data_9HST # _entry.id 9HST # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.401 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9HST pdb_00009hst 10.2210/pdb9hst/pdb WWPDB D_1292144121 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-02-05 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9HST _pdbx_database_status.recvd_initial_deposition_date 2024-12-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name PDB _pdbx_database_related.details . _pdbx_database_related.db_id 9HSB _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 1 _pdbx_contact_author.email guichou@cbs.cnrs.fr _pdbx_contact_author.name_first Jean-Francois _pdbx_contact_author.name_last Guichou _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7699-3235 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Audebert, S.' 1 0000-0003-4914-4438 'Gelin, M.' 2 0000-0003-1320-8663 'Guichou, J.-F.' 3 0000-0002-7699-3235 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Crystal structure of C-terminal catalytic domain of Plasmodium falciparum CTP:phosphocholine cytidylyltransferase with piperazin-2-one ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Audebert, S.' 1 0000-0003-4914-4438 primary 'Gelin, M.' 2 0000-0003-1320-8663 primary 'Guichou, J.-F.' 3 0000-0002-7699-3235 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'choline-phosphate cytidylyltransferase' 20646.949 1 2.7.7.15 ? ? 'Deletion of a lysine rich loop (720 - 737)' 2 non-polymer syn piperazin-2-one 100.119 1 ? ? ? ? 3 water nat water 18.015 16 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GHMAVPDDDDDDDNSNDESEYESSQMDSEKNKGSIKNSKNVVIYADGVYDMLHLGHMKQLEQAKKLFENTTLIVGVTSDN ETKLFKGQVVQTLEERTETLKHIRWVDEIISPCPWVVTPEFLEKYKIDYVAHDDIPYANNQKEDIYAWLKRAGKFKATQR TEGVSTTDLIVRILKNYED ; _entity_poly.pdbx_seq_one_letter_code_can ;GHMAVPDDDDDDDNSNDESEYESSQMDSEKNKGSIKNSKNVVIYADGVYDMLHLGHMKQLEQAKKLFENTTLIVGVTSDN ETKLFKGQVVQTLEERTETLKHIRWVDEIISPCPWVVTPEFLEKYKIDYVAHDDIPYANNQKEDIYAWLKRAGKFKATQR TEGVSTTDLIVRILKNYED ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 piperazin-2-one XJJ 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 ALA n 1 5 VAL n 1 6 PRO n 1 7 ASP n 1 8 ASP n 1 9 ASP n 1 10 ASP n 1 11 ASP n 1 12 ASP n 1 13 ASP n 1 14 ASN n 1 15 SER n 1 16 ASN n 1 17 ASP n 1 18 GLU n 1 19 SER n 1 20 GLU n 1 21 TYR n 1 22 GLU n 1 23 SER n 1 24 SER n 1 25 GLN n 1 26 MET n 1 27 ASP n 1 28 SER n 1 29 GLU n 1 30 LYS n 1 31 ASN n 1 32 LYS n 1 33 GLY n 1 34 SER n 1 35 ILE n 1 36 LYS n 1 37 ASN n 1 38 SER n 1 39 LYS n 1 40 ASN n 1 41 VAL n 1 42 VAL n 1 43 ILE n 1 44 TYR n 1 45 ALA n 1 46 ASP n 1 47 GLY n 1 48 VAL n 1 49 TYR n 1 50 ASP n 1 51 MET n 1 52 LEU n 1 53 HIS n 1 54 LEU n 1 55 GLY n 1 56 HIS n 1 57 MET n 1 58 LYS n 1 59 GLN n 1 60 LEU n 1 61 GLU n 1 62 GLN n 1 63 ALA n 1 64 LYS n 1 65 LYS n 1 66 LEU n 1 67 PHE n 1 68 GLU n 1 69 ASN n 1 70 THR n 1 71 THR n 1 72 LEU n 1 73 ILE n 1 74 VAL n 1 75 GLY n 1 76 VAL n 1 77 THR n 1 78 SER n 1 79 ASP n 1 80 ASN n 1 81 GLU n 1 82 THR n 1 83 LYS n 1 84 LEU n 1 85 PHE n 1 86 LYS n 1 87 GLY n 1 88 GLN n 1 89 VAL n 1 90 VAL n 1 91 GLN n 1 92 THR n 1 93 LEU n 1 94 GLU n 1 95 GLU n 1 96 ARG n 1 97 THR n 1 98 GLU n 1 99 THR n 1 100 LEU n 1 101 LYS n 1 102 HIS n 1 103 ILE n 1 104 ARG n 1 105 TRP n 1 106 VAL n 1 107 ASP n 1 108 GLU n 1 109 ILE n 1 110 ILE n 1 111 SER n 1 112 PRO n 1 113 CYS n 1 114 PRO n 1 115 TRP n 1 116 VAL n 1 117 VAL n 1 118 THR n 1 119 PRO n 1 120 GLU n 1 121 PHE n 1 122 LEU n 1 123 GLU n 1 124 LYS n 1 125 TYR n 1 126 LYS n 1 127 ILE n 1 128 ASP n 1 129 TYR n 1 130 VAL n 1 131 ALA n 1 132 HIS n 1 133 ASP n 1 134 ASP n 1 135 ILE n 1 136 PRO n 1 137 TYR n 1 138 ALA n 1 139 ASN n 1 140 ASN n 1 141 GLN n 1 142 LYS n 1 143 GLU n 1 144 ASP n 1 145 ILE n 1 146 TYR n 1 147 ALA n 1 148 TRP n 1 149 LEU n 1 150 LYS n 1 151 ARG n 1 152 ALA n 1 153 GLY n 1 154 LYS n 1 155 PHE n 1 156 LYS n 1 157 ALA n 1 158 THR n 1 159 GLN n 1 160 ARG n 1 161 THR n 1 162 GLU n 1 163 GLY n 1 164 VAL n 1 165 SER n 1 166 THR n 1 167 THR n 1 168 ASP n 1 169 LEU n 1 170 ILE n 1 171 VAL n 1 172 ARG n 1 173 ILE n 1 174 LEU n 1 175 LYS n 1 176 ASN n 1 177 TYR n 1 178 GLU n 1 179 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 179 _entity_src_gen.gene_src_common_name 'malaria parasite P. falciparum' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PF3D7_1316600 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Plasmodium falciparum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5833 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 XJJ non-polymer . piperazin-2-one ? 'C4 H8 N2 O' 100.119 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 578 ? ? ? A . n A 1 2 HIS 2 579 ? ? ? A . n A 1 3 MET 3 580 ? ? ? A . n A 1 4 ALA 4 581 ? ? ? A . n A 1 5 VAL 5 582 ? ? ? A . n A 1 6 PRO 6 583 ? ? ? A . n A 1 7 ASP 7 584 ? ? ? A . n A 1 8 ASP 8 585 ? ? ? A . n A 1 9 ASP 9 586 ? ? ? A . n A 1 10 ASP 10 587 ? ? ? A . n A 1 11 ASP 11 588 ? ? ? A . n A 1 12 ASP 12 589 ? ? ? A . n A 1 13 ASP 13 590 ? ? ? A . n A 1 14 ASN 14 591 ? ? ? A . n A 1 15 SER 15 592 ? ? ? A . n A 1 16 ASN 16 593 ? ? ? A . n A 1 17 ASP 17 594 ? ? ? A . n A 1 18 GLU 18 595 ? ? ? A . n A 1 19 SER 19 596 ? ? ? A . n A 1 20 GLU 20 597 ? ? ? A . n A 1 21 TYR 21 598 ? ? ? A . n A 1 22 GLU 22 599 ? ? ? A . n A 1 23 SER 23 600 ? ? ? A . n A 1 24 SER 24 601 ? ? ? A . n A 1 25 GLN 25 602 ? ? ? A . n A 1 26 MET 26 603 ? ? ? A . n A 1 27 ASP 27 604 ? ? ? A . n A 1 28 SER 28 605 ? ? ? A . n A 1 29 GLU 29 606 ? ? ? A . n A 1 30 LYS 30 607 ? ? ? A . n A 1 31 ASN 31 608 ? ? ? A . n A 1 32 LYS 32 609 ? ? ? A . n A 1 33 GLY 33 610 ? ? ? A . n A 1 34 SER 34 611 ? ? ? A . n A 1 35 ILE 35 612 ? ? ? A . n A 1 36 LYS 36 613 ? ? ? A . n A 1 37 ASN 37 614 ? ? ? A . n A 1 38 SER 38 615 ? ? ? A . n A 1 39 LYS 39 616 616 LYS LYS A . n A 1 40 ASN 40 617 617 ASN ASN A . n A 1 41 VAL 41 618 618 VAL VAL A . n A 1 42 VAL 42 619 619 VAL VAL A . n A 1 43 ILE 43 620 620 ILE ILE A . n A 1 44 TYR 44 621 621 TYR TYR A . n A 1 45 ALA 45 622 622 ALA ALA A . n A 1 46 ASP 46 623 623 ASP ASP A . n A 1 47 GLY 47 624 624 GLY GLY A . n A 1 48 VAL 48 625 625 VAL VAL A . n A 1 49 TYR 49 626 626 TYR TYR A . n A 1 50 ASP 50 627 627 ASP ASP A . n A 1 51 MET 51 628 628 MET MET A . n A 1 52 LEU 52 629 629 LEU LEU A . n A 1 53 HIS 53 630 630 HIS HIS A . n A 1 54 LEU 54 631 631 LEU LEU A . n A 1 55 GLY 55 632 632 GLY GLY A . n A 1 56 HIS 56 633 633 HIS HIS A . n A 1 57 MET 57 634 634 MET MET A . n A 1 58 LYS 58 635 635 LYS LYS A . n A 1 59 GLN 59 636 636 GLN GLN A . n A 1 60 LEU 60 637 637 LEU LEU A . n A 1 61 GLU 61 638 638 GLU GLU A . n A 1 62 GLN 62 639 639 GLN GLN A . n A 1 63 ALA 63 640 640 ALA ALA A . n A 1 64 LYS 64 641 641 LYS LYS A . n A 1 65 LYS 65 642 642 LYS LYS A . n A 1 66 LEU 66 643 643 LEU LEU A . n A 1 67 PHE 67 644 644 PHE PHE A . n A 1 68 GLU 68 645 645 GLU GLU A . n A 1 69 ASN 69 646 646 ASN ASN A . n A 1 70 THR 70 647 647 THR THR A . n A 1 71 THR 71 648 648 THR THR A . n A 1 72 LEU 72 649 649 LEU LEU A . n A 1 73 ILE 73 650 650 ILE ILE A . n A 1 74 VAL 74 651 651 VAL VAL A . n A 1 75 GLY 75 652 652 GLY GLY A . n A 1 76 VAL 76 653 653 VAL VAL A . n A 1 77 THR 77 654 654 THR THR A . n A 1 78 SER 78 655 655 SER SER A . n A 1 79 ASP 79 656 656 ASP ASP A . n A 1 80 ASN 80 657 657 ASN ASN A . n A 1 81 GLU 81 658 658 GLU GLU A . n A 1 82 THR 82 659 659 THR THR A . n A 1 83 LYS 83 660 660 LYS LYS A . n A 1 84 LEU 84 661 661 LEU LEU A . n A 1 85 PHE 85 662 662 PHE PHE A . n A 1 86 LYS 86 663 663 LYS LYS A . n A 1 87 GLY 87 664 664 GLY GLY A . n A 1 88 GLN 88 665 665 GLN GLN A . n A 1 89 VAL 89 666 666 VAL VAL A . n A 1 90 VAL 90 667 667 VAL VAL A . n A 1 91 GLN 91 668 668 GLN GLN A . n A 1 92 THR 92 669 669 THR THR A . n A 1 93 LEU 93 670 670 LEU LEU A . n A 1 94 GLU 94 671 671 GLU GLU A . n A 1 95 GLU 95 672 672 GLU GLU A . n A 1 96 ARG 96 673 673 ARG ARG A . n A 1 97 THR 97 674 674 THR THR A . n A 1 98 GLU 98 675 675 GLU GLU A . n A 1 99 THR 99 676 676 THR THR A . n A 1 100 LEU 100 677 677 LEU LEU A . n A 1 101 LYS 101 678 678 LYS LYS A . n A 1 102 HIS 102 679 679 HIS HIS A . n A 1 103 ILE 103 680 680 ILE ILE A . n A 1 104 ARG 104 681 681 ARG ARG A . n A 1 105 TRP 105 682 682 TRP TRP A . n A 1 106 VAL 106 683 683 VAL VAL A . n A 1 107 ASP 107 684 684 ASP ASP A . n A 1 108 GLU 108 685 685 GLU GLU A . n A 1 109 ILE 109 686 686 ILE ILE A . n A 1 110 ILE 110 687 687 ILE ILE A . n A 1 111 SER 111 688 688 SER SER A . n A 1 112 PRO 112 689 689 PRO PRO A . n A 1 113 CYS 113 690 690 CYS CYS A . n A 1 114 PRO 114 691 691 PRO PRO A . n A 1 115 TRP 115 692 692 TRP TRP A . n A 1 116 VAL 116 693 693 VAL VAL A . n A 1 117 VAL 117 694 694 VAL VAL A . n A 1 118 THR 118 695 695 THR THR A . n A 1 119 PRO 119 696 696 PRO PRO A . n A 1 120 GLU 120 697 697 GLU GLU A . n A 1 121 PHE 121 698 698 PHE PHE A . n A 1 122 LEU 122 699 699 LEU LEU A . n A 1 123 GLU 123 700 700 GLU GLU A . n A 1 124 LYS 124 701 701 LYS LYS A . n A 1 125 TYR 125 702 702 TYR TYR A . n A 1 126 LYS 126 703 703 LYS LYS A . n A 1 127 ILE 127 704 704 ILE ILE A . n A 1 128 ASP 128 705 705 ASP ASP A . n A 1 129 TYR 129 706 706 TYR TYR A . n A 1 130 VAL 130 707 707 VAL VAL A . n A 1 131 ALA 131 708 708 ALA ALA A . n A 1 132 HIS 132 709 709 HIS HIS A . n A 1 133 ASP 133 710 710 ASP ASP A . n A 1 134 ASP 134 711 711 ASP ASP A . n A 1 135 ILE 135 730 ? ? ? A . n A 1 136 PRO 136 731 ? ? ? A . n A 1 137 TYR 137 732 ? ? ? A . n A 1 138 ALA 138 733 ? ? ? A . n A 1 139 ASN 139 734 ? ? ? A . n A 1 140 ASN 140 735 ? ? ? A . n A 1 141 GLN 141 736 ? ? ? A . n A 1 142 LYS 142 737 ? ? ? A . n A 1 143 GLU 143 738 ? ? ? A . n A 1 144 ASP 144 739 739 ASP ASP A . n A 1 145 ILE 145 740 740 ILE ILE A . n A 1 146 TYR 146 741 741 TYR TYR A . n A 1 147 ALA 147 742 742 ALA ALA A . n A 1 148 TRP 148 743 743 TRP TRP A . n A 1 149 LEU 149 744 744 LEU LEU A . n A 1 150 LYS 150 745 745 LYS LYS A . n A 1 151 ARG 151 746 746 ARG ARG A . n A 1 152 ALA 152 747 747 ALA ALA A . n A 1 153 GLY 153 748 748 GLY GLY A . n A 1 154 LYS 154 749 749 LYS LYS A . n A 1 155 PHE 155 750 750 PHE PHE A . n A 1 156 LYS 156 751 751 LYS LYS A . n A 1 157 ALA 157 752 752 ALA ALA A . n A 1 158 THR 158 753 753 THR THR A . n A 1 159 GLN 159 754 754 GLN GLN A . n A 1 160 ARG 160 755 755 ARG ARG A . n A 1 161 THR 161 756 756 THR THR A . n A 1 162 GLU 162 757 757 GLU GLU A . n A 1 163 GLY 163 758 758 GLY GLY A . n A 1 164 VAL 164 759 759 VAL VAL A . n A 1 165 SER 165 760 760 SER SER A . n A 1 166 THR 166 761 761 THR THR A . n A 1 167 THR 167 762 762 THR THR A . n A 1 168 ASP 168 763 763 ASP ASP A . n A 1 169 LEU 169 764 764 LEU LEU A . n A 1 170 ILE 170 765 765 ILE ILE A . n A 1 171 VAL 171 766 766 VAL VAL A . n A 1 172 ARG 172 767 767 ARG ARG A . n A 1 173 ILE 173 768 768 ILE ILE A . n A 1 174 LEU 174 769 769 LEU LEU A . n A 1 175 LYS 175 770 770 LYS LYS A . n A 1 176 ASN 176 771 771 ASN ASN A . n A 1 177 TYR 177 772 772 TYR TYR A . n A 1 178 GLU 178 773 773 GLU GLU A . n A 1 179 ASP 179 774 774 ASP ASP A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id XJJ _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id XJJ _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 XJJ 1 801 801 XJJ LIG A . C 3 HOH 1 901 16 HOH HOH A . C 3 HOH 2 902 5 HOH HOH A . C 3 HOH 3 903 4 HOH HOH A . C 3 HOH 4 904 14 HOH HOH A . C 3 HOH 5 905 7 HOH HOH A . C 3 HOH 6 906 10 HOH HOH A . C 3 HOH 7 907 13 HOH HOH A . C 3 HOH 8 908 17 HOH HOH A . C 3 HOH 9 909 3 HOH HOH A . C 3 HOH 10 910 15 HOH HOH A . C 3 HOH 11 911 6 HOH HOH A . C 3 HOH 12 912 12 HOH HOH A . C 3 HOH 13 913 8 HOH HOH A . C 3 HOH 14 914 2 HOH HOH A . C 3 HOH 15 915 9 HOH HOH A . C 3 HOH 16 916 1 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 645 ? CG ? A GLU 68 CG 2 1 Y 1 A GLU 645 ? CD ? A GLU 68 CD 3 1 Y 1 A GLU 645 ? OE1 ? A GLU 68 OE1 4 1 Y 1 A GLU 645 ? OE2 ? A GLU 68 OE2 5 1 Y 1 A LYS 660 ? CG ? A LYS 83 CG 6 1 Y 1 A LYS 660 ? CD ? A LYS 83 CD 7 1 Y 1 A LYS 660 ? CE ? A LYS 83 CE 8 1 Y 1 A LYS 660 ? NZ ? A LYS 83 NZ 9 1 Y 1 A ASP 711 ? CG ? A ASP 134 CG 10 1 Y 1 A ASP 711 ? OD1 ? A ASP 134 OD1 11 1 Y 1 A ASP 711 ? OD2 ? A ASP 134 OD2 12 1 Y 1 A ARG 755 ? CG ? A ARG 160 CG 13 1 Y 1 A ARG 755 ? CD ? A ARG 160 CD 14 1 Y 1 A ARG 755 ? NE ? A ARG 160 NE 15 1 Y 1 A ARG 755 ? CZ ? A ARG 160 CZ 16 1 Y 1 A ARG 755 ? NH1 ? A ARG 160 NH1 17 1 Y 1 A ARG 755 ? NH2 ? A ARG 160 NH2 18 1 Y 1 A GLU 757 ? CG ? A GLU 162 CG 19 1 Y 1 A GLU 757 ? CD ? A GLU 162 CD 20 1 Y 1 A GLU 757 ? OE1 ? A GLU 162 OE1 21 1 Y 1 A GLU 757 ? OE2 ? A GLU 162 OE2 22 1 Y 1 A VAL 759 ? CG1 ? A VAL 164 CG1 23 1 Y 1 A VAL 759 ? CG2 ? A VAL 164 CG2 24 1 Y 1 A LEU 764 ? CG ? A LEU 169 CG 25 1 Y 1 A LEU 764 ? CD1 ? A LEU 169 CD1 26 1 Y 1 A LEU 764 ? CD2 ? A LEU 169 CD2 27 1 Y 1 A ILE 765 ? CG1 ? A ILE 170 CG1 28 1 Y 1 A ILE 765 ? CG2 ? A ILE 170 CG2 29 1 Y 1 A ILE 765 ? CD1 ? A ILE 170 CD1 30 1 Y 1 A ILE 768 ? CG1 ? A ILE 173 CG1 31 1 Y 1 A ILE 768 ? CG2 ? A ILE 173 CG2 32 1 Y 1 A ILE 768 ? CD1 ? A ILE 173 CD1 33 1 Y 1 A LYS 770 ? CG ? A LYS 175 CG 34 1 Y 1 A LYS 770 ? CD ? A LYS 175 CD 35 1 Y 1 A LYS 770 ? CE ? A LYS 175 CE 36 1 Y 1 A LYS 770 ? NZ ? A LYS 175 NZ 37 1 Y 1 A GLU 773 ? CG ? A GLU 178 CG 38 1 Y 1 A GLU 773 ? CD ? A GLU 178 CD 39 1 Y 1 A GLU 773 ? OE1 ? A GLU 178 OE1 40 1 Y 1 A GLU 773 ? OE2 ? A GLU 178 OE2 41 1 Y 1 A ASP 774 ? CG ? A ASP 179 CG 42 1 Y 1 A ASP 774 ? OD1 ? A ASP 179 OD1 43 1 Y 1 A ASP 774 ? OD2 ? A ASP 179 OD2 # _software.citation_id ? _software.classification refinement _software.compiler_name ? _software.compiler_version ? _software.contact_author ? _software.contact_author_email ? _software.date ? _software.description ? _software.dependencies ? _software.hardware ? _software.language ? _software.location ? _software.mods ? _software.name PHENIX _software.os ? _software.os_version ? _software.type ? _software.version 1.19.2_4158 _software.pdbx_ordinal 1 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9HST _cell.details ? _cell.formula_units_Z ? _cell.length_a 50.480 _cell.length_a_esd ? _cell.length_b 69.940 _cell.length_b_esd ? _cell.length_c 118.565 _cell.length_c_esd ? _cell.volume 418602.174 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9HST _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall 'I 2 2' _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9HST _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.53 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.47 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 3350 11.5%, NaF 210 mM, Glycerol 5.8%, MnCl2 15mM, 1,3 propandiol 3%' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 4M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-04-07 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.96577 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE MASSIF-3' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.96577 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MASSIF-3 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 60.35 _reflns.entry_id 9HST _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.39 _reflns.d_resolution_low 60.24 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 16062 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.0 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.99 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.119 _reflns.pdbx_Rpim_I_all 0.039 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.112 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.39 _reflns_shell.d_res_low 2.48 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all 8354 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 880 _reflns_shell.percent_possible_obs 99.6 _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 9.5 _reflns_shell.pdbx_chi_squared 0.84 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 1.0 _reflns_shell.pdbx_Rrim_I_all 2.304 _reflns_shell.pdbx_Rpim_I_all 0.745 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.516 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 2.178 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 66.29 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9HST _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.39 _refine.ls_d_res_low 60.24 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16062 _refine.ls_number_reflns_R_free 801 _refine.ls_number_reflns_R_work 15261 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.80 _refine.ls_percent_reflns_R_free 4.99 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2246 _refine.ls_R_factor_R_free 0.2512 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2229 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 37.7163 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.5009 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.39 _refine_hist.d_res_low 60.24 _refine_hist.number_atoms_solvent 16 _refine_hist.number_atoms_total 1064 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1041 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 7 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0085 ? 1069 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.8260 ? 1450 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0518 ? 168 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0084 ? 180 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 16.0949 ? 382 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.39 2.54 . . 109 2559 99.59 . . . . 0.3917 . . . . . . . . . . . 0.3650 'X-RAY DIFFRACTION' 2.54 2.74 . . 118 2565 100.00 . . . . 0.3268 . . . . . . . . . . . 0.4152 'X-RAY DIFFRACTION' 2.74 3.01 . . 154 2526 99.89 . . . . 0.3214 . . . . . . . . . . . 0.3704 'X-RAY DIFFRACTION' 3.01 3.44 . . 115 2551 99.85 . . . . 0.2517 . . . . . . . . . . . 0.2858 'X-RAY DIFFRACTION' 3.45 4.34 . . 153 2525 99.70 . . . . 0.1952 . . . . . . . . . . . 0.2184 'X-RAY DIFFRACTION' 4.35 60.24 . . 152 2535 99.85 . . . . 0.1738 . . . . . . . . . . . 0.2116 # _struct.entry_id 9HST _struct.title ;Crystal structure of C-terminal catalytic domain of Plasmodium falciparum CTP:phosphocholine cytidylyltransferase with piperazin-2-one ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9HST _struct_keywords.text 'Transferase, CCT' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8IEE9_PLAF7 _struct_ref.pdbx_db_accession Q8IEE9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AVPDDDDDDDNSNDESEYESSQMDSEKNKGSIKNSKNVVIYADGVYDMLHLGHMKQLEQAKKLFENTTLIVGVTSDNETK LFKGQVVQTLEERTETLKHIRWVDEIISPCPWVVTPEFLEKYKIDYVAHDDIPYANNQKKKKKKKSKGKSFSFDEENEDI YAWLKRAGKFKATQRTEGVSTTDLIVRILKNYED ; _struct_ref.pdbx_align_begin 581 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9HST _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 179 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8IEE9 _struct_ref_seq.db_align_beg 581 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 774 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 581 _struct_ref_seq.pdbx_auth_seq_align_end 774 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9HST GLY A 1 ? UNP Q8IEE9 ? ? 'expression tag' 578 1 1 9HST HIS A 2 ? UNP Q8IEE9 ? ? 'expression tag' 579 2 1 9HST MET A 3 ? UNP Q8IEE9 ? ? 'expression tag' 580 3 1 9HST ? A ? ? UNP Q8IEE9 LYS 720 deletion ? 4 1 9HST ? A ? ? UNP Q8IEE9 LYS 721 deletion ? 5 1 9HST ? A ? ? UNP Q8IEE9 LYS 722 deletion ? 6 1 9HST ? A ? ? UNP Q8IEE9 LYS 723 deletion ? 7 1 9HST ? A ? ? UNP Q8IEE9 LYS 724 deletion ? 8 1 9HST ? A ? ? UNP Q8IEE9 LYS 725 deletion ? 9 1 9HST ? A ? ? UNP Q8IEE9 SER 726 deletion ? 10 1 9HST ? A ? ? UNP Q8IEE9 LYS 727 deletion ? 11 1 9HST ? A ? ? UNP Q8IEE9 GLY 728 deletion ? 12 1 9HST ? A ? ? UNP Q8IEE9 LYS 729 deletion ? 13 1 9HST ? A ? ? UNP Q8IEE9 SER 730 deletion ? 14 1 9HST ? A ? ? UNP Q8IEE9 PHE 731 deletion ? 15 1 9HST ? A ? ? UNP Q8IEE9 SER 732 deletion ? 16 1 9HST ? A ? ? UNP Q8IEE9 PHE 733 deletion ? 17 1 9HST ? A ? ? UNP Q8IEE9 ASP 734 deletion ? 18 1 9HST ? A ? ? UNP Q8IEE9 GLU 735 deletion ? 19 1 9HST ? A ? ? UNP Q8IEE9 GLU 736 deletion ? 20 1 9HST ? A ? ? UNP Q8IEE9 ASN 737 deletion ? 21 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1930 ? 1 MORE -5 ? 1 'SSA (A^2)' 14110 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details Dimeric # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_545 -x,-y-1,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 -69.9400000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 53 ? LYS A 65 ? HIS A 630 LYS A 642 1 ? 13 HELX_P HELX_P2 AA2 SER A 78 ? LYS A 86 ? SER A 655 LYS A 663 1 ? 9 HELX_P HELX_P3 AA3 THR A 92 ? LYS A 101 ? THR A 669 LYS A 678 1 ? 10 HELX_P HELX_P4 AA4 THR A 118 ? LYS A 126 ? THR A 695 LYS A 703 1 ? 9 HELX_P HELX_P5 AA5 TYR A 146 ? ALA A 152 ? TYR A 741 ALA A 747 1 ? 7 HELX_P HELX_P6 AA6 SER A 165 ? ASN A 176 ? SER A 760 ASN A 771 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 111 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 688 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 112 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 689 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 6.64 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 108 ? CYS A 113 ? GLU A 685 CYS A 690 AA1 2 THR A 70 ? THR A 77 ? THR A 647 THR A 654 AA1 3 VAL A 41 ? GLY A 47 ? VAL A 618 GLY A 624 AA1 4 TYR A 129 ? ASP A 133 ? TYR A 706 ASP A 710 AA1 5 PHE A 155 ? THR A 158 ? PHE A 750 THR A 753 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 110 ? O ILE A 687 N VAL A 74 ? N VAL A 651 AA1 2 3 O ILE A 73 ? O ILE A 650 N ILE A 43 ? N ILE A 620 AA1 3 4 N TYR A 44 ? N TYR A 621 O ALA A 131 ? O ALA A 708 AA1 4 5 N VAL A 130 ? N VAL A 707 O LYS A 156 ? O LYS A 751 # _pdbx_entry_details.entry_id 9HST _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 663 ? ? -85.42 -83.42 2 1 THR A 762 ? ? -28.78 -57.38 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y,-z 4 -x,-y,z 5 x+1/2,y+1/2,z+1/2 6 x+1/2,-y+1/2,-z+1/2 7 -x+1/2,y+1/2,-z+1/2 8 -x+1/2,-y+1/2,z+1/2 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -4.92806985175 -23.5516824106 -24.6084532573 0.452636515543 ? -0.0102272350396 ? 0.0706762960265 ? 0.410131477754 ? -0.0665799158682 ? 0.438878326366 ? 7.88167961462 ? -1.96306829795 ? 5.11583703136 ? 6.69430865661 ? -5.3813075279 ? 8.54699851859 ? 0.219028973416 ? -0.399125894502 ? 0.023311235333 ? 0.0849834457513 ? -0.362232274561 ? -0.207892953168 ? 0.322912362804 ? 0.341822700927 ? 0.0028126493317 ? 2 'X-RAY DIFFRACTION' ? refined -1.80498158125 -24.7355383758 -22.0786411282 0.323979920489 ? -0.00645216980128 ? 0.0827508873569 ? 0.334947058365 ? -0.0299848901915 ? 0.334098870268 ? 6.46652584617 ? -0.477325002108 ? 1.33080258182 ? 4.73598466024 ? -1.45467518667 ? 3.24260713278 ? -3.2258921655e-05 ? -0.273296250998 ? 0.224102321074 ? 0.231374688064 ? -0.077706932855 ? 0.207402271652 ? 0.0433677870303 ? 0.157995069116 ? 0.0741240710215 ? 3 'X-RAY DIFFRACTION' ? refined -5.28162158337 -13.2137705317 -27.454240802 0.644249530354 ? 0.0362935411541 ? 0.000843596843073 ? 0.507551410177 ? -0.0100325807658 ? 0.574111228695 ? 5.68297766921 ? 0.557954860824 ? 6.45674306823 ? 5.92098333744 ? 3.0541535349 ? 8.51203228503 ? -0.231784945404 ? -0.238329087242 ? 0.276179336807 ? -0.0366986857287 ? -0.174055597316 ? -0.253892349928 ? -0.114982615488 ? -0.648897567825 ? 0.418150593318 ? 4 'X-RAY DIFFRACTION' ? refined -16.3718194302 -11.020158397 -23.4727439928 0.689367385933 ? -0.0970402169992 ? -0.0423634146458 ? 0.840723995148 ? -0.0491548754855 ? 0.938242643037 ? 2.02395780842 ? -1.56605329532 ? 0.494985986045 ? 8.68532017429 ? -0.523915592307 ? 2.00499454267 ? -0.388005426469 ? -1.5082957461 ? 0.847208236542 ? 0.972712975624 ? -0.749975558133 ? -0.752191796298 ? -0.535763941065 ? -0.39850214491 ? 1.0315929474 ? 5 'X-RAY DIFFRACTION' ? refined -14.6386109887 -23.9250057063 -22.2830119321 0.713723989085 ? -0.00655671344205 ? 0.158995735112 ? 0.748898457004 ? -0.0178305979021 ? 0.557710345995 ? 7.99773521489 ? -0.32485063805 ? 0.205861634543 ? 6.75236138475 ? 1.17032815654 ? 4.16565596498 ? 0.116014979051 ? -1.32020784639 ? -0.711610206001 ? 0.810033868587 ? -0.404635143666 ? 0.636820116535 ? 0.655720312401 ? -0.125245904484 ? 0.323074086318 ? 6 'X-RAY DIFFRACTION' ? refined -5.3749615716 -40.4639646802 -1.04077939848 1.06216586161 ? -0.304335199041 ? 0.0557954470864 ? 1.12365911585 ? -0.189999551477 ? 0.682469174895 ? 8.55861936619 ? 2.45533599848 ? -2.70138678634 ? 0.92882592352 ? 0.384495438694 ? 7.82292724982 ? 0.247469569596 ? -1.00546388335 ? 0.445680742588 ? -0.254941922028 ? -0.0977321973266 ? 1.64185935323 ? 2.52654652532 ? -1.14511438541 ? -0.106543753251 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 1 A 616 ? A 15 A 630 ? ? ;chain 'A' and (resid 616 through 630 ) ; 2 'X-RAY DIFFRACTION' 2 A 16 A 631 ? A 72 A 687 ? ? ;chain 'A' and (resid 631 through 687 ) ; 3 'X-RAY DIFFRACTION' 3 A 73 A 688 ? A 95 A 710 ? ? ;chain 'A' and (resid 688 through 710 ) ; 4 'X-RAY DIFFRACTION' 4 A 96 A 711 ? A 104 A 746 ? ? ;chain 'A' and (resid 711 through 746 ) ; 5 'X-RAY DIFFRACTION' 5 A 105 A 747 ? A 118 A 760 ? ? ;chain 'A' and (resid 747 through 760 ) ; 6 'X-RAY DIFFRACTION' 6 A 119 A 761 ? A 132 A 774 ? ? ;chain 'A' and (resid 761 through 774 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 578 ? A GLY 1 2 1 Y 1 A HIS 579 ? A HIS 2 3 1 Y 1 A MET 580 ? A MET 3 4 1 Y 1 A ALA 581 ? A ALA 4 5 1 Y 1 A VAL 582 ? A VAL 5 6 1 Y 1 A PRO 583 ? A PRO 6 7 1 Y 1 A ASP 584 ? A ASP 7 8 1 Y 1 A ASP 585 ? A ASP 8 9 1 Y 1 A ASP 586 ? A ASP 9 10 1 Y 1 A ASP 587 ? A ASP 10 11 1 Y 1 A ASP 588 ? A ASP 11 12 1 Y 1 A ASP 589 ? A ASP 12 13 1 Y 1 A ASP 590 ? A ASP 13 14 1 Y 1 A ASN 591 ? A ASN 14 15 1 Y 1 A SER 592 ? A SER 15 16 1 Y 1 A ASN 593 ? A ASN 16 17 1 Y 1 A ASP 594 ? A ASP 17 18 1 Y 1 A GLU 595 ? A GLU 18 19 1 Y 1 A SER 596 ? A SER 19 20 1 Y 1 A GLU 597 ? A GLU 20 21 1 Y 1 A TYR 598 ? A TYR 21 22 1 Y 1 A GLU 599 ? A GLU 22 23 1 Y 1 A SER 600 ? A SER 23 24 1 Y 1 A SER 601 ? A SER 24 25 1 Y 1 A GLN 602 ? A GLN 25 26 1 Y 1 A MET 603 ? A MET 26 27 1 Y 1 A ASP 604 ? A ASP 27 28 1 Y 1 A SER 605 ? A SER 28 29 1 Y 1 A GLU 606 ? A GLU 29 30 1 Y 1 A LYS 607 ? A LYS 30 31 1 Y 1 A ASN 608 ? A ASN 31 32 1 Y 1 A LYS 609 ? A LYS 32 33 1 Y 1 A GLY 610 ? A GLY 33 34 1 Y 1 A SER 611 ? A SER 34 35 1 Y 1 A ILE 612 ? A ILE 35 36 1 Y 1 A LYS 613 ? A LYS 36 37 1 Y 1 A ASN 614 ? A ASN 37 38 1 Y 1 A SER 615 ? A SER 38 39 1 Y 1 A ILE 730 ? A ILE 135 40 1 Y 1 A PRO 731 ? A PRO 136 41 1 Y 1 A TYR 732 ? A TYR 137 42 1 Y 1 A ALA 733 ? A ALA 138 43 1 Y 1 A ASN 734 ? A ASN 139 44 1 Y 1 A ASN 735 ? A ASN 140 45 1 Y 1 A GLN 736 ? A GLN 141 46 1 Y 1 A LYS 737 ? A LYS 142 47 1 Y 1 A GLU 738 ? A GLU 143 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 XJJ O01 O N N 391 XJJ C02 C N N 392 XJJ C03 C N N 393 XJJ N04 N N N 394 XJJ C05 C N N 395 XJJ C06 C N N 396 XJJ N07 N N N 397 XJJ H031 H N N 398 XJJ H032 H N N 399 XJJ H041 H N N 400 XJJ H051 H N N 401 XJJ H052 H N N 402 XJJ H061 H N N 403 XJJ H062 H N N 404 XJJ H071 H N N 405 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 XJJ C02 O01 doub N N 376 XJJ C03 C02 sing N N 377 XJJ N04 C03 sing N N 378 XJJ C05 N04 sing N N 379 XJJ C06 C05 sing N N 380 XJJ N07 C06 sing N N 381 XJJ C02 N07 sing N N 382 XJJ C03 H031 sing N N 383 XJJ C03 H032 sing N N 384 XJJ N04 H041 sing N N 385 XJJ C05 H051 sing N N 386 XJJ C05 H052 sing N N 387 XJJ C06 H061 sing N N 388 XJJ C06 H062 sing N N 389 XJJ N07 H071 sing N N 390 # _pdbx_audit_support.funding_organization 'Agence Nationale de la Recherche (ANR)' _pdbx_audit_support.country France _pdbx_audit_support.grant_number ANR-20-CE44-0012 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4ZCS _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'I 2 2 2' _space_group.name_Hall 'I 2 2' _space_group.IT_number 23 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 9HST _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.019810 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014298 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008434 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_