data_9HKG # _entry.id 9HKG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.403 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9HKG pdb_00009hkg 10.2210/pdb9hkg/pdb WWPDB D_1292143057 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-04-02 ? 2 'Structure model' 1 1 2025-04-09 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' pdbx_struct_assembly 3 2 'Structure model' pdbx_struct_assembly_gen 4 2 'Structure model' pdbx_struct_assembly_prop 5 2 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_pdbx_struct_assembly.details' 3 2 'Structure model' '_pdbx_struct_assembly.method_details' 4 2 'Structure model' '_pdbx_struct_assembly.oligomeric_count' 5 2 'Structure model' '_pdbx_struct_assembly.oligomeric_details' 6 2 'Structure model' '_pdbx_struct_assembly_gen.oper_expression' 7 2 'Structure model' '_pdbx_struct_assembly_prop.value' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9HKG _pdbx_database_status.recvd_initial_deposition_date 2024-12-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email rspadacc@unisannio.it _pdbx_contact_author.name_first Roberta _pdbx_contact_author.name_last Spadaccini _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-2262-1065 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bologna, A.' 1 0009-0007-5375-7057 'Wang, P.-H.' 2 0000-0001-7359-934X 'Essen, L.-O.' 3 0000-0003-4272-4026 'Spadaccini, R.' 4 0000-0002-2262-1065 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Int.J.Biol.Macromol. _citation.journal_id_ASTM IJBMDR _citation.journal_id_CSD 0708 _citation.journal_id_ISSN 0141-8130 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 308 _citation.language ? _citation.page_first 142239 _citation.page_last 142239 _citation.title 'Unravelling the amyloid aggregation mechanism of the sweet protein Monellin: Insights from circular permutated mutants.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.ijbiomac.2025.142239 _citation.pdbx_database_id_PubMed 40118405 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lucignano, R.' 1 ? primary 'Bologna, A.' 2 ? primary 'Gramazio, S.' 3 ? primary 'Wang, P.H.' 4 ? primary 'Taxis, C.' 5 ? primary 'Essen, L.O.' 6 ? primary 'Picone, D.' 7 ? primary 'Spadaccini, R.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Monellin chain A,Monellin chain B' 11620.231 1 ? ? ? ? 2 non-polymer syn 'ACETIC ACID' 60.052 2 ? ? ? ? 3 water nat water 18.015 85 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Monellin chain I,Monellin chain II' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPPGGSGGEWEIIDIGPFTQNLGKFAVDEENKIGQYG RLTFNKVIRPCMKKTIYENE ; _entity_poly.pdbx_seq_one_letter_code_can ;MFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPPGGSGGEWEIIDIGPFTQNLGKFAVDEENKIGQYG RLTFNKVIRPCMKKTIYENE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ACETIC ACID' ACY 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 PHE n 1 3 ARG n 1 4 GLU n 1 5 ILE n 1 6 LYS n 1 7 GLY n 1 8 TYR n 1 9 GLU n 1 10 TYR n 1 11 GLN n 1 12 LEU n 1 13 TYR n 1 14 VAL n 1 15 TYR n 1 16 ALA n 1 17 SER n 1 18 ASP n 1 19 LYS n 1 20 LEU n 1 21 PHE n 1 22 ARG n 1 23 ALA n 1 24 ASP n 1 25 ILE n 1 26 SER n 1 27 GLU n 1 28 ASP n 1 29 TYR n 1 30 LYS n 1 31 THR n 1 32 ARG n 1 33 GLY n 1 34 ARG n 1 35 LYS n 1 36 LEU n 1 37 LEU n 1 38 ARG n 1 39 PHE n 1 40 ASN n 1 41 GLY n 1 42 PRO n 1 43 VAL n 1 44 PRO n 1 45 PRO n 1 46 PRO n 1 47 GLY n 1 48 GLY n 1 49 SER n 1 50 GLY n 1 51 GLY n 1 52 GLU n 1 53 TRP n 1 54 GLU n 1 55 ILE n 1 56 ILE n 1 57 ASP n 1 58 ILE n 1 59 GLY n 1 60 PRO n 1 61 PHE n 1 62 THR n 1 63 GLN n 1 64 ASN n 1 65 LEU n 1 66 GLY n 1 67 LYS n 1 68 PHE n 1 69 ALA n 1 70 VAL n 1 71 ASP n 1 72 GLU n 1 73 GLU n 1 74 ASN n 1 75 LYS n 1 76 ILE n 1 77 GLY n 1 78 GLN n 1 79 TYR n 1 80 GLY n 1 81 ARG n 1 82 LEU n 1 83 THR n 1 84 PHE n 1 85 ASN n 1 86 LYS n 1 87 VAL n 1 88 ILE n 1 89 ARG n 1 90 PRO n 1 91 CYS n 1 92 MET n 1 93 LYS n 1 94 LYS n 1 95 THR n 1 96 ILE n 1 97 TYR n 1 98 GLU n 1 99 ASN n 1 100 GLU n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 51 'serendipity berry' ? ? ? ? ? ? ? ? 'Dioscoreophyllum cumminsii' 3457 ? ? ? ? ? ? ? ? 'Escherichia coli B' 37762 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 52 100 'serendipity berry' ? ? ? ? ? ? ? ? 'Dioscoreophyllum cumminsii' 3457 ? ? ? ? ? ? ? ? 'Escherichia coli B' 37762 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACY non-polymer . 'ACETIC ACID' ? 'C2 H4 O2' 60.052 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 PHE 2 2 2 PHE PHE A . n A 1 3 ARG 3 3 3 ARG ARG A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 TYR 10 10 10 TYR TYR A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 TYR 15 15 15 TYR TYR A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 TYR 29 29 29 TYR TYR A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 PRO 42 42 42 PRO PRO A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 TRP 53 53 53 TRP TRP A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 GLN 78 78 78 GLN GLN A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 ASN 85 85 85 ASN ASN A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 ARG 89 89 89 ARG ARG A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 CYS 91 91 91 CYS CYS A . n A 1 92 MET 92 92 92 MET MET A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 TYR 97 97 97 TYR TYR A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 GLU 100 100 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ACY _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ACY _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ACY 1 201 101 ACY ACT A . C 2 ACY 1 202 102 ACY ACT A . D 3 HOH 1 301 44 HOH HOH A . D 3 HOH 2 302 41 HOH HOH A . D 3 HOH 3 303 56 HOH HOH A . D 3 HOH 4 304 2 HOH HOH A . D 3 HOH 5 305 11 HOH HOH A . D 3 HOH 6 306 54 HOH HOH A . D 3 HOH 7 307 42 HOH HOH A . D 3 HOH 8 308 25 HOH HOH A . D 3 HOH 9 309 12 HOH HOH A . D 3 HOH 10 310 27 HOH HOH A . D 3 HOH 11 311 75 HOH HOH A . D 3 HOH 12 312 81 HOH HOH A . D 3 HOH 13 313 78 HOH HOH A . D 3 HOH 14 314 37 HOH HOH A . D 3 HOH 15 315 77 HOH HOH A . D 3 HOH 16 316 1 HOH HOH A . D 3 HOH 17 317 3 HOH HOH A . D 3 HOH 18 318 66 HOH HOH A . D 3 HOH 19 319 34 HOH HOH A . D 3 HOH 20 320 51 HOH HOH A . D 3 HOH 21 321 9 HOH HOH A . D 3 HOH 22 322 32 HOH HOH A . D 3 HOH 23 323 10 HOH HOH A . D 3 HOH 24 324 14 HOH HOH A . D 3 HOH 25 325 73 HOH HOH A . D 3 HOH 26 326 19 HOH HOH A . D 3 HOH 27 327 13 HOH HOH A . D 3 HOH 28 328 7 HOH HOH A . D 3 HOH 29 329 64 HOH HOH A . D 3 HOH 30 330 8 HOH HOH A . D 3 HOH 31 331 31 HOH HOH A . D 3 HOH 32 332 5 HOH HOH A . D 3 HOH 33 333 24 HOH HOH A . D 3 HOH 34 334 4 HOH HOH A . D 3 HOH 35 335 38 HOH HOH A . D 3 HOH 36 336 28 HOH HOH A . D 3 HOH 37 337 60 HOH HOH A . D 3 HOH 38 338 43 HOH HOH A . D 3 HOH 39 339 57 HOH HOH A . D 3 HOH 40 340 50 HOH HOH A . D 3 HOH 41 341 30 HOH HOH A . D 3 HOH 42 342 22 HOH HOH A . D 3 HOH 43 343 40 HOH HOH A . D 3 HOH 44 344 82 HOH HOH A . D 3 HOH 45 345 6 HOH HOH A . D 3 HOH 46 346 45 HOH HOH A . D 3 HOH 47 347 74 HOH HOH A . D 3 HOH 48 348 52 HOH HOH A . D 3 HOH 49 349 23 HOH HOH A . D 3 HOH 50 350 21 HOH HOH A . D 3 HOH 51 351 17 HOH HOH A . D 3 HOH 52 352 85 HOH HOH A . D 3 HOH 53 353 16 HOH HOH A . D 3 HOH 54 354 15 HOH HOH A . D 3 HOH 55 355 18 HOH HOH A . D 3 HOH 56 356 71 HOH HOH A . D 3 HOH 57 357 58 HOH HOH A . D 3 HOH 58 358 76 HOH HOH A . D 3 HOH 59 359 29 HOH HOH A . D 3 HOH 60 360 59 HOH HOH A . D 3 HOH 61 361 68 HOH HOH A . D 3 HOH 62 362 26 HOH HOH A . D 3 HOH 63 363 39 HOH HOH A . D 3 HOH 64 364 55 HOH HOH A . D 3 HOH 65 365 61 HOH HOH A . D 3 HOH 66 366 46 HOH HOH A . D 3 HOH 67 367 53 HOH HOH A . D 3 HOH 68 368 36 HOH HOH A . D 3 HOH 69 369 63 HOH HOH A . D 3 HOH 70 370 65 HOH HOH A . D 3 HOH 71 371 62 HOH HOH A . D 3 HOH 72 372 70 HOH HOH A . D 3 HOH 73 373 35 HOH HOH A . D 3 HOH 74 374 67 HOH HOH A . D 3 HOH 75 375 33 HOH HOH A . D 3 HOH 76 376 47 HOH HOH A . D 3 HOH 77 377 84 HOH HOH A . D 3 HOH 78 378 79 HOH HOH A . D 3 HOH 79 379 49 HOH HOH A . D 3 HOH 80 380 20 HOH HOH A . D 3 HOH 81 381 80 HOH HOH A . D 3 HOH 82 382 48 HOH HOH A . D 3 HOH 83 383 83 HOH HOH A . D 3 HOH 84 384 72 HOH HOH A . D 3 HOH 85 385 69 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 A ARG 3 ? NE ? A ARG 3 NE 2 1 Y 0 A ARG 3 ? CZ ? A ARG 3 CZ 3 1 Y 0 A ARG 3 ? NH1 ? A ARG 3 NH1 4 1 Y 0 A ARG 3 ? NH2 ? A ARG 3 NH2 5 1 Y 0 A ASP 57 ? CG ? A ASP 57 CG # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 97.840 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9HKG _cell.details ? _cell.formula_units_Z ? _cell.length_a 39.464 _cell.length_a_esd ? _cell.length_b 32.518 _cell.length_b_esd ? _cell.length_c 40.824 _cell.length_c_esd ? _cell.volume 51899.357 _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9HKG _symmetry.cell_setting ? _symmetry.Int_Tables_number 3 _symmetry.space_group_name_Hall 'P 2y' _symmetry.space_group_name_H-M 'P 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9HKG _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.23 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.92 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Precipitant: 19% (w/v) PEG 4000, 19% (v/v) 2-Propanol Buffer: 0.095 M Trisodium citrate (pH 5.5) Additive: 5% (v/v) Glycerol ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-09-02 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator mirror _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X06SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X06SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate 21.89 _reflns.entry_id 9HKG _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.26 _reflns.d_resolution_low 39.1 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 23712 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 85.59 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.3 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.46 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.07209 _reflns.pdbx_Rpim_I_all 0.02871 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.993 _reflns.pdbx_CC_star 0.998 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.06587 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.264 _reflns_shell.d_res_low 1.31 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.05 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1035 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.8 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.4936 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.68 _reflns_shell.pdbx_CC_star 0.9 _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 37.35 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.8873 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 35.56 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9HKG _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.26 _refine.ls_d_res_low 39.10 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 23710 _refine.ls_number_reflns_R_free 457 _refine.ls_number_reflns_R_work 23253 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 85.59 _refine.ls_percent_reflns_R_free 1.93 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1598 _refine.ls_R_factor_R_free 0.1916 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1591 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.95 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 36.2494 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1755 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.26 _refine_hist.d_res_low 39.10 _refine_hist.number_atoms_solvent 85 _refine_hist.number_atoms_total 895 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 802 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 8 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0109 ? 835 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.8932 ? 1121 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0741 ? 110 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0170 ? 148 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 5.6363 ? 113 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.26 1.45 . . 114 5612 62.51 . . . . 0.2152 . . . . . . . . . . . 0.2809 'X-RAY DIFFRACTION' 1.45 1.82 . . 165 8732 96.70 . . . . 0.2210 . . . . . . . . . . . 0.2460 'X-RAY DIFFRACTION' 1.82 39.10 . . 178 8909 97.30 . . . . 0.1458 . . . . . . . . . . . 0.1793 # _struct.entry_id 9HKG _struct.title 'X-ray structure of Perm2, a circularly permuted mutant of the sweet protein MNEI' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9HKG _struct_keywords.text 'sweet protein, PLANT PROTEIN' _struct_keywords.pdbx_keywords 'PLANT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP MONA_DIOCU P02881 ? 1 FREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP 1 2 UNP MONB_DIOCU P02882 ? 1 EWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYE 2 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9HKG A 2 ? 46 ? P02881 1 ? 45 ? 2 46 2 2 9HKG A 52 ? 98 ? P02882 2 ? 48 ? 52 98 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9HKG MET A 1 ? UNP P02881 ? ? 'initiating methionine' 1 1 1 9HKG GLY A 47 ? UNP P02881 ? ? linker 47 2 1 9HKG GLY A 48 ? UNP P02881 ? ? linker 48 3 1 9HKG SER A 49 ? UNP P02881 ? ? linker 49 4 1 9HKG GLY A 50 ? UNP P02881 ? ? linker 50 5 1 9HKG GLY A 51 ? UNP P02881 ? ? linker 51 6 2 9HKG ASN A 99 ? UNP P02882 ? ? 'expression tag' 99 7 2 9HKG GLU A 100 ? UNP P02882 ? ? 'expression tag' 100 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6460 ? 1 MORE -43 ? 1 'SSA (A^2)' 11220 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id GLY _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 59 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 77 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLY _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 59 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 77 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 41 A . ? GLY 41 A PRO 42 A ? PRO 42 A 1 -0.56 2 ARG 89 A . ? ARG 89 A PRO 90 A ? PRO 90 A 1 -3.08 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 7 ? ALA A 16 ? GLY A 7 ALA A 16 AA1 2 LYS A 19 ? ASP A 28 ? LYS A 19 ASP A 28 AA1 3 ARG A 34 ? ASN A 40 ? ARG A 34 ASN A 40 AA2 1 GLU A 52 ? ILE A 56 ? GLU A 52 ILE A 56 AA2 2 CYS A 91 ? THR A 95 ? CYS A 91 THR A 95 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 12 ? N LEU A 12 O ALA A 23 ? O ALA A 23 AA1 2 3 N ASP A 24 ? N ASP A 24 O LEU A 37 ? O LEU A 37 AA2 1 2 N GLU A 54 ? N GLU A 54 O LYS A 93 ? O LYS A 93 # _pdbx_entry_details.entry_id 9HKG _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 303 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 360 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.03 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 85 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -105.82 _pdbx_validate_torsion.psi -64.62 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 81 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.097 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 312 ? D HOH . 2 1 A HOH 313 ? D HOH . 3 1 A HOH 363 ? D HOH . 4 1 A HOH 385 ? D HOH . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -x,y,-z # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLU 100 ? A GLU 100 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACY C C N N 1 ACY O O N N 2 ACY OXT O N N 3 ACY CH3 C N N 4 ACY HXT H N N 5 ACY H1 H N N 6 ACY H2 H N N 7 ACY H3 H N N 8 ALA N N N N 9 ALA CA C N S 10 ALA C C N N 11 ALA O O N N 12 ALA CB C N N 13 ALA OXT O N N 14 ALA H H N N 15 ALA H2 H N N 16 ALA HA H N N 17 ALA HB1 H N N 18 ALA HB2 H N N 19 ALA HB3 H N N 20 ALA HXT H N N 21 ARG N N N N 22 ARG CA C N S 23 ARG C C N N 24 ARG O O N N 25 ARG CB C N N 26 ARG CG C N N 27 ARG CD C N N 28 ARG NE N N N 29 ARG CZ C N N 30 ARG NH1 N N N 31 ARG NH2 N N N 32 ARG OXT O N N 33 ARG H H N N 34 ARG H2 H N N 35 ARG HA H N N 36 ARG HB2 H N N 37 ARG HB3 H N N 38 ARG HG2 H N N 39 ARG HG3 H N N 40 ARG HD2 H N N 41 ARG HD3 H N N 42 ARG HE H N N 43 ARG HH11 H N N 44 ARG HH12 H N N 45 ARG HH21 H N N 46 ARG HH22 H N N 47 ARG HXT H N N 48 ASN N N N N 49 ASN CA C N S 50 ASN C C N N 51 ASN O O N N 52 ASN CB C N N 53 ASN CG C N N 54 ASN OD1 O N N 55 ASN ND2 N N N 56 ASN OXT O N N 57 ASN H H N N 58 ASN H2 H N N 59 ASN HA H N N 60 ASN HB2 H N N 61 ASN HB3 H N N 62 ASN HD21 H N N 63 ASN HD22 H N N 64 ASN HXT H N N 65 ASP N N N N 66 ASP CA C N S 67 ASP C C N N 68 ASP O O N N 69 ASP CB C N N 70 ASP CG C N N 71 ASP OD1 O N N 72 ASP OD2 O N N 73 ASP OXT O N N 74 ASP H H N N 75 ASP H2 H N N 76 ASP HA H N N 77 ASP HB2 H N N 78 ASP HB3 H N N 79 ASP HD2 H N N 80 ASP HXT H N N 81 CYS N N N N 82 CYS CA C N R 83 CYS C C N N 84 CYS O O N N 85 CYS CB C N N 86 CYS SG S N N 87 CYS OXT O N N 88 CYS H H N N 89 CYS H2 H N N 90 CYS HA H N N 91 CYS HB2 H N N 92 CYS HB3 H N N 93 CYS HG H N N 94 CYS HXT H N N 95 GLN N N N N 96 GLN CA C N S 97 GLN C C N N 98 GLN O O N N 99 GLN CB C N N 100 GLN CG C N N 101 GLN CD C N N 102 GLN OE1 O N N 103 GLN NE2 N N N 104 GLN OXT O N N 105 GLN H H N N 106 GLN H2 H N N 107 GLN HA H N N 108 GLN HB2 H N N 109 GLN HB3 H N N 110 GLN HG2 H N N 111 GLN HG3 H N N 112 GLN HE21 H N N 113 GLN HE22 H N N 114 GLN HXT H N N 115 GLU N N N N 116 GLU CA C N S 117 GLU C C N N 118 GLU O O N N 119 GLU CB C N N 120 GLU CG C N N 121 GLU CD C N N 122 GLU OE1 O N N 123 GLU OE2 O N N 124 GLU OXT O N N 125 GLU H H N N 126 GLU H2 H N N 127 GLU HA H N N 128 GLU HB2 H N N 129 GLU HB3 H N N 130 GLU HG2 H N N 131 GLU HG3 H N N 132 GLU HE2 H N N 133 GLU HXT H N N 134 GLY N N N N 135 GLY CA C N N 136 GLY C C N N 137 GLY O O N N 138 GLY OXT O N N 139 GLY H H N N 140 GLY H2 H N N 141 GLY HA2 H N N 142 GLY HA3 H N N 143 GLY HXT H N N 144 HOH O O N N 145 HOH H1 H N N 146 HOH H2 H N N 147 ILE N N N N 148 ILE CA C N S 149 ILE C C N N 150 ILE O O N N 151 ILE CB C N S 152 ILE CG1 C N N 153 ILE CG2 C N N 154 ILE CD1 C N N 155 ILE OXT O N N 156 ILE H H N N 157 ILE H2 H N N 158 ILE HA H N N 159 ILE HB H N N 160 ILE HG12 H N N 161 ILE HG13 H N N 162 ILE HG21 H N N 163 ILE HG22 H N N 164 ILE HG23 H N N 165 ILE HD11 H N N 166 ILE HD12 H N N 167 ILE HD13 H N N 168 ILE HXT H N N 169 LEU N N N N 170 LEU CA C N S 171 LEU C C N N 172 LEU O O N N 173 LEU CB C N N 174 LEU CG C N N 175 LEU CD1 C N N 176 LEU CD2 C N N 177 LEU OXT O N N 178 LEU H H N N 179 LEU H2 H N N 180 LEU HA H N N 181 LEU HB2 H N N 182 LEU HB3 H N N 183 LEU HG H N N 184 LEU HD11 H N N 185 LEU HD12 H N N 186 LEU HD13 H N N 187 LEU HD21 H N N 188 LEU HD22 H N N 189 LEU HD23 H N N 190 LEU HXT H N N 191 LYS N N N N 192 LYS CA C N S 193 LYS C C N N 194 LYS O O N N 195 LYS CB C N N 196 LYS CG C N N 197 LYS CD C N N 198 LYS CE C N N 199 LYS NZ N N N 200 LYS OXT O N N 201 LYS H H N N 202 LYS H2 H N N 203 LYS HA H N N 204 LYS HB2 H N N 205 LYS HB3 H N N 206 LYS HG2 H N N 207 LYS HG3 H N N 208 LYS HD2 H N N 209 LYS HD3 H N N 210 LYS HE2 H N N 211 LYS HE3 H N N 212 LYS HZ1 H N N 213 LYS HZ2 H N N 214 LYS HZ3 H N N 215 LYS HXT H N N 216 MET N N N N 217 MET CA C N S 218 MET C C N N 219 MET O O N N 220 MET CB C N N 221 MET CG C N N 222 MET SD S N N 223 MET CE C N N 224 MET OXT O N N 225 MET H H N N 226 MET H2 H N N 227 MET HA H N N 228 MET HB2 H N N 229 MET HB3 H N N 230 MET HG2 H N N 231 MET HG3 H N N 232 MET HE1 H N N 233 MET HE2 H N N 234 MET HE3 H N N 235 MET HXT H N N 236 PHE N N N N 237 PHE CA C N S 238 PHE C C N N 239 PHE O O N N 240 PHE CB C N N 241 PHE CG C Y N 242 PHE CD1 C Y N 243 PHE CD2 C Y N 244 PHE CE1 C Y N 245 PHE CE2 C Y N 246 PHE CZ C Y N 247 PHE OXT O N N 248 PHE H H N N 249 PHE H2 H N N 250 PHE HA H N N 251 PHE HB2 H N N 252 PHE HB3 H N N 253 PHE HD1 H N N 254 PHE HD2 H N N 255 PHE HE1 H N N 256 PHE HE2 H N N 257 PHE HZ H N N 258 PHE HXT H N N 259 PRO N N N N 260 PRO CA C N S 261 PRO C C N N 262 PRO O O N N 263 PRO CB C N N 264 PRO CG C N N 265 PRO CD C N N 266 PRO OXT O N N 267 PRO H H N N 268 PRO HA H N N 269 PRO HB2 H N N 270 PRO HB3 H N N 271 PRO HG2 H N N 272 PRO HG3 H N N 273 PRO HD2 H N N 274 PRO HD3 H N N 275 PRO HXT H N N 276 SER N N N N 277 SER CA C N S 278 SER C C N N 279 SER O O N N 280 SER CB C N N 281 SER OG O N N 282 SER OXT O N N 283 SER H H N N 284 SER H2 H N N 285 SER HA H N N 286 SER HB2 H N N 287 SER HB3 H N N 288 SER HG H N N 289 SER HXT H N N 290 THR N N N N 291 THR CA C N S 292 THR C C N N 293 THR O O N N 294 THR CB C N R 295 THR OG1 O N N 296 THR CG2 C N N 297 THR OXT O N N 298 THR H H N N 299 THR H2 H N N 300 THR HA H N N 301 THR HB H N N 302 THR HG1 H N N 303 THR HG21 H N N 304 THR HG22 H N N 305 THR HG23 H N N 306 THR HXT H N N 307 TRP N N N N 308 TRP CA C N S 309 TRP C C N N 310 TRP O O N N 311 TRP CB C N N 312 TRP CG C Y N 313 TRP CD1 C Y N 314 TRP CD2 C Y N 315 TRP NE1 N Y N 316 TRP CE2 C Y N 317 TRP CE3 C Y N 318 TRP CZ2 C Y N 319 TRP CZ3 C Y N 320 TRP CH2 C Y N 321 TRP OXT O N N 322 TRP H H N N 323 TRP H2 H N N 324 TRP HA H N N 325 TRP HB2 H N N 326 TRP HB3 H N N 327 TRP HD1 H N N 328 TRP HE1 H N N 329 TRP HE3 H N N 330 TRP HZ2 H N N 331 TRP HZ3 H N N 332 TRP HH2 H N N 333 TRP HXT H N N 334 TYR N N N N 335 TYR CA C N S 336 TYR C C N N 337 TYR O O N N 338 TYR CB C N N 339 TYR CG C Y N 340 TYR CD1 C Y N 341 TYR CD2 C Y N 342 TYR CE1 C Y N 343 TYR CE2 C Y N 344 TYR CZ C Y N 345 TYR OH O N N 346 TYR OXT O N N 347 TYR H H N N 348 TYR H2 H N N 349 TYR HA H N N 350 TYR HB2 H N N 351 TYR HB3 H N N 352 TYR HD1 H N N 353 TYR HD2 H N N 354 TYR HE1 H N N 355 TYR HE2 H N N 356 TYR HH H N N 357 TYR HXT H N N 358 VAL N N N N 359 VAL CA C N S 360 VAL C C N N 361 VAL O O N N 362 VAL CB C N N 363 VAL CG1 C N N 364 VAL CG2 C N N 365 VAL OXT O N N 366 VAL H H N N 367 VAL H2 H N N 368 VAL HA H N N 369 VAL HB H N N 370 VAL HG11 H N N 371 VAL HG12 H N N 372 VAL HG13 H N N 373 VAL HG21 H N N 374 VAL HG22 H N N 375 VAL HG23 H N N 376 VAL HXT H N N 377 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACY C O doub N N 1 ACY C OXT sing N N 2 ACY C CH3 sing N N 3 ACY OXT HXT sing N N 4 ACY CH3 H1 sing N N 5 ACY CH3 H2 sing N N 6 ACY CH3 H3 sing N N 7 ALA N CA sing N N 8 ALA N H sing N N 9 ALA N H2 sing N N 10 ALA CA C sing N N 11 ALA CA CB sing N N 12 ALA CA HA sing N N 13 ALA C O doub N N 14 ALA C OXT sing N N 15 ALA CB HB1 sing N N 16 ALA CB HB2 sing N N 17 ALA CB HB3 sing N N 18 ALA OXT HXT sing N N 19 ARG N CA sing N N 20 ARG N H sing N N 21 ARG N H2 sing N N 22 ARG CA C sing N N 23 ARG CA CB sing N N 24 ARG CA HA sing N N 25 ARG C O doub N N 26 ARG C OXT sing N N 27 ARG CB CG sing N N 28 ARG CB HB2 sing N N 29 ARG CB HB3 sing N N 30 ARG CG CD sing N N 31 ARG CG HG2 sing N N 32 ARG CG HG3 sing N N 33 ARG CD NE sing N N 34 ARG CD HD2 sing N N 35 ARG CD HD3 sing N N 36 ARG NE CZ sing N N 37 ARG NE HE sing N N 38 ARG CZ NH1 sing N N 39 ARG CZ NH2 doub N N 40 ARG NH1 HH11 sing N N 41 ARG NH1 HH12 sing N N 42 ARG NH2 HH21 sing N N 43 ARG NH2 HH22 sing N N 44 ARG OXT HXT sing N N 45 ASN N CA sing N N 46 ASN N H sing N N 47 ASN N H2 sing N N 48 ASN CA C sing N N 49 ASN CA CB sing N N 50 ASN CA HA sing N N 51 ASN C O doub N N 52 ASN C OXT sing N N 53 ASN CB CG sing N N 54 ASN CB HB2 sing N N 55 ASN CB HB3 sing N N 56 ASN CG OD1 doub N N 57 ASN CG ND2 sing N N 58 ASN ND2 HD21 sing N N 59 ASN ND2 HD22 sing N N 60 ASN OXT HXT sing N N 61 ASP N CA sing N N 62 ASP N H sing N N 63 ASP N H2 sing N N 64 ASP CA C sing N N 65 ASP CA CB sing N N 66 ASP CA HA sing N N 67 ASP C O doub N N 68 ASP C OXT sing N N 69 ASP CB CG sing N N 70 ASP CB HB2 sing N N 71 ASP CB HB3 sing N N 72 ASP CG OD1 doub N N 73 ASP CG OD2 sing N N 74 ASP OD2 HD2 sing N N 75 ASP OXT HXT sing N N 76 CYS N CA sing N N 77 CYS N H sing N N 78 CYS N H2 sing N N 79 CYS CA C sing N N 80 CYS CA CB sing N N 81 CYS CA HA sing N N 82 CYS C O doub N N 83 CYS C OXT sing N N 84 CYS CB SG sing N N 85 CYS CB HB2 sing N N 86 CYS CB HB3 sing N N 87 CYS SG HG sing N N 88 CYS OXT HXT sing N N 89 GLN N CA sing N N 90 GLN N H sing N N 91 GLN N H2 sing N N 92 GLN CA C sing N N 93 GLN CA CB sing N N 94 GLN CA HA sing N N 95 GLN C O doub N N 96 GLN C OXT sing N N 97 GLN CB CG sing N N 98 GLN CB HB2 sing N N 99 GLN CB HB3 sing N N 100 GLN CG CD sing N N 101 GLN CG HG2 sing N N 102 GLN CG HG3 sing N N 103 GLN CD OE1 doub N N 104 GLN CD NE2 sing N N 105 GLN NE2 HE21 sing N N 106 GLN NE2 HE22 sing N N 107 GLN OXT HXT sing N N 108 GLU N CA sing N N 109 GLU N H sing N N 110 GLU N H2 sing N N 111 GLU CA C sing N N 112 GLU CA CB sing N N 113 GLU CA HA sing N N 114 GLU C O doub N N 115 GLU C OXT sing N N 116 GLU CB CG sing N N 117 GLU CB HB2 sing N N 118 GLU CB HB3 sing N N 119 GLU CG CD sing N N 120 GLU CG HG2 sing N N 121 GLU CG HG3 sing N N 122 GLU CD OE1 doub N N 123 GLU CD OE2 sing N N 124 GLU OE2 HE2 sing N N 125 GLU OXT HXT sing N N 126 GLY N CA sing N N 127 GLY N H sing N N 128 GLY N H2 sing N N 129 GLY CA C sing N N 130 GLY CA HA2 sing N N 131 GLY CA HA3 sing N N 132 GLY C O doub N N 133 GLY C OXT sing N N 134 GLY OXT HXT sing N N 135 HOH O H1 sing N N 136 HOH O H2 sing N N 137 ILE N CA sing N N 138 ILE N H sing N N 139 ILE N H2 sing N N 140 ILE CA C sing N N 141 ILE CA CB sing N N 142 ILE CA HA sing N N 143 ILE C O doub N N 144 ILE C OXT sing N N 145 ILE CB CG1 sing N N 146 ILE CB CG2 sing N N 147 ILE CB HB sing N N 148 ILE CG1 CD1 sing N N 149 ILE CG1 HG12 sing N N 150 ILE CG1 HG13 sing N N 151 ILE CG2 HG21 sing N N 152 ILE CG2 HG22 sing N N 153 ILE CG2 HG23 sing N N 154 ILE CD1 HD11 sing N N 155 ILE CD1 HD12 sing N N 156 ILE CD1 HD13 sing N N 157 ILE OXT HXT sing N N 158 LEU N CA sing N N 159 LEU N H sing N N 160 LEU N H2 sing N N 161 LEU CA C sing N N 162 LEU CA CB sing N N 163 LEU CA HA sing N N 164 LEU C O doub N N 165 LEU C OXT sing N N 166 LEU CB CG sing N N 167 LEU CB HB2 sing N N 168 LEU CB HB3 sing N N 169 LEU CG CD1 sing N N 170 LEU CG CD2 sing N N 171 LEU CG HG sing N N 172 LEU CD1 HD11 sing N N 173 LEU CD1 HD12 sing N N 174 LEU CD1 HD13 sing N N 175 LEU CD2 HD21 sing N N 176 LEU CD2 HD22 sing N N 177 LEU CD2 HD23 sing N N 178 LEU OXT HXT sing N N 179 LYS N CA sing N N 180 LYS N H sing N N 181 LYS N H2 sing N N 182 LYS CA C sing N N 183 LYS CA CB sing N N 184 LYS CA HA sing N N 185 LYS C O doub N N 186 LYS C OXT sing N N 187 LYS CB CG sing N N 188 LYS CB HB2 sing N N 189 LYS CB HB3 sing N N 190 LYS CG CD sing N N 191 LYS CG HG2 sing N N 192 LYS CG HG3 sing N N 193 LYS CD CE sing N N 194 LYS CD HD2 sing N N 195 LYS CD HD3 sing N N 196 LYS CE NZ sing N N 197 LYS CE HE2 sing N N 198 LYS CE HE3 sing N N 199 LYS NZ HZ1 sing N N 200 LYS NZ HZ2 sing N N 201 LYS NZ HZ3 sing N N 202 LYS OXT HXT sing N N 203 MET N CA sing N N 204 MET N H sing N N 205 MET N H2 sing N N 206 MET CA C sing N N 207 MET CA CB sing N N 208 MET CA HA sing N N 209 MET C O doub N N 210 MET C OXT sing N N 211 MET CB CG sing N N 212 MET CB HB2 sing N N 213 MET CB HB3 sing N N 214 MET CG SD sing N N 215 MET CG HG2 sing N N 216 MET CG HG3 sing N N 217 MET SD CE sing N N 218 MET CE HE1 sing N N 219 MET CE HE2 sing N N 220 MET CE HE3 sing N N 221 MET OXT HXT sing N N 222 PHE N CA sing N N 223 PHE N H sing N N 224 PHE N H2 sing N N 225 PHE CA C sing N N 226 PHE CA CB sing N N 227 PHE CA HA sing N N 228 PHE C O doub N N 229 PHE C OXT sing N N 230 PHE CB CG sing N N 231 PHE CB HB2 sing N N 232 PHE CB HB3 sing N N 233 PHE CG CD1 doub Y N 234 PHE CG CD2 sing Y N 235 PHE CD1 CE1 sing Y N 236 PHE CD1 HD1 sing N N 237 PHE CD2 CE2 doub Y N 238 PHE CD2 HD2 sing N N 239 PHE CE1 CZ doub Y N 240 PHE CE1 HE1 sing N N 241 PHE CE2 CZ sing Y N 242 PHE CE2 HE2 sing N N 243 PHE CZ HZ sing N N 244 PHE OXT HXT sing N N 245 PRO N CA sing N N 246 PRO N CD sing N N 247 PRO N H sing N N 248 PRO CA C sing N N 249 PRO CA CB sing N N 250 PRO CA HA sing N N 251 PRO C O doub N N 252 PRO C OXT sing N N 253 PRO CB CG sing N N 254 PRO CB HB2 sing N N 255 PRO CB HB3 sing N N 256 PRO CG CD sing N N 257 PRO CG HG2 sing N N 258 PRO CG HG3 sing N N 259 PRO CD HD2 sing N N 260 PRO CD HD3 sing N N 261 PRO OXT HXT sing N N 262 SER N CA sing N N 263 SER N H sing N N 264 SER N H2 sing N N 265 SER CA C sing N N 266 SER CA CB sing N N 267 SER CA HA sing N N 268 SER C O doub N N 269 SER C OXT sing N N 270 SER CB OG sing N N 271 SER CB HB2 sing N N 272 SER CB HB3 sing N N 273 SER OG HG sing N N 274 SER OXT HXT sing N N 275 THR N CA sing N N 276 THR N H sing N N 277 THR N H2 sing N N 278 THR CA C sing N N 279 THR CA CB sing N N 280 THR CA HA sing N N 281 THR C O doub N N 282 THR C OXT sing N N 283 THR CB OG1 sing N N 284 THR CB CG2 sing N N 285 THR CB HB sing N N 286 THR OG1 HG1 sing N N 287 THR CG2 HG21 sing N N 288 THR CG2 HG22 sing N N 289 THR CG2 HG23 sing N N 290 THR OXT HXT sing N N 291 TRP N CA sing N N 292 TRP N H sing N N 293 TRP N H2 sing N N 294 TRP CA C sing N N 295 TRP CA CB sing N N 296 TRP CA HA sing N N 297 TRP C O doub N N 298 TRP C OXT sing N N 299 TRP CB CG sing N N 300 TRP CB HB2 sing N N 301 TRP CB HB3 sing N N 302 TRP CG CD1 doub Y N 303 TRP CG CD2 sing Y N 304 TRP CD1 NE1 sing Y N 305 TRP CD1 HD1 sing N N 306 TRP CD2 CE2 doub Y N 307 TRP CD2 CE3 sing Y N 308 TRP NE1 CE2 sing Y N 309 TRP NE1 HE1 sing N N 310 TRP CE2 CZ2 sing Y N 311 TRP CE3 CZ3 doub Y N 312 TRP CE3 HE3 sing N N 313 TRP CZ2 CH2 doub Y N 314 TRP CZ2 HZ2 sing N N 315 TRP CZ3 CH2 sing Y N 316 TRP CZ3 HZ3 sing N N 317 TRP CH2 HH2 sing N N 318 TRP OXT HXT sing N N 319 TYR N CA sing N N 320 TYR N H sing N N 321 TYR N H2 sing N N 322 TYR CA C sing N N 323 TYR CA CB sing N N 324 TYR CA HA sing N N 325 TYR C O doub N N 326 TYR C OXT sing N N 327 TYR CB CG sing N N 328 TYR CB HB2 sing N N 329 TYR CB HB3 sing N N 330 TYR CG CD1 doub Y N 331 TYR CG CD2 sing Y N 332 TYR CD1 CE1 sing Y N 333 TYR CD1 HD1 sing N N 334 TYR CD2 CE2 doub Y N 335 TYR CD2 HD2 sing N N 336 TYR CE1 CZ doub Y N 337 TYR CE1 HE1 sing N N 338 TYR CE2 CZ sing Y N 339 TYR CE2 HE2 sing N N 340 TYR CZ OH sing N N 341 TYR OH HH sing N N 342 TYR OXT HXT sing N N 343 VAL N CA sing N N 344 VAL N H sing N N 345 VAL N H2 sing N N 346 VAL CA C sing N N 347 VAL CA CB sing N N 348 VAL CA HA sing N N 349 VAL C O doub N N 350 VAL C OXT sing N N 351 VAL CB CG1 sing N N 352 VAL CB CG2 sing N N 353 VAL CB HB sing N N 354 VAL CG1 HG11 sing N N 355 VAL CG1 HG12 sing N N 356 VAL CG1 HG13 sing N N 357 VAL CG2 HG21 sing N N 358 VAL CG2 HG22 sing N N 359 VAL CG2 HG23 sing N N 360 VAL OXT HXT sing N N 361 # _pdbx_audit_support.funding_organization 'Other government' _pdbx_audit_support.country Italy _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1FA3 _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 1 2 1' _space_group.name_Hall 'P 2y' _space_group.IT_number 3 _space_group.crystal_system monoclinic _space_group.id 1 # _atom_sites.entry_id 9HKG _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.025340 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.003489 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.030752 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.024727 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #