLU GLU A . n A 1 257 PHE 257 268 268 PHE PHE A . n A 1 258 HIS 258 269 269 HIS HIS A . n A 1 259 LEU 259 270 270 LEU LEU A . n A 1 260 PHE 260 271 271 PHE PHE A . n A 1 261 LEU 261 272 272 LEU LEU A . n A 1 262 ASP 262 273 273 ASP ASP A . n A 1 263 HIS 263 274 274 HIS HIS A . n A 1 264 ILE 264 275 275 ILE ILE A . n A 1 265 ALA 265 276 276 ALA ALA A . n A 1 266 SER 266 277 277 SER SER A . n A 1 267 LEU 267 278 278 LEU LEU A . n A 1 268 ASP 268 279 279 ASP ASP A . n A 1 269 TYR 269 280 280 TYR TYR A . n A 1 270 PHE 270 281 281 PHE PHE A . n A 1 271 THR 271 282 282 THR THR A . n A 1 272 LYS 272 283 283 LYS LYS A . n A 1 273 PRO 273 284 284 PRO PRO A . n A 1 274 ASP 274 285 285 ASP ASP A . n A 1 275 TYR 275 286 286 TYR TYR A . n A 1 276 GLN 276 287 287 GLN GLN A . n A 1 277 LEU 277 288 288 LEU LEU A . n A 1 278 ILE 278 289 289 ILE ILE A . n A 1 279 MET 279 290 290 MET MET A . n A 1 280 SER 280 291 291 SER SER A . n A 1 281 VAL 281 292 292 VAL VAL A . n A 1 282 PHE 282 293 293 PHE PHE A . n A 1 283 GLU 283 294 294 GLU GLU A . n A 1 284 ASN 284 295 295 ASN ASN A . n A 1 285 SER 285 296 296 SER SER A . n A 1 286 MET 286 297 297 MET MET A . n A 1 287 LYS 287 298 298 LYS LYS A . n A 1 288 GLU 288 299 299 GLU GLU A . n A 1 289 ARG 289 300 300 ARG ARG A . n A 1 290 GLY 290 301 301 GLY GLY A . n A 1 291 ILE 291 302 302 ILE ILE A . n A 1 292 ALA 292 303 303 ALA ALA A . n A 1 293 GLU 293 304 304 GLU GLU A . n A 1 294 ASN 294 305 305 ASN ASN A . n A 1 295 GLU 295 306 306 GLU GLU A . n A 1 296 ALA 296 307 307 ALA ALA A . n A 1 297 PHE 297 308 308 PHE PHE A . n A 1 298 ASP 298 309 309 ASP ASP A . n A 1 299 TRP 299 310 310 TRP TRP A . n A 1 300 GLU 300 311 311 GLU GLU A . n A 1 301 LYS 301 312 312 LYS LYS A . n A 1 302 ALA 302 313 313 ALA ALA A . n A 1 303 GLY 303 314 ? ? ? A . n A 1 304 THR 304 315 ? ? ? A . n A 1 305 ASP 305 316 ? ? ? A . n A 1 306 ALA 306 317 ? ? ? A . n A 1 307 LEU 307 318 ? ? ? A . n A 1 308 LEU 308 319 ? ? ? A . n A 1 309 SER 309 320 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1IU7 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1IU7 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 A1IU7 1 401 401 A1IU7 LIG A . C 3 HOH 1 501 14 HOH HOH A . C 3 HOH 2 502 6 HOH HOH A . C 3 HOH 3 503 13 HOH HOH A . C 3 HOH 4 504 11 HOH HOH A . C 3 HOH 5 505 17 HOH HOH A . C 3 HOH 6 506 18 HOH HOH A . C 3 HOH 7 507 5 HOH HOH A . C 3 HOH 8 508 12 HOH HOH A . C 3 HOH 9 509 15 HOH HOH A . C 3 HOH 10 510 3 HOH HOH A . C 3 HOH 11 511 10 HOH HOH A . C 3 HOH 12 512 2 HOH HOH A . C 3 HOH 13 513 4 HOH HOH A . C 3 HOH 14 514 1 HOH HOH A . C 3 HOH 15 515 9 HOH HOH A . C 3 HOH 16 516 16 HOH HOH A . C 3 HOH 17 517 7 HOH HOH A . C 3 HOH 18 518 8 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 200 ? CG ? A ARG 189 CG 2 1 Y 1 A ARG 200 ? CD ? A ARG 189 CD 3 1 Y 1 A ARG 200 ? NE ? A ARG 189 NE 4 1 Y 1 A ARG 200 ? CZ ? A ARG 189 CZ 5 1 Y 1 A ARG 200 ? NH1 ? A ARG 189 NH1 6 1 Y 1 A ARG 200 ? NH2 ? A ARG 189 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0425 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 93.30 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9HHW _cell.details ? _cell.formula_units_Z ? _cell.length_a 49.641 _cell.length_a_esd ? _cell.length_b 39.954 _cell.length_b_esd ? _cell.length_c 166.667 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9HHW _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9HHW _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.32 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.05 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '17% PEG 3350, 0.2 M sodium acetate pH 7.0 and 0.1 M tris pH 7.5-9.0' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-02-10 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.999995 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.999995 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9HHW _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3 _reflns.d_resolution_low 48.26 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6759 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.7 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.977 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 3 _reflns_shell.d_res_low 3.18 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1077 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.772 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -7.24 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] -0.20 _refine.aniso_B[2][2] 1.68 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] 5.54 _refine.B_iso_max ? _refine.B_iso_mean 36.710 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.899 _refine.correlation_coeff_Fo_to_Fc_free 0.808 _refine.details 'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9HHW _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.00 _refine.ls_d_res_low 48.26 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6426 _refine.ls_number_reflns_R_free 332 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.78 _refine.ls_percent_reflns_R_free 4.9 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.23429 _refine.ls_R_factor_R_free 0.28592 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.23162 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.537 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 25.236 _refine.overall_SU_ML 0.445 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 3.00 _refine_hist.d_res_low 48.26 _refine_hist.number_atoms_solvent 18 _refine_hist.number_atoms_total 2417 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2379 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 20 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 0.012 2470 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.016 2385 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.818 1.857 3324 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.551 1.785 5477 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.309 5.000 298 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 18.754 6.731 26 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 16.728 10.000 460 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.074 0.200 348 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 2934 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 611 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 2.720 3.491 1177 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.719 3.491 1177 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 4.643 6.262 1471 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 4.641 6.266 1472 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.645 3.858 1293 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.644 3.863 1294 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 4.659 6.950 1851 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 10.671 41.75 10329 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 10.670 41.75 10330 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 3.000 _refine_ls_shell.d_res_low 3.078 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 22 _refine_ls_shell.number_reflns_R_work 482 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.339 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.230 # _struct.entry_id 9HHW _struct.title 'Crystal structure of TTBK1 with a covalent compound GCL95' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9HHW _struct_keywords.text 'Kinase, Covalent, inhibitor, TTBK1, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TTBK1_HUMAN _struct_ref.pdbx_db_accession Q5TCY1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NMSGGGEQADILPANYVVKDRWKVLKKIGGGGFGEIYEAMDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCR FIGCGRNEKFNYVVMQLQGRNLADLRRSQPRGTFTLSTTLRLGKQILESIEAIHSVGFLHRDIKPSNFAMGRLPSTYRKC YMLDFGLARQYTNTTGDVRPPRNVAGFRGTVRYASVNAHKNREMGRHDDLWSLFYMLVEFAVGQLPWRKIKDKEQVGMIK EKYEHRMLLKHMPSEFHLFLDHIASLDYFTKPDYQLIMSVFENSMKERGIAENEAFDWEKAGTDALLS ; _struct_ref.pdbx_align_begin 13 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9HHW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 309 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5TCY1 _struct_ref_seq.db_align_beg 13 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 320 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 13 _struct_ref_seq.pdbx_auth_seq_align_end 320 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 9HHW _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q5TCY1 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 12 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 VAL A 62 ? LEU A 73 ? VAL A 73 LEU A 84 1 ? 12 HELX_P HELX_P2 AA2 ASN A 102 ? GLN A 110 ? ASN A 113 GLN A 121 1 ? 9 HELX_P HELX_P3 AA3 THR A 116 ? VAL A 137 ? THR A 127 VAL A 148 1 ? 22 HELX_P HELX_P4 AA4 LYS A 145 ? SER A 147 ? LYS A 156 SER A 158 5 ? 3 HELX_P HELX_P5 AA5 THR A 191 ? ALA A 195 ? THR A 202 ALA A 206 5 ? 5 HELX_P HELX_P6 AA6 SER A 196 ? LYS A 201 ? SER A 207 LYS A 212 1 ? 6 HELX_P HELX_P7 AA7 GLY A 206 ? GLY A 224 ? GLY A 217 GLY A 235 1 ? 19 HELX_P HELX_P8 AA8 ASP A 233 ? TYR A 244 ? ASP A 244 TYR A 255 1 ? 12 HELX_P HELX_P9 AA9 GLU A 245 ? HIS A 252 ? GLU A 256 HIS A 263 5 ? 8 HELX_P HELX_P10 AB1 GLU A 256 ? ALA A 265 ? GLU A 267 ALA A 276 1 ? 10 HELX_P HELX_P11 AB2 ASP A 274 ? GLU A 288 ? ASP A 285 GLU A 299 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 80 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id A1IU7 _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C1 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 91 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id A1IU7 _struct_conn.ptnr2_auth_seq_id 401 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.772 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id A1IU7 _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 80 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id A1IU7 _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 401 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 91 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom C1 _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id A1IU7 _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Covalent chemical modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 18 ? VAL A 19 ? VAL A 29 VAL A 30 AA1 2 TRP A 23 ? GLY A 30 ? TRP A 34 GLY A 41 AA1 3 GLU A 36 ? ASP A 42 ? GLU A 47 ASP A 53 AA1 4 ASN A 48 ? SER A 55 ? ASN A 59 SER A 66 AA1 5 PHE A 91 ? GLN A 97 ? PHE A 102 GLN A 108 AA1 6 PHE A 82 ? ASN A 88 ? PHE A 93 ASN A 99 AA2 1 PHE A 139 ? LEU A 140 ? PHE A 150 LEU A 151 AA2 2 ARG A 170 ? GLN A 171 ? ARG A 181 GLN A 182 AA3 1 PHE A 149 ? MET A 151 ? PHE A 160 MET A 162 AA3 2 CYS A 161 ? MET A 163 ? CYS A 172 MET A 174 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 19 ? N VAL A 30 O TRP A 23 ? O TRP A 34 AA1 2 3 N LEU A 26 ? N LEU A 37 O GLU A 39 ? O GLU A 50 AA1 3 4 N TYR A 38 ? N TYR A 49 O LEU A 51 ? O LEU A 62 AA1 4 5 N GLU A 54 ? N GLU A 65 O ASN A 92 ? O ASN A 103 AA1 5 6 O VAL A 95 ? O VAL A 106 N GLY A 84 ? N GLY A 95 AA2 1 2 N LEU A 140 ? N LEU A 151 O ARG A 170 ? O ARG A 181 AA3 1 2 N ALA A 150 ? N ALA A 161 O TYR A 162 ? O TYR A 173 # _pdbx_entry_details.entry_id 9HHW _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 33 ? ? -157.82 -25.00 2 1 ILE A 40 ? ? -133.63 -31.92 3 1 ARG A 57 ? ? 82.64 -4.14 4 1 GLN A 69 ? ? -36.09 128.77 5 1 HIS A 89 ? ? 80.19 14.78 6 1 GLU A 100 ? ? -75.69 26.44 7 1 PHE A 102 ? ? -172.74 142.59 8 1 THR A 127 ? ? -57.75 175.24 9 1 ARG A 153 ? ? 68.09 -25.52 10 1 SER A 158 ? ? -52.70 -9.44 11 1 THR A 168 ? ? -143.70 -9.44 12 1 ASP A 176 ? ? 63.39 128.70 13 1 THR A 187 ? ? -70.54 -88.37 14 1 ALA A 197 ? ? -162.93 113.04 15 1 PRO A 265 ? ? -37.65 143.84 16 1 GLU A 299 ? ? -63.69 31.03 17 1 ARG A 300 ? ? -161.30 4.88 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 181 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.157 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 12 ? A MET 1 2 1 Y 1 A ASN 13 ? A ASN 2 3 1 Y 1 A MET 14 ? A MET 3 4 1 Y 1 A SER 15 ? A SER 4 5 1 Y 1 A GLY 16 ? A GLY 5 6 1 Y 1 A GLY 17 ? A GLY 6 7 1 Y 1 A GLY 18 ? A GLY 7 8 1 Y 1 A GLU 19 ? A GLU 8 9 1 Y 1 A GLN 20 ? A GLN 9 10 1 Y 1 A GLY 314 ? A GLY 303 11 1 Y 1 A THR 315 ? A THR 304 12 1 Y 1 A ASP 316 ? A ASP 305 13 1 Y 1 A ALA 317 ? A ALA 306 14 1 Y 1 A LEU 318 ? A LEU 307 15 1 Y 1 A LEU 319 ? A LEU 308 16 1 Y 1 A SER 320 ? A SER 309 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1IU7 N1 N N N 1 A1IU7 N3 N Y N 2 A1IU7 C4 C Y N 3 A1IU7 C5 C Y N 4 A1IU7 C6 C Y N 5 A1IU7 C7 C Y N 6 A1IU7 C8 C Y N 7 A1IU7 C10 C Y N 8 A1IU7 C13 C Y N 9 A1IU7 C15 C Y N 10 A1IU7 C1 C N N 11 A1IU7 C2 C N N 12 A1IU7 C3 C N N 13 A1IU7 O1 O N N 14 A1IU7 C9 C Y N 15 A1IU7 C11 C Y N 16 A1IU7 N2 N Y N 17 A1IU7 C12 C Y N 18 A1IU7 C14 C Y N 19 A1IU7 C16 C Y N 20 A1IU7 H1 H N N 21 A1IU7 H2 H N N 22 A1IU7 H3 H N N 23 A1IU7 H4 H N N 24 A1IU7 H5 H N N 25 A1IU7 H6 H N N 26 A1IU7 H7 H N N 27 A1IU7 H8 H N N 28 A1IU7 H9 H N N 29 A1IU7 H10 H N N 30 A1IU7 H11 H N N 31 A1IU7 H12 H N N 32 A1IU7 H13 H N N 33 A1IU7 H14 H N N 34 A1IU7 H15 H N N 35 ALA N N N N 36 ALA CA C N S 37 ALA C C N N 38 ALA O O N N 39 ALA CB C N N 40 ALA OXT O N N 41 ALA H H N N 42 ALA H2 H N N 43 ALA HA H N N 44 ALA HB1 H N N 45 ALA HB2 H N N 46 ALA HB3 H N N 47 ALA HXT H N N 48 ARG N N N N 49 ARG CA C N S 50 ARG C C N N 51 ARG O O N N 52 ARG CB C N N 53 ARG CG C N N 54 ARG CD C N N 55 ARG NE N N N 56 ARG CZ C N N 57 ARG NH1 N N N 58 ARG NH2 N N N 59 ARG OXT O N N 60 ARG H H N N 61 ARG H2 H N N 62 ARG HA H N N 63 ARG HB2 H N N 64 ARG HB3 H N N 65 ARG HG2 H N N 66 ARG HG3 H N N 67 ARG HD2 H N N 68 ARG HD3 H N N 69 ARG HE H N N 70 ARG HH11 H N N 71 ARG HH12 H N N 72 ARG HH21 H N N 73 ARG HH22 H N N 74 ARG HXT H N N 75 ASN N N N N 76 ASN CA C N S 77 ASN C C N N 78 ASN O O N N 79 ASN CB C N N 80 ASN CG C N N 81 ASN OD1 O N N 82 ASN ND2 N N N 83 ASN OXT O N N 84 ASN H H N N 85 ASN H2 H N N 86 ASN HA H N N 87 ASN HB2 H N N 88 ASN HB3 H N N 89 ASN HD21 H N N 90 ASN HD22 H N N 91 ASN HXT H N N 92 ASP N N N N 93 ASP CA C N S 94 ASP C C N N 95 ASP O O N N 96 ASP CB C N N 97 ASP CG C N N 98 ASP OD1 O N N 99 ASP OD2 O N N 100 ASP OXT O N N 101 ASP H H N N 102 ASP H2 H N N 103 ASP HA H N N 104 ASP HB2 H N N 105 ASP HB3 H N N 106 ASP HD2 H N N 107 ASP HXT H N N 108 CYS N N N N 109 CYS CA C N R 110 CYS C C N N 111 CYS O O N N 112 CYS CB C N N 113 CYS SG S N N 114 CYS OXT O N N 115 CYS H H N N 116 CYS H2 H N N 117 CYS HA H N N 118 CYS HB2 H N N 119 CYS HB3 H N N 120 CYS HG H N N 121 CYS HXT H N N 122 GLN N N N N 123 GLN CA C N S 124 GLN C C N N 125 GLN O O N N 126 GLN CB C N N 127 GLN CG C N N 128 GLN CD C N N 129 GLN OE1 O N N 130 GLN NE2 N N N 131 GLN OXT O N N 132 GLN H H N N 133 GLN H2 H N N 134 GLN HA H N N 135 GLN HB2 H N N 136 GLN HB3 H N N 137 GLN HG2 H N N 138 GLN HG3 H N N 139 GLN HE21 H N N 140 GLN HE22 H N N 141 GLN HXT H N N 142 GLU N N N N 143 GLU CA C N S 144 GLU C C N N 145 GLU O O N N 146 GLU CB C N N 147 GLU CG C N N 148 GLU CD C N N 149 GLU OE1 O N N 150 GLU OE2 O N N 151 GLU OXT O N N 152 GLU H H N N 153 GLU H2 H N N 154 GLU HA H N N 155 GLU HB2 H N N 156 GLU HB3 H N N 157 GLU HG2 H N N 158 GLU HG3 H N N 159 GLU HE2 H N N 160 GLU HXT H N N 161 GLY N N N N 162 GLY CA C N N 163 GLY C C N N 164 GLY O O N N 165 GLY OXT O N N 166 GLY H H N N 167 GLY H2 H N N 168 GLY HA2 H N N 169 GLY HA3 H N N 170 GLY HXT H N N 171 HIS N N N N 172 HIS CA C N S 173 HIS C C N N 174 HIS O O N N 175 HIS CB C N N 176 HIS CG C Y N 177 HIS ND1 N Y N 178 HIS CD2 C Y N 179 HIS CE1 C Y N 180 HIS NE2 N Y N 181 HIS OXT O N N 182 HIS H H N N 183 HIS H2 H N N 184 HIS HA H N N 185 HIS HB2 H N N 186 HIS HB3 H N N 187 HIS HD1 H N N 188 HIS HD2 H N N 189 HIS HE1 H N N 190 HIS HE2 H N N 191 HIS HXT H N N 192 HOH O O N N 193 HOH H1 H N N 194 HOH H2 H N N 195 ILE N N N N 196 ILE CA C N S 197 ILE C C N N 198 ILE O O N N 199 ILE CB C N S 200 ILE CG1 C N N 201 ILE CG2 C N N 202 ILE CD1 C N N 203 ILE OXT O N N 204 ILE H H N N 205 ILE H2 H N N 206 ILE HA H N N 207 ILE HB H N N 208 ILE HG12 H N N 209 ILE HG13 H N N 210 ILE HG21 H N N 211 ILE HG22 H N N 212 ILE HG23 H N N 213 ILE HD11 H N N 214 ILE HD12 H N N 215 ILE HD13 H N N 216 ILE HXT H N N 217 LEU N N N N 218 LEU CA C N S 219 LEU C C N N 220 LEU O O N N 221 LEU CB C N N 222 LEU CG C N N 223 LEU CD1 C N N 224 LEU CD2 C N N 225 LEU OXT O N N 226 LEU H H N N 227 LEU H2 H N N 228 LEU HA H N N 229 LEU HB2 H N N 230 LEU HB3 H N N 231 LEU HG H N N 232 LEU HD11 H N N 233 LEU HD12 H N N 234 LEU HD13 H N N 235 LEU HD21 H N N 236 LEU HD22 H N N 237 LEU HD23 H N N 238 LEU HXT H N N 239 LYS N N N N 240 LYS CA C N S 241 LYS C C N N 242 LYS O O N N 243 LYS CB C N N 244 LYS CG C N N 245 LYS CD C N N 246 LYS CE C N N 247 LYS NZ N N N 248 LYS OXT O N N 249 LYS H H N N 250 LYS H2 H N N 251 LYS HA H N N 252 LYS HB2 H N N 253 LYS HB3 H N N 254 LYS HG2 H N N 255 LYS HG3 H N N 256 LYS HD2 H N N 257 LYS HD3 H N N 258 LYS HE2 H N N 259 LYS HE3 H N N 260 LYS HZ1 H N N 261 LYS HZ2 H N N 262 LYS HZ3 H N N 263 LYS HXT H N N 264 MET N N N N 265 MET CA C N S 266 MET C C N N 267 MET O O N N 268 MET CB C N N 269 MET CG C N N 270 MET SD S N N 271 MET CE C N N 272 MET OXT O N N 273 MET H H N N 274 MET H2 H N N 275 MET HA H N N 276 MET HB2 H N N 277 MET HB3 H N N 278 MET HG2 H N N 279 MET HG3 H N N 280 MET HE1 H N N 281 MET HE2 H N N 282 MET HE3 H N N 283 MET HXT H N N 284 PHE N N N N 285 PHE CA C N S 286 PHE C C N N 287 PHE O O N N 288 PHE CB C N N 289 PHE CG C Y N 290 PHE CD1 C Y N 291 PHE CD2 C Y N 292 PHE CE1 C Y N 293 PHE CE2 C Y N 294 PHE CZ C Y N 295 PHE OXT O N N 296 PHE H H N N 297 PHE H2 H N N 298 PHE HA H N N 299 PHE HB2 H N N 300 PHE HB3 H N N 301 PHE HD1 H N N 302 PHE HD2 H N N 303 PHE HE1 H N N 304 PHE HE2 H N N 305 PHE HZ H N N 306 PHE HXT H N N 307 PRO N N N N 308 PRO CA C N S 309 PRO C C N N 310 PRO O O N N 311 PRO CB C N N 312 PRO CG C N N 313 PRO CD C N N 314 PRO OXT O N N 315 PRO H H N N 316 PRO HA H N N 317 PRO HB2 H N N 318 PRO HB3 H N N 319 PRO HG2 H N N 320 PRO HG3 H N N 321 PRO HD2 H N N 322 PRO HD3 H N N 323 PRO HXT H N N 324 SER N N N N 325 SER CA C N S 326 SER C C N N 327 SER O O N N 328 SER CB C N N 329 SER OG O N N 330 SER OXT O N N 331 SER H H N N 332 SER H2 H N N 333 SER HA H N N 334 SER HB2 H N N 335 SER HB3 H N N 336 SER HG H N N 337 SER HXT H N N 338 THR N N N N 339 THR CA C N S 340 THR C C N N 341 THR O O N N 342 THR CB C N R 343 THR OG1 O N N 344 THR CG2 C N N 345 THR OXT O N N 346 THR H H N N 347 THR H2 H N N 348 THR HA H N N 349 THR HB H N N 350 THR HG1 H N N 351 THR HG21 H N N 352 THR HG22 H N N 353 THR HG23 H N N 354 THR HXT H N N 355 TRP N N N N 356 TRP CA C N S 357 TRP C C N N 358 TRP O O N N 359 TRP CB C N N 360 TRP CG C Y N 361 TRP CD1 C Y N 362 TRP CD2 C Y N 363 TRP NE1 N Y N 364 TRP CE2 C Y N 365 TRP CE3 C Y N 366 TRP CZ2 C Y N 367 TRP CZ3 C Y N 368 TRP CH2 C Y N 369 TRP OXT O N N 370 TRP H H N N 371 TRP H2 H N N 372 TRP HA H N N 373 TRP HB2 H N N 374 TRP HB3 H N N 375 TRP HD1 H N N 376 TRP HE1 H N N 377 TRP HE3 H N N 378 TRP HZ2 H N N 379 TRP HZ3 H N N 380 TRP HH2 H N N 381 TRP HXT H N N 382 TYR N N N N 383 TYR CA C N S 384 TYR C C N N 385 TYR O O N N 386 TYR CB C N N 387 TYR CG C Y N 388 TYR CD1 C Y N 389 TYR CD2 C Y N 390 TYR CE1 C Y N 391 TYR CE2 C Y N 392 TYR CZ C Y N 393 TYR OH O N N 394 TYR OXT O N N 395 TYR H H N N 396 TYR H2 H N N 397 TYR HA H N N 398 TYR HB2 H N N 399 TYR HB3 H N N 400 TYR HD1 H N N 401 TYR HD2 H N N 402 TYR HE1 H N N 403 TYR HE2 H N N 404 TYR HH H N N 405 TYR HXT H N N 406 VAL N N N N 407 VAL CA C N S 408 VAL C C N N 409 VAL O O N N 410 VAL CB C N N 411 VAL CG1 C N N 412 VAL CG2 C N N 413 VAL OXT O N N 414 VAL H H N N 415 VAL H2 H N N 416 VAL HA H N N 417 VAL HB H N N 418 VAL HG11 H N N 419 VAL HG12 H N N 420 VAL HG13 H N N 421 VAL HG21 H N N 422 VAL HG22 H N N 423 VAL HG23 H N N 424 VAL HXT H N N 425 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1IU7 C13 N3 sing Y N 1 A1IU7 C13 C14 doub Y N 2 A1IU7 N3 C12 sing Y N 3 A1IU7 C14 C15 sing Y N 4 A1IU7 C12 N2 doub Y N 5 A1IU7 C12 C15 sing Y N 6 A1IU7 N2 C11 sing Y N 7 A1IU7 C15 C16 doub Y N 8 A1IU7 C11 C10 doub Y N 9 A1IU7 C16 C10 sing Y N 10 A1IU7 C10 C9 sing N N 11 A1IU7 C9 C8 doub Y N 12 A1IU7 C9 C4 sing Y N 13 A1IU7 C8 C7 sing Y N 14 A1IU7 C4 N1 sing N N 15 A1IU7 C4 C5 doub Y N 16 A1IU7 C7 C6 doub Y N 17 A1IU7 N1 C3 sing N N 18 A1IU7 C5 C6 sing Y N 19 A1IU7 C3 C2 sing N N 20 A1IU7 C3 O1 doub N N 21 A1IU7 C2 C1 sing N N 22 A1IU7 N1 H1 sing N N 23 A1IU7 N3 H2 sing N N 24 A1IU7 C5 H3 sing N N 25 A1IU7 C6 H4 sing N N 26 A1IU7 C7 H5 sing N N 27 A1IU7 C8 H6 sing N N 28 A1IU7 C13 H7 sing N N 29 A1IU7 C1 H8 sing N N 30 A1IU7 C1 H9 sing N N 31 A1IU7 C1 H10 sing N N 32 A1IU7 C2 H11 sing N N 33 A1IU7 C2 H12 sing N N 34 A1IU7 C11 H13 sing N N 35 A1IU7 C14 H14 sing N N 36 A1IU7 C16 H15 sing N N 37 ALA N CA sing N N 38 ALA N H sing N N 39 ALA N H2 sing N N 40 ALA CA C sing N N 41 ALA CA CB sing N N 42 ALA CA HA sing N N 43 ALA C O doub N N 44 ALA C OXT sing N N 45 ALA CB HB1 sing N N 46 ALA CB HB2 sing N N 47 ALA CB HB3 sing N N 48 ALA OXT HXT sing N N 49 ARG N CA sing N N 50 ARG N H sing N N 51 ARG N H2 sing N N 52 ARG CA C sing N N 53 ARG CA CB sing N N 54 ARG CA HA sing N N 55 ARG C O doub N N 56 ARG C OXT sing N N 57 ARG CB CG sing N N 58 ARG CB HB2 sing N N 59 ARG CB HB3 sing N N 60 ARG CG CD sing N N 61 ARG CG HG2 sing N N 62 ARG CG HG3 sing N N 63 ARG CD NE sing N N 64 ARG CD HD2 sing N N 65 ARG CD HD3 sing N N 66 ARG NE CZ sing N N 67 ARG NE HE sing N N 68 ARG CZ NH1 sing N N 69 ARG CZ NH2 doub N N 70 ARG NH1 HH11 sing N N 71 ARG NH1 HH12 sing N N 72 ARG NH2 HH21 sing N N 73 ARG NH2 HH22 sing N N 74 ARG OXT HXT sing N N 75 ASN N CA sing N N 76 ASN N H sing N N 77 ASN N H2 sing N N 78 ASN CA C sing N N 79 ASN CA CB sing N N 80 ASN CA HA sing N N 81 ASN C O doub N N 82 ASN C OXT sing N N 83 ASN CB CG sing N N 84 ASN CB HB2 sing N N 85 ASN CB HB3 sing N N 86 ASN CG OD1 doub N N 87 ASN CG ND2 sing N N 88 ASN ND2 HD21 sing N N 89 ASN ND2 HD22 sing N N 90 ASN OXT HXT sing N N 91 ASP N CA sing N N 92 ASP N H sing N N 93 ASP N H2 sing N N 94 ASP CA C sing N N 95 ASP CA CB sing N N 96 ASP CA HA sing N N 97 ASP C O doub N N 98 ASP C OXT sing N N 99 ASP CB CG sing N N 100 ASP CB HB2 sing N N 101 ASP CB HB3 sing N N 102 ASP CG OD1 doub N N 103 ASP CG OD2 sing N N 104 ASP OD2 HD2 sing N N 105 ASP OXT HXT sing N N 106 CYS N CA sing N N 107 CYS N H sing N N 108 CYS N H2 sing N N 109 CYS CA C sing N N 110 CYS CA CB sing N N 111 CYS CA HA sing N N 112 CYS C O doub N N 113 CYS C OXT sing N N 114 CYS CB SG sing N N 115 CYS CB HB2 sing N N 116 CYS CB HB3 sing N N 117 CYS SG HG sing N N 118 CYS OXT HXT sing N N 119 GLN N CA sing N N 120 GLN N H sing N N 121 GLN N H2 sing N N 122 GLN CA C sing N N 123 GLN CA CB sing N N 124 GLN CA HA sing N N 125 GLN C O doub N N 126 GLN C OXT sing N N 127 GLN CB CG sing N N 128 GLN CB HB2 sing N N 129 GLN CB HB3 sing N N 130 GLN CG CD sing N N 131 GLN CG HG2 sing N N 132 GLN CG HG3 sing N N 133 GLN CD OE1 doub N N 134 GLN CD NE2 sing N N 135 GLN NE2 HE21 sing N N 136 GLN NE2 HE22 sing N N 137 GLN OXT HXT sing N N 138 GLU N CA sing N N 139 GLU N H sing N N 140 GLU N H2 sing N N 141 GLU CA C sing N N 142 GLU CA CB sing N N 143 GLU CA HA sing N N 144 GLU C O doub N N 145 GLU C OXT sing N N 146 GLU CB CG sing N N 147 GLU CB HB2 sing N N 148 GLU CB HB3 sing N N 149 GLU CG CD sing N N 150 GLU CG HG2 sing N N 151 GLU CG HG3 sing N N 152 GLU CD OE1 doub N N 153 GLU CD OE2 sing N N 154 GLU OE2 HE2 sing N N 155 GLU OXT HXT sing N N 156 GLY N CA sing N N 157 GLY N H sing N N 158 GLY N H2 sing N N 159 GLY CA C sing N N 160 GLY CA HA2 sing N N 161 GLY CA HA3 sing N N 162 GLY C O doub N N 163 GLY C OXT sing N N 164 GLY OXT HXT sing N N 165 HIS N CA sing N N 166 HIS N H sing N N 167 HIS N H2 sing N N 168 HIS CA C sing N N 169 HIS CA CB sing N N 170 HIS CA HA sing N N 171 HIS C O doub N N 172 HIS C OXT sing N N 173 HIS CB CG sing N N 174 HIS CB HB2 sing N N 175 HIS CB HB3 sing N N 176 HIS CG ND1 sing Y N 177 HIS CG CD2 doub Y N 178 HIS ND1 CE1 doub Y N 179 HIS ND1 HD1 sing N N 180 HIS CD2 NE2 sing Y N 181 HIS CD2 HD2 sing N N 182 HIS CE1 NE2 sing Y N 183 HIS CE1 HE1 sing N N 184 HIS NE2 HE2 sing N N 185 HIS OXT HXT sing N N 186 HOH O H1 sing N N 187 HOH O H2 sing N N 188 ILE N CA sing N N 189 ILE N H sing N N 190 ILE N H2 sing N N 191 ILE CA C sing N N 192 ILE CA CB sing N N 193 ILE CA HA sing N N 194 ILE C O doub N N 195 ILE C OXT sing N N 196 ILE CB CG1 sing N N 197 ILE CB CG2 sing N N 198 ILE CB HB sing N N 199 ILE CG1 CD1 sing N N 200 ILE CG1 HG12 sing N N 201 ILE CG1 HG13 sing N N 202 ILE CG2 HG21 sing N N 203 ILE CG2 HG22 sing N N 204 ILE CG2 HG23 sing N N 205 ILE CD1 HD11 sing N N 206 ILE CD1 HD12 sing N N 207 ILE CD1 HD13 sing N N 208 ILE OXT HXT sing N N 209 LEU N CA sing N N 210 LEU N H sing N N 211 LEU N H2 sing N N 212 LEU CA C sing N N 213 LEU CA CB sing N N 214 LEU CA HA sing N N 215 LEU C O doub N N 216 LEU C OXT sing N N 217 LEU CB CG sing N N 218 LEU CB HB2 sing N N 219 LEU CB HB3 sing N N 220 LEU CG CD1 sing N N 221 LEU CG CD2 sing N N 222 LEU CG HG sing N N 223 LEU CD1 HD11 sing N N 224 LEU CD1 HD12 sing N N 225 LEU CD1 HD13 sing N N 226 LEU CD2 HD21 sing N N 227 LEU CD2 HD22 sing N N 228 LEU CD2 HD23 sing N N 229 LEU OXT HXT sing N N 230 LYS N CA sing N N 231 LYS N H sing N N 232 LYS N H2 sing N N 233 LYS CA C sing N N 234 LYS CA CB sing N N 235 LYS CA HA sing N N 236 LYS C O doub N N 237 LYS C OXT sing N N 238 LYS CB CG sing N N 239 LYS CB HB2 sing N N 240 LYS CB HB3 sing N N 241 LYS CG CD sing N N 242 LYS CG HG2 sing N N 243 LYS CG HG3 sing N N 244 LYS CD CE sing N N 245 LYS CD HD2 sing N N 246 LYS CD HD3 sing N N 247 LYS CE NZ sing N N 248 LYS CE HE2 sing N N 249 LYS CE HE3 sing N N 250 LYS NZ HZ1 sing N N 251 LYS NZ HZ2 sing N N 252 LYS NZ HZ3 sing N N 253 LYS OXT HXT sing N N 254 MET N CA sing N N 255 MET N H sing N N 256 MET N H2 sing N N 257 MET CA C sing N N 258 MET CA CB sing N N 259 MET CA HA sing N N 260 MET C O doub N N 261 MET C OXT sing N N 262 MET CB CG sing N N 263 MET CB HB2 sing N N 264 MET CB HB3 sing N N 265 MET CG SD sing N N 266 MET CG HG2 sing N N 267 MET CG HG3 sing N N 268 MET SD CE sing N N 269 MET CE HE1 sing N N 270 MET CE HE2 sing N N 271 MET CE HE3 sing N N 272 MET OXT HXT sing N N 273 PHE N CA sing N N 274 PHE N H sing N N 275 PHE N H2 sing N N 276 PHE CA C sing N N 277 PHE CA CB sing N N 278 PHE CA HA sing N N 279 PHE C O doub N N 280 PHE C OXT sing N N 281 PHE CB CG sing N N 282 PHE CB HB2 sing N N 283 PHE CB HB3 sing N N 284 PHE CG CD1 doub Y N 285 PHE CG CD2 sing Y N 286 PHE CD1 CE1 sing Y N 287 PHE CD1 HD1 sing N N 288 PHE CD2 CE2 doub Y N 289 PHE CD2 HD2 sing N N 290 PHE CE1 CZ doub Y N 291 PHE CE1 HE1 sing N N 292 PHE CE2 CZ sing Y N 293 PHE CE2 HE2 sing N N 294 PHE CZ HZ sing N N 295 PHE OXT HXT sing N N 296 PRO N CA sing N N 297 PRO N CD sing N N 298 PRO N H sing N N 299 PRO CA C sing N N 300 PRO CA CB sing N N 301 PRO CA HA sing N N 302 PRO C O doub N N 303 PRO C OXT sing N N 304 PRO CB CG sing N N 305 PRO CB HB2 sing N N 306 PRO CB HB3 sing N N 307 PRO CG CD sing N N 308 PRO CG HG2 sing N N 309 PRO CG HG3 sing N N 310 PRO CD HD2 sing N N 311 PRO CD HD3 sing N N 312 PRO OXT HXT sing N N 313 SER N CA sing N N 314 SER N H sing N N 315 SER N H2 sing N N 316 SER CA C sing N N 317 SER CA CB sing N N 318 SER CA HA sing N N 319 SER C O doub N N 320 SER C OXT sing N N 321 SER CB OG sing N N 322 SER CB HB2 sing N N 323 SER CB HB3 sing N N 324 SER OG HG sing N N 325 SER OXT HXT sing N N 326 THR N CA sing N N 327 THR N H sing N N 328 THR N H2 sing N N 329 THR CA C sing N N 330 THR CA CB sing N N 331 THR CA HA sing N N 332 THR C O doub N N 333 THR C OXT sing N N 334 THR CB OG1 sing N N 335 THR CB CG2 sing N N 336 THR CB HB sing N N 337 THR OG1 HG1 sing N N 338 THR CG2 HG21 sing N N 339 THR CG2 HG22 sing N N 340 THR CG2 HG23 sing N N 341 THR OXT HXT sing N N 342 TRP N CA sing N N 343 TRP N H sing N N 344 TRP N H2 sing N N 345 TRP CA C sing N N 346 TRP CA CB sing N N 347 TRP CA HA sing N N 348 TRP C O doub N N 349 TRP C OXT sing N N 350 TRP CB CG sing N N 351 TRP CB HB2 sing N N 352 TRP CB HB3 sing N N 353 TRP CG CD1 doub Y N 354 TRP CG CD2 sing Y N 355 TRP CD1 NE1 sing Y N 356 TRP CD1 HD1 sing N N 357 TRP CD2 CE2 doub Y N 358 TRP CD2 CE3 sing Y N 359 TRP NE1 CE2 sing Y N 360 TRP NE1 HE1 sing N N 361 TRP CE2 CZ2 sing Y N 362 TRP CE3 CZ3 doub Y N 363 TRP CE3 HE3 sing N N 364 TRP CZ2 CH2 doub Y N 365 TRP CZ2 HZ2 sing N N 366 TRP CZ3 CH2 sing Y N 367 TRP CZ3 HZ3 sing N N 368 TRP CH2 HH2 sing N N 369 TRP OXT HXT sing N N 370 TYR N CA sing N N 371 TYR N H sing N N 372 TYR N H2 sing N N 373 TYR CA C sing N N 374 TYR CA CB sing N N 375 TYR CA HA sing N N 376 TYR C O doub N N 377 TYR C OXT sing N N 378 TYR CB CG sing N N 379 TYR CB HB2 sing N N 380 TYR CB HB3 sing N N 381 TYR CG CD1 doub Y N 382 TYR CG CD2 sing Y N 383 TYR CD1 CE1 sing Y N 384 TYR CD1 HD1 sing N N 385 TYR CD2 CE2 doub Y N 386 TYR CD2 HD2 sing N N 387 TYR CE1 CZ doub Y N 388 TYR CE1 HE1 sing N N 389 TYR CE2 CZ sing Y N 390 TYR CE2 HE2 sing N N 391 TYR CZ OH sing N N 392 TYR OH HH sing N N 393 TYR OXT HXT sing N N 394 VAL N CA sing N N 395 VAL N H sing N N 396 VAL N H2 sing N N 397 VAL CA C sing N N 398 VAL CA CB sing N N 399 VAL CA HA sing N N 400 VAL C O doub N N 401 VAL C OXT sing N N 402 VAL CB CG1 sing N N 403 VAL CB CG2 sing N N 404 VAL CB HB sing N N 405 VAL CG1 HG11 sing N N 406 VAL CG1 HG12 sing N N 407 VAL CG1 HG13 sing N N 408 VAL CG2 HG21 sing N N 409 VAL CG2 HG22 sing N N 410 VAL CG2 HG23 sing N N 411 VAL OXT HXT sing N N 412 # _pdbx_audit_support.funding_organization 'The Structural Genomics Consortium (SGC)' _pdbx_audit_support.country Canada _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7ZHQ _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9HHW _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.020145 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.001162 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.025029 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006010 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ #