data_9HRT # _entry.id 9HRT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.404 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9HRT pdb_00009hrt 10.2210/pdb9hrt/pdb WWPDB D_1292144111 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-06-18 ? 2 'Structure model' 1 1 2025-07-30 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 2 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' # _database_PDB_caveat.id 1 _database_PDB_caveat.text 'SER A 65 HAS WRONG CHIRALITY AT ATOM CA' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9HRT _pdbx_database_status.recvd_initial_deposition_date 2024-12-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 3 _pdbx_contact_author.email k.magiera@uj.edu.pl _pdbx_contact_author.name_first Katarzyna _pdbx_contact_author.name_last Magiera-Mularz _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-4826-6380 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Slota, A.' 1 0009-0006-2247-3302 'Golebiowska-Mendroch, K.' 2 0009-0003-8971-8587 'Plewka, J.' 3 0000-0002-0307-0907 'Magiera-Mularz, K.' 4 0000-0002-4826-6380 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Med.Chem.Lett.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1948-5875 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 16 _citation.language ? _citation.page_first 1359 _citation.page_last 1364 _citation.title 'Characterization of Clinically Evaluated Small-Molecule Inhibitors of PD-L1 for Immunotherapy.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsmedchemlett.5c00245 _citation.pdbx_database_id_PubMed 40666457 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Slota, A.' 1 ? primary 'Golebiowska-Mendroch, K.' 2 ? primary 'Kocik-Krol, J.' 3 ? primary 'Musielak, B.' 4 ? primary 'Stec, M.' 5 ? primary 'Weglarczyk, K.' 6 ? primary 'Siedlar, M.' 7 ? primary 'Skalniak, L.' 8 ? primary 'Plewka, J.' 9 ? primary 'Magiera-Mularz, K.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Programmed cell death 1 ligand 1' 14954.085 2 ? ? ? ? 2 non-polymer syn ;(2~{R})-2-[[3-[(~{E})-2-[3-(2,3-dihydro-1,4-benzodioxin-6-yl)-2-methyl-phenyl]ethenyl]-4-(trifluoromethyl)phenyl]methylamino]-2-methyl-3-oxidanyl-propanoic acid ; 527.532 1 ? ? ? ? 3 water nat water 18.015 38 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PD-L1,PDCD1 ligand 1,Programmed death ligand 1,hPD-L1,B7 homolog 1,B7-H1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSL GNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYAAALEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSL GNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYAAALEHHHHHH ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;(2~{R})-2-[[3-[(~{E})-2-[3-(2,3-dihydro-1,4-benzodioxin-6-yl)-2-methyl-phenyl]ethenyl]-4-(trifluoromethyl)phenyl]methylamino]-2-methyl-3-oxidanyl-propanoic acid ; A1IXH 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 ALA n 1 5 PHE n 1 6 THR n 1 7 VAL n 1 8 THR n 1 9 VAL n 1 10 PRO n 1 11 LYS n 1 12 ASP n 1 13 LEU n 1 14 TYR n 1 15 VAL n 1 16 VAL n 1 17 GLU n 1 18 TYR n 1 19 GLY n 1 20 SER n 1 21 ASN n 1 22 MET n 1 23 THR n 1 24 ILE n 1 25 GLU n 1 26 CYS n 1 27 LYS n 1 28 PHE n 1 29 PRO n 1 30 VAL n 1 31 GLU n 1 32 LYS n 1 33 GLN n 1 34 LEU n 1 35 ASP n 1 36 LEU n 1 37 ALA n 1 38 ALA n 1 39 LEU n 1 40 ILE n 1 41 VAL n 1 42 TYR n 1 43 TRP n 1 44 GLU n 1 45 MET n 1 46 GLU n 1 47 ASP n 1 48 LYS n 1 49 ASN n 1 50 ILE n 1 51 ILE n 1 52 GLN n 1 53 PHE n 1 54 VAL n 1 55 HIS n 1 56 GLY n 1 57 GLU n 1 58 GLU n 1 59 ASP n 1 60 LEU n 1 61 LYS n 1 62 VAL n 1 63 GLN n 1 64 HIS n 1 65 SER n 1 66 SER n 1 67 TYR n 1 68 ARG n 1 69 GLN n 1 70 ARG n 1 71 ALA n 1 72 ARG n 1 73 LEU n 1 74 LEU n 1 75 LYS n 1 76 ASP n 1 77 GLN n 1 78 LEU n 1 79 SER n 1 80 LEU n 1 81 GLY n 1 82 ASN n 1 83 ALA n 1 84 ALA n 1 85 LEU n 1 86 GLN n 1 87 ILE n 1 88 THR n 1 89 ASP n 1 90 VAL n 1 91 LYS n 1 92 LEU n 1 93 GLN n 1 94 ASP n 1 95 ALA n 1 96 GLY n 1 97 VAL n 1 98 TYR n 1 99 ARG n 1 100 CYS n 1 101 MET n 1 102 ILE n 1 103 SER n 1 104 TYR n 1 105 GLY n 1 106 GLY n 1 107 ALA n 1 108 ASP n 1 109 TYR n 1 110 LYS n 1 111 ARG n 1 112 ILE n 1 113 THR n 1 114 VAL n 1 115 LYS n 1 116 VAL n 1 117 ASN n 1 118 ALA n 1 119 PRO n 1 120 TYR n 1 121 ALA n 1 122 ALA n 1 123 ALA n 1 124 LEU n 1 125 GLU n 1 126 HIS n 1 127 HIS n 1 128 HIS n 1 129 HIS n 1 130 HIS n 1 131 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 131 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CD274, B7H1, PDCD1L1, PDCD1LG1, PDL1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1IXH non-polymer . ;(2~{R})-2-[[3-[(~{E})-2-[3-(2,3-dihydro-1,4-benzodioxin-6-yl)-2-methyl-phenyl]ethenyl]-4-(trifluoromethyl)phenyl]methylamino]-2-methyl-3-oxidanyl-propanoic acid ; ? 'C29 H28 F3 N O5' 527.532 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLY 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 PHE 28 28 28 PHE PHE A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 TRP 43 43 43 TRP TRP A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 MET 45 45 45 MET MET A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 GLN 52 52 52 GLN GLN A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 HIS 55 55 55 HIS HIS A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 ASP 59 59 59 ASP ASP A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 TYR 67 67 67 TYR TYR A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 VAL 97 97 97 VAL VAL A . n A 1 98 TYR 98 98 98 TYR TYR A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 CYS 100 100 100 CYS CYS A . n A 1 101 MET 101 101 101 MET MET A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 TYR 104 104 104 TYR TYR A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 TYR 109 109 109 TYR TYR A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 TYR 120 120 120 TYR TYR A . n A 1 121 ALA 121 121 121 ALA ALA A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 GLU 125 125 125 GLU GLU A . n A 1 126 HIS 126 126 126 HIS HIS A . n A 1 127 HIS 127 127 127 HIS HIS A . n A 1 128 HIS 128 128 128 HIS HIS A . n A 1 129 HIS 129 129 129 HIS HIS A . n A 1 130 HIS 130 130 ? ? ? A . n A 1 131 HIS 131 131 ? ? ? A . n B 1 1 MET 1 1 ? ? ? B . n B 1 2 GLY 2 2 ? ? ? B . n B 1 3 SER 3 3 ? ? ? B . n B 1 4 ALA 4 4 4 ALA ALA B . n B 1 5 PHE 5 5 5 PHE PHE B . n B 1 6 THR 6 6 6 THR THR B . n B 1 7 VAL 7 7 7 VAL VAL B . n B 1 8 THR 8 8 8 THR THR B . n B 1 9 VAL 9 9 9 VAL VAL B . n B 1 10 PRO 10 10 10 PRO PRO B . n B 1 11 LYS 11 11 11 LYS LYS B . n B 1 12 ASP 12 12 12 ASP ASP B . n B 1 13 LEU 13 13 13 LEU LEU B . n B 1 14 TYR 14 14 14 TYR TYR B . n B 1 15 VAL 15 15 15 VAL VAL B . n B 1 16 VAL 16 16 16 VAL VAL B . n B 1 17 GLU 17 17 17 GLU GLU B . n B 1 18 TYR 18 18 18 TYR TYR B . n B 1 19 GLY 19 19 19 GLY GLY B . n B 1 20 SER 20 20 20 SER SER B . n B 1 21 ASN 21 21 21 ASN ASN B . n B 1 22 MET 22 22 22 MET MET B . n B 1 23 THR 23 23 23 THR THR B . n B 1 24 ILE 24 24 24 ILE ILE B . n B 1 25 GLU 25 25 25 GLU GLU B . n B 1 26 CYS 26 26 26 CYS CYS B . n B 1 27 LYS 27 27 27 LYS LYS B . n B 1 28 PHE 28 28 28 PHE PHE B . n B 1 29 PRO 29 29 29 PRO PRO B . n B 1 30 VAL 30 30 30 VAL VAL B . n B 1 31 GLU 31 31 31 GLU GLU B . n B 1 32 LYS 32 32 32 LYS LYS B . n B 1 33 GLN 33 33 33 GLN GLN B . n B 1 34 LEU 34 34 34 LEU LEU B . n B 1 35 ASP 35 35 35 ASP ASP B . n B 1 36 LEU 36 36 36 LEU LEU B . n B 1 37 ALA 37 37 37 ALA ALA B . n B 1 38 ALA 38 38 38 ALA ALA B . n B 1 39 LEU 39 39 39 LEU LEU B . n B 1 40 ILE 40 40 40 ILE ILE B . n B 1 41 VAL 41 41 41 VAL VAL B . n B 1 42 TYR 42 42 42 TYR TYR B . n B 1 43 TRP 43 43 43 TRP TRP B . n B 1 44 GLU 44 44 44 GLU GLU B . n B 1 45 MET 45 45 45 MET MET B . n B 1 46 GLU 46 46 46 GLU GLU B . n B 1 47 ASP 47 47 47 ASP ASP B . n B 1 48 LYS 48 48 48 LYS LYS B . n B 1 49 ASN 49 49 49 ASN ASN B . n B 1 50 ILE 50 50 50 ILE ILE B . n B 1 51 ILE 51 51 51 ILE ILE B . n B 1 52 GLN 52 52 52 GLN GLN B . n B 1 53 PHE 53 53 53 PHE PHE B . n B 1 54 VAL 54 54 54 VAL VAL B . n B 1 55 HIS 55 55 55 HIS HIS B . n B 1 56 GLY 56 56 56 GLY GLY B . n B 1 57 GLU 57 57 57 GLU GLU B . n B 1 58 GLU 58 58 58 GLU GLU B . n B 1 59 ASP 59 59 59 ASP ASP B . n B 1 60 LEU 60 60 60 LEU LEU B . n B 1 61 LYS 61 61 61 LYS LYS B . n B 1 62 VAL 62 62 62 VAL VAL B . n B 1 63 GLN 63 63 63 GLN GLN B . n B 1 64 HIS 64 64 64 HIS HIS B . n B 1 65 SER 65 65 65 SER SER B . n B 1 66 SER 66 66 66 SER SER B . n B 1 67 TYR 67 67 67 TYR TYR B . n B 1 68 ARG 68 68 68 ARG ARG B . n B 1 69 GLN 69 69 69 GLN GLN B . n B 1 70 ARG 70 70 70 ARG ARG B . n B 1 71 ALA 71 71 71 ALA ALA B . n B 1 72 ARG 72 72 72 ARG ARG B . n B 1 73 LEU 73 73 73 LEU LEU B . n B 1 74 LEU 74 74 74 LEU LEU B . n B 1 75 LYS 75 75 75 LYS LYS B . n B 1 76 ASP 76 76 76 ASP ASP B . n B 1 77 GLN 77 77 77 GLN GLN B . n B 1 78 LEU 78 78 78 LEU LEU B . n B 1 79 SER 79 79 79 SER SER B . n B 1 80 LEU 80 80 80 LEU LEU B . n B 1 81 GLY 81 81 81 GLY GLY B . n B 1 82 ASN 82 82 82 ASN ASN B . n B 1 83 ALA 83 83 83 ALA ALA B . n B 1 84 ALA 84 84 84 ALA ALA B . n B 1 85 LEU 85 85 85 LEU LEU B . n B 1 86 GLN 86 86 86 GLN GLN B . n B 1 87 ILE 87 87 87 ILE ILE B . n B 1 88 THR 88 88 88 THR THR B . n B 1 89 ASP 89 89 89 ASP ASP B . n B 1 90 VAL 90 90 90 VAL VAL B . n B 1 91 LYS 91 91 91 LYS LYS B . n B 1 92 LEU 92 92 92 LEU LEU B . n B 1 93 GLN 93 93 93 GLN GLN B . n B 1 94 ASP 94 94 94 ASP ASP B . n B 1 95 ALA 95 95 95 ALA ALA B . n B 1 96 GLY 96 96 96 GLY GLY B . n B 1 97 VAL 97 97 97 VAL VAL B . n B 1 98 TYR 98 98 98 TYR TYR B . n B 1 99 ARG 99 99 99 ARG ARG B . n B 1 100 CYS 100 100 100 CYS CYS B . n B 1 101 MET 101 101 101 MET MET B . n B 1 102 ILE 102 102 102 ILE ILE B . n B 1 103 SER 103 103 103 SER SER B . n B 1 104 TYR 104 104 104 TYR TYR B . n B 1 105 GLY 105 105 105 GLY GLY B . n B 1 106 GLY 106 106 106 GLY GLY B . n B 1 107 ALA 107 107 107 ALA ALA B . n B 1 108 ASP 108 108 108 ASP ASP B . n B 1 109 TYR 109 109 109 TYR TYR B . n B 1 110 LYS 110 110 110 LYS LYS B . n B 1 111 ARG 111 111 111 ARG ARG B . n B 1 112 ILE 112 112 112 ILE ILE B . n B 1 113 THR 113 113 113 THR THR B . n B 1 114 VAL 114 114 114 VAL VAL B . n B 1 115 LYS 115 115 115 LYS LYS B . n B 1 116 VAL 116 116 116 VAL VAL B . n B 1 117 ASN 117 117 117 ASN ASN B . n B 1 118 ALA 118 118 118 ALA ALA B . n B 1 119 PRO 119 119 119 PRO PRO B . n B 1 120 TYR 120 120 120 TYR TYR B . n B 1 121 ALA 121 121 121 ALA ALA B . n B 1 122 ALA 122 122 122 ALA ALA B . n B 1 123 ALA 123 123 123 ALA ALA B . n B 1 124 LEU 124 124 124 LEU LEU B . n B 1 125 GLU 125 125 125 GLU GLU B . n B 1 126 HIS 126 126 126 HIS HIS B . n B 1 127 HIS 127 127 127 HIS HIS B . n B 1 128 HIS 128 128 128 HIS HIS B . n B 1 129 HIS 129 129 129 HIS HIS B . n B 1 130 HIS 130 130 ? ? ? B . n B 1 131 HIS 131 131 ? ? ? B . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1IXH _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1IXH _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 A1IXH 1 201 1 A1IXH 00Z B . D 3 HOH 1 201 1 HOH HOH A . D 3 HOH 2 202 3 HOH HOH A . D 3 HOH 3 203 19 HOH HOH A . D 3 HOH 4 204 9 HOH HOH A . D 3 HOH 5 205 12 HOH HOH A . D 3 HOH 6 206 14 HOH HOH A . D 3 HOH 7 207 11 HOH HOH A . D 3 HOH 8 208 15 HOH HOH A . D 3 HOH 9 209 20 HOH HOH A . D 3 HOH 10 210 18 HOH HOH A . D 3 HOH 11 211 5 HOH HOH A . D 3 HOH 12 212 13 HOH HOH A . D 3 HOH 13 213 5 HOH HOH A . D 3 HOH 14 214 23 HOH HOH A . D 3 HOH 15 215 7 HOH HOH A . D 3 HOH 16 216 22 HOH HOH A . D 3 HOH 17 217 13 HOH HOH A . D 3 HOH 18 218 6 HOH HOH A . D 3 HOH 19 219 24 HOH HOH A . D 3 HOH 20 220 17 HOH HOH A . D 3 HOH 21 221 21 HOH HOH A . D 3 HOH 22 222 18 HOH HOH A . D 3 HOH 23 223 22 HOH HOH A . D 3 HOH 24 224 10 HOH HOH A . E 3 HOH 1 301 25 HOH HOH B . E 3 HOH 2 302 2 HOH HOH B . E 3 HOH 3 303 19 HOH HOH B . E 3 HOH 4 304 2 HOH HOH B . E 3 HOH 5 305 9 HOH HOH B . E 3 HOH 6 306 3 HOH HOH B . E 3 HOH 7 307 17 HOH HOH B . E 3 HOH 8 308 4 HOH HOH B . E 3 HOH 9 309 6 HOH HOH B . E 3 HOH 10 310 8 HOH HOH B . E 3 HOH 11 311 1 HOH HOH B . E 3 HOH 12 312 16 HOH HOH B . E 3 HOH 13 313 7 HOH HOH B . E 3 HOH 14 314 11 HOH HOH B . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? v5.5.0110 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9HRT _cell.details ? _cell.formula_units_Z ? _cell.length_a 50.859 _cell.length_a_esd ? _cell.length_b 52.030 _cell.length_b_esd ? _cell.length_c 111.318 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9HRT _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9HRT _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.46 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.05 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2M Ammonium sulfate; 0.1 soudium cacodylate; 6.53% w/v PEG 8000' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2024-07-12 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9677 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, DESY BEAMLINE P11' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9677 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline P11 _diffrn_source.pdbx_synchrotron_site 'PETRA III, DESY' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9HRT _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.30 _reflns.d_resolution_low 47.18 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13321 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.70 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.90 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.30 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.99 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.16 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.30 _reflns_shell.d_res_low 2.38 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1308 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.83 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.89 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 3.15 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] -5.25 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 2.10 _refine.B_iso_max ? _refine.B_iso_mean 54.039 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details 'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9HRT _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.30 _refine.ls_d_res_low 47.18 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12665 _refine.ls_number_reflns_R_free 631 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.90 _refine.ls_percent_reflns_R_free 4.7 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.20945 _refine.ls_R_factor_R_free 0.26324 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.20667 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.343 _refine.pdbx_overall_ESU_R_Free 0.253 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 11.902 _refine.overall_SU_ML 0.259 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 47.18 _refine_hist.number_atoms_solvent 38 _refine_hist.number_atoms_total 2102 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2026 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 38 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # _struct.entry_id 9HRT _struct.title 'Structure of human PD-L1 in complex with clinically evaluated inhibitor' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9HRT _struct_keywords.text 'small-molecule inhibitor, PD-1 pathway, Programmed death-ligand 1, IMMUNE SYSTEM' _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PD1L1_HUMAN _struct_ref.pdbx_db_accession Q9NZQ7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNA ALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPY ; _struct_ref.pdbx_align_begin 18 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9HRT A 4 ? 120 ? Q9NZQ7 18 ? 134 ? 4 120 2 1 9HRT B 4 ? 120 ? Q9NZQ7 18 ? 134 ? 4 120 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9HRT MET A 1 ? UNP Q9NZQ7 ? ? 'initiating methionine' 1 1 1 9HRT GLY A 2 ? UNP Q9NZQ7 ? ? 'expression tag' 2 2 1 9HRT SER A 3 ? UNP Q9NZQ7 ? ? 'expression tag' 3 3 1 9HRT ALA A 121 ? UNP Q9NZQ7 ? ? 'expression tag' 121 4 1 9HRT ALA A 122 ? UNP Q9NZQ7 ? ? 'expression tag' 122 5 1 9HRT ALA A 123 ? UNP Q9NZQ7 ? ? 'expression tag' 123 6 1 9HRT LEU A 124 ? UNP Q9NZQ7 ? ? 'expression tag' 124 7 1 9HRT GLU A 125 ? UNP Q9NZQ7 ? ? 'expression tag' 125 8 1 9HRT HIS A 126 ? UNP Q9NZQ7 ? ? 'expression tag' 126 9 1 9HRT HIS A 127 ? UNP Q9NZQ7 ? ? 'expression tag' 127 10 1 9HRT HIS A 128 ? UNP Q9NZQ7 ? ? 'expression tag' 128 11 1 9HRT HIS A 129 ? UNP Q9NZQ7 ? ? 'expression tag' 129 12 1 9HRT HIS A 130 ? UNP Q9NZQ7 ? ? 'expression tag' 130 13 1 9HRT HIS A 131 ? UNP Q9NZQ7 ? ? 'expression tag' 131 14 2 9HRT MET B 1 ? UNP Q9NZQ7 ? ? 'initiating methionine' 1 15 2 9HRT GLY B 2 ? UNP Q9NZQ7 ? ? 'expression tag' 2 16 2 9HRT SER B 3 ? UNP Q9NZQ7 ? ? 'expression tag' 3 17 2 9HRT ALA B 121 ? UNP Q9NZQ7 ? ? 'expression tag' 121 18 2 9HRT ALA B 122 ? UNP Q9NZQ7 ? ? 'expression tag' 122 19 2 9HRT ALA B 123 ? UNP Q9NZQ7 ? ? 'expression tag' 123 20 2 9HRT LEU B 124 ? UNP Q9NZQ7 ? ? 'expression tag' 124 21 2 9HRT GLU B 125 ? UNP Q9NZQ7 ? ? 'expression tag' 125 22 2 9HRT HIS B 126 ? UNP Q9NZQ7 ? ? 'expression tag' 126 23 2 9HRT HIS B 127 ? UNP Q9NZQ7 ? ? 'expression tag' 127 24 2 9HRT HIS B 128 ? UNP Q9NZQ7 ? ? 'expression tag' 128 25 2 9HRT HIS B 129 ? UNP Q9NZQ7 ? ? 'expression tag' 129 26 2 9HRT HIS B 130 ? UNP Q9NZQ7 ? ? 'expression tag' 130 27 2 9HRT HIS B 131 ? UNP Q9NZQ7 ? ? 'expression tag' 131 28 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1330 ? 1 MORE -4 ? 1 'SSA (A^2)' 13600 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 35 ? ALA A 38 ? ASP A 35 ALA A 38 5 ? 4 HELX_P HELX_P2 AA2 HIS A 64 ? ARG A 68 ? HIS A 64 ARG A 68 5 ? 5 HELX_P HELX_P3 AA3 LYS A 75 ? LEU A 80 ? LYS A 75 LEU A 80 5 ? 6 HELX_P HELX_P4 AA4 LYS A 91 ? ALA A 95 ? LYS A 91 ALA A 95 5 ? 5 HELX_P HELX_P5 AA5 PRO A 119 ? HIS A 128 ? PRO A 119 HIS A 128 1 ? 10 HELX_P HELX_P6 AA6 ASP B 35 ? ALA B 38 ? ASP B 35 ALA B 38 5 ? 4 HELX_P HELX_P7 AA7 LEU B 60 ? GLN B 63 ? LEU B 60 GLN B 63 5 ? 4 HELX_P HELX_P8 AA8 HIS B 64 ? ARG B 68 ? HIS B 64 ARG B 68 5 ? 5 HELX_P HELX_P9 AA9 LYS B 75 ? LEU B 80 ? LYS B 75 LEU B 80 5 ? 6 HELX_P HELX_P10 AB1 LYS B 91 ? ALA B 95 ? LYS B 91 ALA B 95 5 ? 5 HELX_P HELX_P11 AB2 PRO B 119 ? HIS B 129 ? PRO B 119 HIS B 129 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 100 SG ? ? A CYS 26 A CYS 100 1_555 ? ? ? ? ? ? ? 2.013 ? ? disulf2 disulf ? ? B CYS 26 SG ? ? ? 1_555 B CYS 100 SG ? ? B CYS 26 B CYS 100 1_555 ? ? ? ? ? ? ? 2.018 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 26 ? CYS A 100 ? CYS A 26 ? 1_555 CYS A 100 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS B 26 ? CYS B 100 ? CYS B 26 ? 1_555 CYS B 100 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 3 ? AA3 ? 6 ? AA4 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA3 5 6 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 13 ? GLU A 17 ? LEU A 13 GLU A 17 AA1 2 ALA A 107 ? ASN A 117 ? ALA A 107 ASN A 117 AA1 3 GLY A 96 ? SER A 103 ? GLY A 96 SER A 103 AA1 4 ILE A 40 ? MET A 45 ? ILE A 40 MET A 45 AA1 5 LYS A 48 ? VAL A 54 ? LYS A 48 VAL A 54 AA1 6 GLU A 57 ? GLU A 58 ? GLU A 57 GLU A 58 AA2 1 ASN A 21 ? LYS A 27 ? ASN A 21 LYS A 27 AA2 2 ASN A 82 ? THR A 88 ? ASN A 82 THR A 88 AA2 3 ALA A 71 ? LEU A 73 ? ALA A 71 LEU A 73 AA3 1 LEU B 13 ? GLU B 17 ? LEU B 13 GLU B 17 AA3 2 ALA B 107 ? ASN B 117 ? ALA B 107 ASN B 117 AA3 3 GLY B 96 ? SER B 103 ? GLY B 96 SER B 103 AA3 4 ILE B 40 ? MET B 45 ? ILE B 40 MET B 45 AA3 5 LYS B 48 ? VAL B 54 ? LYS B 48 VAL B 54 AA3 6 GLU B 57 ? GLU B 58 ? GLU B 57 GLU B 58 AA4 1 MET B 22 ? LYS B 27 ? MET B 22 LYS B 27 AA4 2 ASN B 82 ? ILE B 87 ? ASN B 82 ILE B 87 AA4 3 ALA B 71 ? LEU B 73 ? ALA B 71 LEU B 73 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TYR A 14 ? N TYR A 14 O LYS A 115 ? O LYS A 115 AA1 2 3 O ILE A 112 ? O ILE A 112 N TYR A 98 ? N TYR A 98 AA1 3 4 O MET A 101 ? O MET A 101 N TYR A 42 ? N TYR A 42 AA1 4 5 N VAL A 41 ? N VAL A 41 O PHE A 53 ? O PHE A 53 AA1 5 6 N VAL A 54 ? N VAL A 54 O GLU A 57 ? O GLU A 57 AA2 1 2 N MET A 22 ? N MET A 22 O ILE A 87 ? O ILE A 87 AA2 2 3 O GLN A 86 ? O GLN A 86 N ARG A 72 ? N ARG A 72 AA3 1 2 N TYR B 14 ? N TYR B 14 O LYS B 115 ? O LYS B 115 AA3 2 3 O ILE B 112 ? O ILE B 112 N TYR B 98 ? N TYR B 98 AA3 3 4 O MET B 101 ? O MET B 101 N TYR B 42 ? N TYR B 42 AA3 4 5 N VAL B 41 ? N VAL B 41 O PHE B 53 ? O PHE B 53 AA3 5 6 N VAL B 54 ? N VAL B 54 O GLU B 57 ? O GLU B 57 AA4 1 2 N MET B 22 ? N MET B 22 O ILE B 87 ? O ILE B 87 AA4 2 3 O GLN B 86 ? O GLN B 86 N ARG B 72 ? N ARG B 72 # _pdbx_entry_details.entry_id 9HRT _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 NZ B LYS 32 ? ? O B HOH 301 ? ? 1.46 2 1 OD1 A ASP 76 ? ? O A HOH 201 ? ? 1.81 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 32 ? ? 81.52 -35.13 2 1 SER A 66 ? ? -32.08 -34.57 3 1 TYR A 104 ? ? -150.29 84.92 4 1 HIS A 128 ? ? -101.45 62.67 5 1 TYR B 18 ? ? -39.04 125.95 6 1 LYS B 32 ? ? 49.51 -129.40 7 1 TYR B 104 ? ? -152.87 84.71 # _pdbx_validate_chiral.id 1 _pdbx_validate_chiral.PDB_model_num 1 _pdbx_validate_chiral.auth_atom_id CA _pdbx_validate_chiral.label_alt_id ? _pdbx_validate_chiral.auth_asym_id A _pdbx_validate_chiral.auth_comp_id SER _pdbx_validate_chiral.auth_seq_id 65 _pdbx_validate_chiral.PDB_ins_code ? _pdbx_validate_chiral.details 'WRONG HAND' _pdbx_validate_chiral.omega . # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 68 ? ? 0.092 'SIDE CHAIN' 2 1 ARG A 72 ? ? 0.097 'SIDE CHAIN' 3 1 ARG A 99 ? ? 0.081 'SIDE CHAIN' 4 1 ARG A 111 ? ? 0.141 'SIDE CHAIN' 5 1 ARG B 70 ? ? 0.083 'SIDE CHAIN' 6 1 ARG B 72 ? ? 0.098 'SIDE CHAIN' 7 1 ARG B 99 ? ? 0.120 'SIDE CHAIN' # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id B _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 308 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id E _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLY 2 ? A GLY 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A HIS 130 ? A HIS 130 5 1 Y 1 A HIS 131 ? A HIS 131 6 1 Y 1 B MET 1 ? B MET 1 7 1 Y 1 B GLY 2 ? B GLY 2 8 1 Y 1 B SER 3 ? B SER 3 9 1 Y 1 B HIS 130 ? B HIS 130 10 1 Y 1 B HIS 131 ? B HIS 131 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1IXH C15 C N N 1 A1IXH C16 C N R 2 A1IXH C17 C N N 3 A1IXH C18 C N N 4 A1IXH C19 C N N 5 A1IXH C20 C Y N 6 A1IXH C21 C N N 7 A1IXH C22 C Y N 8 A1IXH C23 C Y N 9 A1IXH C24 C Y N 10 A1IXH C25 C Y N 11 A1IXH C26 C N N 12 A1IXH C27 C N N 13 A1IXH C28 C Y N 14 A1IXH C1 C N N 15 A1IXH C2 C Y N 16 A1IXH C3 C Y N 17 A1IXH C4 C Y N 18 A1IXH C5 C Y N 19 A1IXH C6 C Y N 20 A1IXH C7 C Y N 21 A1IXH C8 C N N 22 A1IXH C9 C N N 23 A1IXH C10 C Y N 24 A1IXH C11 C Y N 25 A1IXH C12 C Y N 26 A1IXH C13 C Y N 27 A1IXH C14 C Y N 28 A1IXH N1 N N N 29 A1IXH O1 O N N 30 A1IXH O2 O N N 31 A1IXH O3 O N N 32 A1IXH F1 F N N 33 A1IXH F2 F N N 34 A1IXH F3 F N N 35 A1IXH O4 O N N 36 A1IXH O5 O N N 37 A1IXH C29 C Y N 38 A1IXH H1 H N N 39 A1IXH H2 H N N 40 A1IXH H3 H N N 41 A1IXH H4 H N N 42 A1IXH H5 H N N 43 A1IXH H6 H N N 44 A1IXH H7 H N N 45 A1IXH H8 H N N 46 A1IXH H9 H N N 47 A1IXH H10 H N N 48 A1IXH H11 H N N 49 A1IXH H12 H N N 50 A1IXH H13 H N N 51 A1IXH H14 H N N 52 A1IXH H15 H N N 53 A1IXH H16 H N N 54 A1IXH H17 H N N 55 A1IXH H18 H N N 56 A1IXH H19 H N N 57 A1IXH H20 H N N 58 A1IXH H21 H N N 59 A1IXH H22 H N N 60 A1IXH H23 H N N 61 A1IXH H24 H N N 62 A1IXH H25 H N N 63 A1IXH H27 H N N 64 A1IXH H28 H N N 65 A1IXH H29 H N N 66 ALA N N N N 67 ALA CA C N S 68 ALA C C N N 69 ALA O O N N 70 ALA CB C N N 71 ALA OXT O N N 72 ALA H H N N 73 ALA H2 H N N 74 ALA HA H N N 75 ALA HB1 H N N 76 ALA HB2 H N N 77 ALA HB3 H N N 78 ALA HXT H N N 79 ARG N N N N 80 ARG CA C N S 81 ARG C C N N 82 ARG O O N N 83 ARG CB C N N 84 ARG CG C N N 85 ARG CD C N N 86 ARG NE N N N 87 ARG CZ C N N 88 ARG NH1 N N N 89 ARG NH2 N N N 90 ARG OXT O N N 91 ARG H H N N 92 ARG H2 H N N 93 ARG HA H N N 94 ARG HB2 H N N 95 ARG HB3 H N N 96 ARG HG2 H N N 97 ARG HG3 H N N 98 ARG HD2 H N N 99 ARG HD3 H N N 100 ARG HE H N N 101 ARG HH11 H N N 102 ARG HH12 H N N 103 ARG HH21 H N N 104 ARG HH22 H N N 105 ARG HXT H N N 106 ASN N N N N 107 ASN CA C N S 108 ASN C C N N 109 ASN O O N N 110 ASN CB C N N 111 ASN CG C N N 112 ASN OD1 O N N 113 ASN ND2 N N N 114 ASN OXT O N N 115 ASN H H N N 116 ASN H2 H N N 117 ASN HA H N N 118 ASN HB2 H N N 119 ASN HB3 H N N 120 ASN HD21 H N N 121 ASN HD22 H N N 122 ASN HXT H N N 123 ASP N N N N 124 ASP CA C N S 125 ASP C C N N 126 ASP O O N N 127 ASP CB C N N 128 ASP CG C N N 129 ASP OD1 O N N 130 ASP OD2 O N N 131 ASP OXT O N N 132 ASP H H N N 133 ASP H2 H N N 134 ASP HA H N N 135 ASP HB2 H N N 136 ASP HB3 H N N 137 ASP HD2 H N N 138 ASP HXT H N N 139 CYS N N N N 140 CYS CA C N R 141 CYS C C N N 142 CYS O O N N 143 CYS CB C N N 144 CYS SG S N N 145 CYS OXT O N N 146 CYS H H N N 147 CYS H2 H N N 148 CYS HA H N N 149 CYS HB2 H N N 150 CYS HB3 H N N 151 CYS HG H N N 152 CYS HXT H N N 153 GLN N N N N 154 GLN CA C N S 155 GLN C C N N 156 GLN O O N N 157 GLN CB C N N 158 GLN CG C N N 159 GLN CD C N N 160 GLN OE1 O N N 161 GLN NE2 N N N 162 GLN OXT O N N 163 GLN H H N N 164 GLN H2 H N N 165 GLN HA H N N 166 GLN HB2 H N N 167 GLN HB3 H N N 168 GLN HG2 H N N 169 GLN HG3 H N N 170 GLN HE21 H N N 171 GLN HE22 H N N 172 GLN HXT H N N 173 GLU N N N N 174 GLU CA C N S 175 GLU C C N N 176 GLU O O N N 177 GLU CB C N N 178 GLU CG C N N 179 GLU CD C N N 180 GLU OE1 O N N 181 GLU OE2 O N N 182 GLU OXT O N N 183 GLU H H N N 184 GLU H2 H N N 185 GLU HA H N N 186 GLU HB2 H N N 187 GLU HB3 H N N 188 GLU HG2 H N N 189 GLU HG3 H N N 190 GLU HE2 H N N 191 GLU HXT H N N 192 GLY N N N N 193 GLY CA C N N 194 GLY C C N N 195 GLY O O N N 196 GLY OXT O N N 197 GLY H H N N 198 GLY H2 H N N 199 GLY HA2 H N N 200 GLY HA3 H N N 201 GLY HXT H N N 202 HIS N N N N 203 HIS CA C N S 204 HIS C C N N 205 HIS O O N N 206 HIS CB C N N 207 HIS CG C Y N 208 HIS ND1 N Y N 209 HIS CD2 C Y N 210 HIS CE1 C Y N 211 HIS NE2 N Y N 212 HIS OXT O N N 213 HIS H H N N 214 HIS H2 H N N 215 HIS HA H N N 216 HIS HB2 H N N 217 HIS HB3 H N N 218 HIS HD1 H N N 219 HIS HD2 H N N 220 HIS HE1 H N N 221 HIS HE2 H N N 222 HIS HXT H N N 223 HOH O O N N 224 HOH H1 H N N 225 HOH H2 H N N 226 ILE N N N N 227 ILE CA C N S 228 ILE C C N N 229 ILE O O N N 230 ILE CB C N S 231 ILE CG1 C N N 232 ILE CG2 C N N 233 ILE CD1 C N N 234 ILE OXT O N N 235 ILE H H N N 236 ILE H2 H N N 237 ILE HA H N N 238 ILE HB H N N 239 ILE HG12 H N N 240 ILE HG13 H N N 241 ILE HG21 H N N 242 ILE HG22 H N N 243 ILE HG23 H N N 244 ILE HD11 H N N 245 ILE HD12 H N N 246 ILE HD13 H N N 247 ILE HXT H N N 248 LEU N N N N 249 LEU CA C N S 250 LEU C C N N 251 LEU O O N N 252 LEU CB C N N 253 LEU CG C N N 254 LEU CD1 C N N 255 LEU CD2 C N N 256 LEU OXT O N N 257 LEU H H N N 258 LEU H2 H N N 259 LEU HA H N N 260 LEU HB2 H N N 261 LEU HB3 H N N 262 LEU HG H N N 263 LEU HD11 H N N 264 LEU HD12 H N N 265 LEU HD13 H N N 266 LEU HD21 H N N 267 LEU HD22 H N N 268 LEU HD23 H N N 269 LEU HXT H N N 270 LYS N N N N 271 LYS CA C N S 272 LYS C C N N 273 LYS O O N N 274 LYS CB C N N 275 LYS CG C N N 276 LYS CD C N N 277 LYS CE C N N 278 LYS NZ N N N 279 LYS OXT O N N 280 LYS H H N N 281 LYS H2 H N N 282 LYS HA H N N 283 LYS HB2 H N N 284 LYS HB3 H N N 285 LYS HG2 H N N 286 LYS HG3 H N N 287 LYS HD2 H N N 288 LYS HD3 H N N 289 LYS HE2 H N N 290 LYS HE3 H N N 291 LYS HZ1 H N N 292 LYS HZ2 H N N 293 LYS HZ3 H N N 294 LYS HXT H N N 295 MET N N N N 296 MET CA C N S 297 MET C C N N 298 MET O O N N 299 MET CB C N N 300 MET CG C N N 301 MET SD S N N 302 MET CE C N N 303 MET OXT O N N 304 MET H H N N 305 MET H2 H N N 306 MET HA H N N 307 MET HB2 H N N 308 MET HB3 H N N 309 MET HG2 H N N 310 MET HG3 H N N 311 MET HE1 H N N 312 MET HE2 H N N 313 MET HE3 H N N 314 MET HXT H N N 315 PHE N N N N 316 PHE CA C N S 317 PHE C C N N 318 PHE O O N N 319 PHE CB C N N 320 PHE CG C Y N 321 PHE CD1 C Y N 322 PHE CD2 C Y N 323 PHE CE1 C Y N 324 PHE CE2 C Y N 325 PHE CZ C Y N 326 PHE OXT O N N 327 PHE H H N N 328 PHE H2 H N N 329 PHE HA H N N 330 PHE HB2 H N N 331 PHE HB3 H N N 332 PHE HD1 H N N 333 PHE HD2 H N N 334 PHE HE1 H N N 335 PHE HE2 H N N 336 PHE HZ H N N 337 PHE HXT H N N 338 PRO N N N N 339 PRO CA C N S 340 PRO C C N N 341 PRO O O N N 342 PRO CB C N N 343 PRO CG C N N 344 PRO CD C N N 345 PRO OXT O N N 346 PRO H H N N 347 PRO HA H N N 348 PRO HB2 H N N 349 PRO HB3 H N N 350 PRO HG2 H N N 351 PRO HG3 H N N 352 PRO HD2 H N N 353 PRO HD3 H N N 354 PRO HXT H N N 355 SER N N N N 356 SER CA C N S 357 SER C C N N 358 SER O O N N 359 SER CB C N N 360 SER OG O N N 361 SER OXT O N N 362 SER H H N N 363 SER H2 H N N 364 SER HA H N N 365 SER HB2 H N N 366 SER HB3 H N N 367 SER HG H N N 368 SER HXT H N N 369 THR N N N N 370 THR CA C N S 371 THR C C N N 372 THR O O N N 373 THR CB C N R 374 THR OG1 O N N 375 THR CG2 C N N 376 THR OXT O N N 377 THR H H N N 378 THR H2 H N N 379 THR HA H N N 380 THR HB H N N 381 THR HG1 H N N 382 THR HG21 H N N 383 THR HG22 H N N 384 THR HG23 H N N 385 THR HXT H N N 386 TRP N N N N 387 TRP CA C N S 388 TRP C C N N 389 TRP O O N N 390 TRP CB C N N 391 TRP CG C Y N 392 TRP CD1 C Y N 393 TRP CD2 C Y N 394 TRP NE1 N Y N 395 TRP CE2 C Y N 396 TRP CE3 C Y N 397 TRP CZ2 C Y N 398 TRP CZ3 C Y N 399 TRP CH2 C Y N 400 TRP OXT O N N 401 TRP H H N N 402 TRP H2 H N N 403 TRP HA H N N 404 TRP HB2 H N N 405 TRP HB3 H N N 406 TRP HD1 H N N 407 TRP HE1 H N N 408 TRP HE3 H N N 409 TRP HZ2 H N N 410 TRP HZ3 H N N 411 TRP HH2 H N N 412 TRP HXT H N N 413 TYR N N N N 414 TYR CA C N S 415 TYR C C N N 416 TYR O O N N 417 TYR CB C N N 418 TYR CG C Y N 419 TYR CD1 C Y N 420 TYR CD2 C Y N 421 TYR CE1 C Y N 422 TYR CE2 C Y N 423 TYR CZ C Y N 424 TYR OH O N N 425 TYR OXT O N N 426 TYR H H N N 427 TYR H2 H N N 428 TYR HA H N N 429 TYR HB2 H N N 430 TYR HB3 H N N 431 TYR HD1 H N N 432 TYR HD2 H N N 433 TYR HE1 H N N 434 TYR HE2 H N N 435 TYR HH H N N 436 TYR HXT H N N 437 VAL N N N N 438 VAL CA C N S 439 VAL C C N N 440 VAL O O N N 441 VAL CB C N N 442 VAL CG1 C N N 443 VAL CG2 C N N 444 VAL OXT O N N 445 VAL H H N N 446 VAL H2 H N N 447 VAL HA H N N 448 VAL HB H N N 449 VAL HG11 H N N 450 VAL HG12 H N N 451 VAL HG13 H N N 452 VAL HG21 H N N 453 VAL HG22 H N N 454 VAL HG23 H N N 455 VAL HXT H N N 456 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1IXH C27 C26 sing N N 1 A1IXH C27 O5 sing N N 2 A1IXH C26 O4 sing N N 3 A1IXH O5 C28 sing N N 4 A1IXH O4 C25 sing N N 5 A1IXH C28 C25 doub Y N 6 A1IXH C28 C29 sing Y N 7 A1IXH C25 C24 sing Y N 8 A1IXH C29 C22 doub Y N 9 A1IXH C24 C23 doub Y N 10 A1IXH C22 C23 sing Y N 11 A1IXH C22 C3 sing N N 12 A1IXH C18 C16 sing N N 13 A1IXH C3 C4 doub Y N 14 A1IXH C3 C2 sing Y N 15 A1IXH C1 C2 sing N N 16 A1IXH C4 C5 sing Y N 17 A1IXH C2 C7 doub Y N 18 A1IXH O3 C19 doub N N 19 A1IXH C5 C6 doub Y N 20 A1IXH C16 N1 sing N N 21 A1IXH C16 C19 sing N N 22 A1IXH C16 C17 sing N N 23 A1IXH C15 N1 sing N N 24 A1IXH C15 C14 sing N N 25 A1IXH C7 C6 sing Y N 26 A1IXH C7 C8 sing N N 27 A1IXH C9 C8 doub N E 28 A1IXH C9 C10 sing N N 29 A1IXH C20 C14 doub Y N 30 A1IXH C20 C10 sing Y N 31 A1IXH C19 O2 sing N N 32 A1IXH C17 O1 sing N N 33 A1IXH C14 C13 sing Y N 34 A1IXH C10 C11 doub Y N 35 A1IXH C13 C12 doub Y N 36 A1IXH C11 C12 sing Y N 37 A1IXH C11 C21 sing N N 38 A1IXH F3 C21 sing N N 39 A1IXH F2 C21 sing N N 40 A1IXH C21 F1 sing N N 41 A1IXH C15 H1 sing N N 42 A1IXH C15 H2 sing N N 43 A1IXH C17 H3 sing N N 44 A1IXH C17 H4 sing N N 45 A1IXH C18 H5 sing N N 46 A1IXH C18 H6 sing N N 47 A1IXH C18 H7 sing N N 48 A1IXH C20 H8 sing N N 49 A1IXH C23 H9 sing N N 50 A1IXH C24 H10 sing N N 51 A1IXH C26 H11 sing N N 52 A1IXH C26 H12 sing N N 53 A1IXH C27 H13 sing N N 54 A1IXH C27 H14 sing N N 55 A1IXH C1 H15 sing N N 56 A1IXH C1 H16 sing N N 57 A1IXH C1 H17 sing N N 58 A1IXH C4 H18 sing N N 59 A1IXH C5 H19 sing N N 60 A1IXH C6 H20 sing N N 61 A1IXH C8 H21 sing N N 62 A1IXH C9 H22 sing N N 63 A1IXH C12 H23 sing N N 64 A1IXH C13 H24 sing N N 65 A1IXH N1 H25 sing N N 66 A1IXH O1 H27 sing N N 67 A1IXH O2 H28 sing N N 68 A1IXH C29 H29 sing N N 69 ALA N CA sing N N 70 ALA N H sing N N 71 ALA N H2 sing N N 72 ALA CA C sing N N 73 ALA CA CB sing N N 74 ALA CA HA sing N N 75 ALA C O doub N N 76 ALA C OXT sing N N 77 ALA CB HB1 sing N N 78 ALA CB HB2 sing N N 79 ALA CB HB3 sing N N 80 ALA OXT HXT sing N N 81 ARG N CA sing N N 82 ARG N H sing N N 83 ARG N H2 sing N N 84 ARG CA C sing N N 85 ARG CA CB sing N N 86 ARG CA HA sing N N 87 ARG C O doub N N 88 ARG C OXT sing N N 89 ARG CB CG sing N N 90 ARG CB HB2 sing N N 91 ARG CB HB3 sing N N 92 ARG CG CD sing N N 93 ARG CG HG2 sing N N 94 ARG CG HG3 sing N N 95 ARG CD NE sing N N 96 ARG CD HD2 sing N N 97 ARG CD HD3 sing N N 98 ARG NE CZ sing N N 99 ARG NE HE sing N N 100 ARG CZ NH1 sing N N 101 ARG CZ NH2 doub N N 102 ARG NH1 HH11 sing N N 103 ARG NH1 HH12 sing N N 104 ARG NH2 HH21 sing N N 105 ARG NH2 HH22 sing N N 106 ARG OXT HXT sing N N 107 ASN N CA sing N N 108 ASN N H sing N N 109 ASN N H2 sing N N 110 ASN CA C sing N N 111 ASN CA CB sing N N 112 ASN CA HA sing N N 113 ASN C O doub N N 114 ASN C OXT sing N N 115 ASN CB CG sing N N 116 ASN CB HB2 sing N N 117 ASN CB HB3 sing N N 118 ASN CG OD1 doub N N 119 ASN CG ND2 sing N N 120 ASN ND2 HD21 sing N N 121 ASN ND2 HD22 sing N N 122 ASN OXT HXT sing N N 123 ASP N CA sing N N 124 ASP N H sing N N 125 ASP N H2 sing N N 126 ASP CA C sing N N 127 ASP CA CB sing N N 128 ASP CA HA sing N N 129 ASP C O doub N N 130 ASP C OXT sing N N 131 ASP CB CG sing N N 132 ASP CB HB2 sing N N 133 ASP CB HB3 sing N N 134 ASP CG OD1 doub N N 135 ASP CG OD2 sing N N 136 ASP OD2 HD2 sing N N 137 ASP OXT HXT sing N N 138 CYS N CA sing N N 139 CYS N H sing N N 140 CYS N H2 sing N N 141 CYS CA C sing N N 142 CYS CA CB sing N N 143 CYS CA HA sing N N 144 CYS C O doub N N 145 CYS C OXT sing N N 146 CYS CB SG sing N N 147 CYS CB HB2 sing N N 148 CYS CB HB3 sing N N 149 CYS SG HG sing N N 150 CYS OXT HXT sing N N 151 GLN N CA sing N N 152 GLN N H sing N N 153 GLN N H2 sing N N 154 GLN CA C sing N N 155 GLN CA CB sing N N 156 GLN CA HA sing N N 157 GLN C O doub N N 158 GLN C OXT sing N N 159 GLN CB CG sing N N 160 GLN CB HB2 sing N N 161 GLN CB HB3 sing N N 162 GLN CG CD sing N N 163 GLN CG HG2 sing N N 164 GLN CG HG3 sing N N 165 GLN CD OE1 doub N N 166 GLN CD NE2 sing N N 167 GLN NE2 HE21 sing N N 168 GLN NE2 HE22 sing N N 169 GLN OXT HXT sing N N 170 GLU N CA sing N N 171 GLU N H sing N N 172 GLU N H2 sing N N 173 GLU CA C sing N N 174 GLU CA CB sing N N 175 GLU CA HA sing N N 176 GLU C O doub N N 177 GLU C OXT sing N N 178 GLU CB CG sing N N 179 GLU CB HB2 sing N N 180 GLU CB HB3 sing N N 181 GLU CG CD sing N N 182 GLU CG HG2 sing N N 183 GLU CG HG3 sing N N 184 GLU CD OE1 doub N N 185 GLU CD OE2 sing N N 186 GLU OE2 HE2 sing N N 187 GLU OXT HXT sing N N 188 GLY N CA sing N N 189 GLY N H sing N N 190 GLY N H2 sing N N 191 GLY CA C sing N N 192 GLY CA HA2 sing N N 193 GLY CA HA3 sing N N 194 GLY C O doub N N 195 GLY C OXT sing N N 196 GLY OXT HXT sing N N 197 HIS N CA sing N N 198 HIS N H sing N N 199 HIS N H2 sing N N 200 HIS CA C sing N N 201 HIS CA CB sing N N 202 HIS CA HA sing N N 203 HIS C O doub N N 204 HIS C OXT sing N N 205 HIS CB CG sing N N 206 HIS CB HB2 sing N N 207 HIS CB HB3 sing N N 208 HIS CG ND1 sing Y N 209 HIS CG CD2 doub Y N 210 HIS ND1 CE1 doub Y N 211 HIS ND1 HD1 sing N N 212 HIS CD2 NE2 sing Y N 213 HIS CD2 HD2 sing N N 214 HIS CE1 NE2 sing Y N 215 HIS CE1 HE1 sing N N 216 HIS NE2 HE2 sing N N 217 HIS OXT HXT sing N N 218 HOH O H1 sing N N 219 HOH O H2 sing N N 220 ILE N CA sing N N 221 ILE N H sing N N 222 ILE N H2 sing N N 223 ILE CA C sing N N 224 ILE CA CB sing N N 225 ILE CA HA sing N N 226 ILE C O doub N N 227 ILE C OXT sing N N 228 ILE CB CG1 sing N N 229 ILE CB CG2 sing N N 230 ILE CB HB sing N N 231 ILE CG1 CD1 sing N N 232 ILE CG1 HG12 sing N N 233 ILE CG1 HG13 sing N N 234 ILE CG2 HG21 sing N N 235 ILE CG2 HG22 sing N N 236 ILE CG2 HG23 sing N N 237 ILE CD1 HD11 sing N N 238 ILE CD1 HD12 sing N N 239 ILE CD1 HD13 sing N N 240 ILE OXT HXT sing N N 241 LEU N CA sing N N 242 LEU N H sing N N 243 LEU N H2 sing N N 244 LEU CA C sing N N 245 LEU CA CB sing N N 246 LEU CA HA sing N N 247 LEU C O doub N N 248 LEU C OXT sing N N 249 LEU CB CG sing N N 250 LEU CB HB2 sing N N 251 LEU CB HB3 sing N N 252 LEU CG CD1 sing N N 253 LEU CG CD2 sing N N 254 LEU CG HG sing N N 255 LEU CD1 HD11 sing N N 256 LEU CD1 HD12 sing N N 257 LEU CD1 HD13 sing N N 258 LEU CD2 HD21 sing N N 259 LEU CD2 HD22 sing N N 260 LEU CD2 HD23 sing N N 261 LEU OXT HXT sing N N 262 LYS N CA sing N N 263 LYS N H sing N N 264 LYS N H2 sing N N 265 LYS CA C sing N N 266 LYS CA CB sing N N 267 LYS CA HA sing N N 268 LYS C O doub N N 269 LYS C OXT sing N N 270 LYS CB CG sing N N 271 LYS CB HB2 sing N N 272 LYS CB HB3 sing N N 273 LYS CG CD sing N N 274 LYS CG HG2 sing N N 275 LYS CG HG3 sing N N 276 LYS CD CE sing N N 277 LYS CD HD2 sing N N 278 LYS CD HD3 sing N N 279 LYS CE NZ sing N N 280 LYS CE HE2 sing N N 281 LYS CE HE3 sing N N 282 LYS NZ HZ1 sing N N 283 LYS NZ HZ2 sing N N 284 LYS NZ HZ3 sing N N 285 LYS OXT HXT sing N N 286 MET N CA sing N N 287 MET N H sing N N 288 MET N H2 sing N N 289 MET CA C sing N N 290 MET CA CB sing N N 291 MET CA HA sing N N 292 MET C O doub N N 293 MET C OXT sing N N 294 MET CB CG sing N N 295 MET CB HB2 sing N N 296 MET CB HB3 sing N N 297 MET CG SD sing N N 298 MET CG HG2 sing N N 299 MET CG HG3 sing N N 300 MET SD CE sing N N 301 MET CE HE1 sing N N 302 MET CE HE2 sing N N 303 MET CE HE3 sing N N 304 MET OXT HXT sing N N 305 PHE N CA sing N N 306 PHE N H sing N N 307 PHE N H2 sing N N 308 PHE CA C sing N N 309 PHE CA CB sing N N 310 PHE CA HA sing N N 311 PHE C O doub N N 312 PHE C OXT sing N N 313 PHE CB CG sing N N 314 PHE CB HB2 sing N N 315 PHE CB HB3 sing N N 316 PHE CG CD1 doub Y N 317 PHE CG CD2 sing Y N 318 PHE CD1 CE1 sing Y N 319 PHE CD1 HD1 sing N N 320 PHE CD2 CE2 doub Y N 321 PHE CD2 HD2 sing N N 322 PHE CE1 CZ doub Y N 323 PHE CE1 HE1 sing N N 324 PHE CE2 CZ sing Y N 325 PHE CE2 HE2 sing N N 326 PHE CZ HZ sing N N 327 PHE OXT HXT sing N N 328 PRO N CA sing N N 329 PRO N CD sing N N 330 PRO N H sing N N 331 PRO CA C sing N N 332 PRO CA CB sing N N 333 PRO CA HA sing N N 334 PRO C O doub N N 335 PRO C OXT sing N N 336 PRO CB CG sing N N 337 PRO CB HB2 sing N N 338 PRO CB HB3 sing N N 339 PRO CG CD sing N N 340 PRO CG HG2 sing N N 341 PRO CG HG3 sing N N 342 PRO CD HD2 sing N N 343 PRO CD HD3 sing N N 344 PRO OXT HXT sing N N 345 SER N CA sing N N 346 SER N H sing N N 347 SER N H2 sing N N 348 SER CA C sing N N 349 SER CA CB sing N N 350 SER CA HA sing N N 351 SER C O doub N N 352 SER C OXT sing N N 353 SER CB OG sing N N 354 SER CB HB2 sing N N 355 SER CB HB3 sing N N 356 SER OG HG sing N N 357 SER OXT HXT sing N N 358 THR N CA sing N N 359 THR N H sing N N 360 THR N H2 sing N N 361 THR CA C sing N N 362 THR CA CB sing N N 363 THR CA HA sing N N 364 THR C O doub N N 365 THR C OXT sing N N 366 THR CB OG1 sing N N 367 THR CB CG2 sing N N 368 THR CB HB sing N N 369 THR OG1 HG1 sing N N 370 THR CG2 HG21 sing N N 371 THR CG2 HG22 sing N N 372 THR CG2 HG23 sing N N 373 THR OXT HXT sing N N 374 TRP N CA sing N N 375 TRP N H sing N N 376 TRP N H2 sing N N 377 TRP CA C sing N N 378 TRP CA CB sing N N 379 TRP CA HA sing N N 380 TRP C O doub N N 381 TRP C OXT sing N N 382 TRP CB CG sing N N 383 TRP CB HB2 sing N N 384 TRP CB HB3 sing N N 385 TRP CG CD1 doub Y N 386 TRP CG CD2 sing Y N 387 TRP CD1 NE1 sing Y N 388 TRP CD1 HD1 sing N N 389 TRP CD2 CE2 doub Y N 390 TRP CD2 CE3 sing Y N 391 TRP NE1 CE2 sing Y N 392 TRP NE1 HE1 sing N N 393 TRP CE2 CZ2 sing Y N 394 TRP CE3 CZ3 doub Y N 395 TRP CE3 HE3 sing N N 396 TRP CZ2 CH2 doub Y N 397 TRP CZ2 HZ2 sing N N 398 TRP CZ3 CH2 sing Y N 399 TRP CZ3 HZ3 sing N N 400 TRP CH2 HH2 sing N N 401 TRP OXT HXT sing N N 402 TYR N CA sing N N 403 TYR N H sing N N 404 TYR N H2 sing N N 405 TYR CA C sing N N 406 TYR CA CB sing N N 407 TYR CA HA sing N N 408 TYR C O doub N N 409 TYR C OXT sing N N 410 TYR CB CG sing N N 411 TYR CB HB2 sing N N 412 TYR CB HB3 sing N N 413 TYR CG CD1 doub Y N 414 TYR CG CD2 sing Y N 415 TYR CD1 CE1 sing Y N 416 TYR CD1 HD1 sing N N 417 TYR CD2 CE2 doub Y N 418 TYR CD2 HD2 sing N N 419 TYR CE1 CZ doub Y N 420 TYR CE1 HE1 sing N N 421 TYR CE2 CZ sing Y N 422 TYR CE2 HE2 sing N N 423 TYR CZ OH sing N N 424 TYR OH HH sing N N 425 TYR OXT HXT sing N N 426 VAL N CA sing N N 427 VAL N H sing N N 428 VAL N H2 sing N N 429 VAL CA C sing N N 430 VAL CA CB sing N N 431 VAL CA HA sing N N 432 VAL C O doub N N 433 VAL C OXT sing N N 434 VAL CB CG1 sing N N 435 VAL CB CG2 sing N N 436 VAL CB HB sing N N 437 VAL CG1 HG11 sing N N 438 VAL CG1 HG12 sing N N 439 VAL CG1 HG13 sing N N 440 VAL CG2 HG21 sing N N 441 VAL CG2 HG22 sing N N 442 VAL CG2 HG23 sing N N 443 VAL OXT HXT sing N N 444 # _pdbx_audit_support.funding_organization 'Polish National Science Centre' _pdbx_audit_support.country Poland _pdbx_audit_support.grant_number 2021/43/B/NZ7/03170 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5J89 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9HRT _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.019662 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019220 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008983 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C F N O S # loop_ #