data_9I0T # _entry.id 9I0T # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.404 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9I0T pdb_00009i0t 10.2210/pdb9i0t/pdb WWPDB D_1292144645 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-05-21 ? 2 'Structure model' 1 1 2025-05-28 ? 3 'Structure model' 1 2 2025-06-25 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_id_ISSN' 2 2 'Structure model' '_citation.pdbx_database_id_DOI' 3 2 'Structure model' '_citation.pdbx_database_id_PubMed' 4 2 'Structure model' '_citation.title' 5 3 'Structure model' '_citation.journal_volume' 6 3 'Structure model' '_citation.page_first' 7 3 'Structure model' '_citation.page_last' 8 3 'Structure model' '_citation_author.identifier_ORCID' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9I0T _pdbx_database_status.recvd_initial_deposition_date 2025-01-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 3 _pdbx_contact_author.email katrin.rittinger@crick.ac.uk _pdbx_contact_author.name_first Katrin _pdbx_contact_author.name_last Rittinger _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7698-4435 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'McPhie, K.A.' 1 0000-0001-6525-7235 'Esposito, D.' 2 0000-0003-4042-8856 'Rittinger, K.' 3 0000-0002-7698-4435 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Chem Sci' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-6520 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 16 _citation.language ? _citation.page_first 10432 _citation.page_last 10443 _citation.title 'Discovery and optimisation of a covalent ligand for TRIM25 and its application to targeted protein ubiquitination.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1039/d5sc01540e _citation.pdbx_database_id_PubMed 40365055 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'McPhie, K.A.' 1 ? primary 'Esposito, D.' 2 ? primary 'Pettinger, J.' 3 ? primary 'Norman, D.' 4 ? primary 'Werner, T.' 5 ? primary 'Mathieson, T.' 6 ? primary 'Bush, J.T.' 7 ? primary 'Rittinger, K.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'E3 ubiquitin/ISG15 ligase TRIM25' 22695.189 1 6.3.2.-,2.3.2.27 ? 'PRYSPRY domain' ? 2 non-polymer syn '1-[4-(3-methyl-4-phenyl-phenyl)carbonyl-1,4-diazepan-1-yl]ethanone' 336.427 1 ? ? ? ? 3 water nat water 18.015 84 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Estrogen-responsive finger protein,RING finger protein 147,RING-type E3 ubiquitin transferase,RING-type E3 ubiquitin transferase TRIM25,Tripartite motif-containing protein 25,Ubiquitin/ISG15-conjugating enzyme TRIM25,Zinc finger protein 147 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GMASLKAKVLETFLAKSRPELLEYYIKVILDYNTAHNKVALSECYTVASVAEMPQNYRPHPQRFTYCSQVLGLHCYKKGI HYWEVELQKNNFCGVGICYGSMNRQGPESRLGRNSASWCVEWFNTKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVIFF AVADKVHLMYKFRVDFTEALYPAFWVFSAGATLSICSPK ; _entity_poly.pdbx_seq_one_letter_code_can ;GMASLKAKVLETFLAKSRPELLEYYIKVILDYNTAHNKVALSECYTVASVAEMPQNYRPHPQRFTYCSQVLGLHCYKKGI HYWEVELQKNNFCGVGICYGSMNRQGPESRLGRNSASWCVEWFNTKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVIFF AVADKVHLMYKFRVDFTEALYPAFWVFSAGATLSICSPK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '1-[4-(3-methyl-4-phenyl-phenyl)carbonyl-1,4-diazepan-1-yl]ethanone' A1IZK 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 MET n 1 3 ALA n 1 4 SER n 1 5 LEU n 1 6 LYS n 1 7 ALA n 1 8 LYS n 1 9 VAL n 1 10 LEU n 1 11 GLU n 1 12 THR n 1 13 PHE n 1 14 LEU n 1 15 ALA n 1 16 LYS n 1 17 SER n 1 18 ARG n 1 19 PRO n 1 20 GLU n 1 21 LEU n 1 22 LEU n 1 23 GLU n 1 24 TYR n 1 25 TYR n 1 26 ILE n 1 27 LYS n 1 28 VAL n 1 29 ILE n 1 30 LEU n 1 31 ASP n 1 32 TYR n 1 33 ASN n 1 34 THR n 1 35 ALA n 1 36 HIS n 1 37 ASN n 1 38 LYS n 1 39 VAL n 1 40 ALA n 1 41 LEU n 1 42 SER n 1 43 GLU n 1 44 CYS n 1 45 TYR n 1 46 THR n 1 47 VAL n 1 48 ALA n 1 49 SER n 1 50 VAL n 1 51 ALA n 1 52 GLU n 1 53 MET n 1 54 PRO n 1 55 GLN n 1 56 ASN n 1 57 TYR n 1 58 ARG n 1 59 PRO n 1 60 HIS n 1 61 PRO n 1 62 GLN n 1 63 ARG n 1 64 PHE n 1 65 THR n 1 66 TYR n 1 67 CYS n 1 68 SER n 1 69 GLN n 1 70 VAL n 1 71 LEU n 1 72 GLY n 1 73 LEU n 1 74 HIS n 1 75 CYS n 1 76 TYR n 1 77 LYS n 1 78 LYS n 1 79 GLY n 1 80 ILE n 1 81 HIS n 1 82 TYR n 1 83 TRP n 1 84 GLU n 1 85 VAL n 1 86 GLU n 1 87 LEU n 1 88 GLN n 1 89 LYS n 1 90 ASN n 1 91 ASN n 1 92 PHE n 1 93 CYS n 1 94 GLY n 1 95 VAL n 1 96 GLY n 1 97 ILE n 1 98 CYS n 1 99 TYR n 1 100 GLY n 1 101 SER n 1 102 MET n 1 103 ASN n 1 104 ARG n 1 105 GLN n 1 106 GLY n 1 107 PRO n 1 108 GLU n 1 109 SER n 1 110 ARG n 1 111 LEU n 1 112 GLY n 1 113 ARG n 1 114 ASN n 1 115 SER n 1 116 ALA n 1 117 SER n 1 118 TRP n 1 119 CYS n 1 120 VAL n 1 121 GLU n 1 122 TRP n 1 123 PHE n 1 124 ASN n 1 125 THR n 1 126 LYS n 1 127 ILE n 1 128 SER n 1 129 ALA n 1 130 TRP n 1 131 HIS n 1 132 ASN n 1 133 ASN n 1 134 VAL n 1 135 GLU n 1 136 LYS n 1 137 THR n 1 138 LEU n 1 139 PRO n 1 140 SER n 1 141 THR n 1 142 LYS n 1 143 ALA n 1 144 THR n 1 145 ARG n 1 146 VAL n 1 147 GLY n 1 148 VAL n 1 149 LEU n 1 150 LEU n 1 151 ASN n 1 152 CYS n 1 153 ASP n 1 154 HIS n 1 155 GLY n 1 156 PHE n 1 157 VAL n 1 158 ILE n 1 159 PHE n 1 160 PHE n 1 161 ALA n 1 162 VAL n 1 163 ALA n 1 164 ASP n 1 165 LYS n 1 166 VAL n 1 167 HIS n 1 168 LEU n 1 169 MET n 1 170 TYR n 1 171 LYS n 1 172 PHE n 1 173 ARG n 1 174 VAL n 1 175 ASP n 1 176 PHE n 1 177 THR n 1 178 GLU n 1 179 ALA n 1 180 LEU n 1 181 TYR n 1 182 PRO n 1 183 ALA n 1 184 PHE n 1 185 TRP n 1 186 VAL n 1 187 PHE n 1 188 SER n 1 189 ALA n 1 190 GLY n 1 191 ALA n 1 192 THR n 1 193 LEU n 1 194 SER n 1 195 ILE n 1 196 CYS n 1 197 SER n 1 198 PRO n 1 199 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 199 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TRIM25, EFP, RNF147, ZNF147' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1IZK non-polymer . '1-[4-(3-methyl-4-phenyl-phenyl)carbonyl-1,4-diazepan-1-yl]ethanone' ? 'C21 H24 N2 O2' 336.427 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 MET 2 -1 -1 MET MET A . n A 1 3 ALA 3 0 0 ALA ALA A . n A 1 4 SER 4 1 1 SER SER A . n A 1 5 LEU 5 2 2 LEU LEU A . n A 1 6 LYS 6 3 3 LYS LYS A . n A 1 7 ALA 7 4 4 ALA ALA A . n A 1 8 LYS 8 5 5 LYS LYS A . n A 1 9 VAL 9 6 6 VAL VAL A . n A 1 10 LEU 10 7 7 LEU LEU A . n A 1 11 GLU 11 8 8 GLU GLU A . n A 1 12 THR 12 9 9 THR THR A . n A 1 13 PHE 13 10 10 PHE PHE A . n A 1 14 LEU 14 11 11 LEU LEU A . n A 1 15 ALA 15 12 12 ALA ALA A . n A 1 16 LYS 16 13 13 LYS LYS A . n A 1 17 SER 17 14 14 SER SER A . n A 1 18 ARG 18 15 15 ARG ARG A . n A 1 19 PRO 19 16 16 PRO PRO A . n A 1 20 GLU 20 17 17 GLU GLU A . n A 1 21 LEU 21 18 18 LEU LEU A . n A 1 22 LEU 22 19 19 LEU LEU A . n A 1 23 GLU 23 20 20 GLU GLU A . n A 1 24 TYR 24 21 21 TYR TYR A . n A 1 25 TYR 25 22 22 TYR TYR A . n A 1 26 ILE 26 23 23 ILE ILE A . n A 1 27 LYS 27 24 24 LYS LYS A . n A 1 28 VAL 28 25 25 VAL VAL A . n A 1 29 ILE 29 26 26 ILE ILE A . n A 1 30 LEU 30 27 27 LEU LEU A . n A 1 31 ASP 31 28 28 ASP ASP A . n A 1 32 TYR 32 29 29 TYR TYR A . n A 1 33 ASN 33 30 30 ASN ASN A . n A 1 34 THR 34 31 31 THR THR A . n A 1 35 ALA 35 32 32 ALA ALA A . n A 1 36 HIS 36 33 33 HIS HIS A . n A 1 37 ASN 37 34 34 ASN ASN A . n A 1 38 LYS 38 35 35 LYS LYS A . n A 1 39 VAL 39 36 36 VAL VAL A . n A 1 40 ALA 40 37 37 ALA ALA A . n A 1 41 LEU 41 38 38 LEU LEU A . n A 1 42 SER 42 39 39 SER SER A . n A 1 43 GLU 43 40 40 GLU GLU A . n A 1 44 CYS 44 41 41 CYS CYS A . n A 1 45 TYR 45 42 42 TYR TYR A . n A 1 46 THR 46 43 43 THR THR A . n A 1 47 VAL 47 44 44 VAL VAL A . n A 1 48 ALA 48 45 45 ALA ALA A . n A 1 49 SER 49 46 46 SER SER A . n A 1 50 VAL 50 47 47 VAL VAL A . n A 1 51 ALA 51 48 48 ALA ALA A . n A 1 52 GLU 52 49 49 GLU GLU A . n A 1 53 MET 53 50 50 MET MET A . n A 1 54 PRO 54 51 51 PRO PRO A . n A 1 55 GLN 55 52 52 GLN GLN A . n A 1 56 ASN 56 53 53 ASN ASN A . n A 1 57 TYR 57 54 54 TYR TYR A . n A 1 58 ARG 58 55 55 ARG ARG A . n A 1 59 PRO 59 56 56 PRO PRO A . n A 1 60 HIS 60 57 57 HIS HIS A . n A 1 61 PRO 61 58 58 PRO PRO A . n A 1 62 GLN 62 59 59 GLN GLN A . n A 1 63 ARG 63 60 60 ARG ARG A . n A 1 64 PHE 64 61 61 PHE PHE A . n A 1 65 THR 65 62 62 THR THR A . n A 1 66 TYR 66 63 63 TYR TYR A . n A 1 67 CYS 67 64 64 CYS CYS A . n A 1 68 SER 68 65 65 SER SER A . n A 1 69 GLN 69 66 66 GLN GLN A . n A 1 70 VAL 70 67 67 VAL VAL A . n A 1 71 LEU 71 68 68 LEU LEU A . n A 1 72 GLY 72 69 69 GLY GLY A . n A 1 73 LEU 73 70 70 LEU LEU A . n A 1 74 HIS 74 71 71 HIS HIS A . n A 1 75 CYS 75 72 72 CYS CYS A . n A 1 76 TYR 76 73 73 TYR TYR A . n A 1 77 LYS 77 74 74 LYS LYS A . n A 1 78 LYS 78 75 75 LYS LYS A . n A 1 79 GLY 79 76 76 GLY GLY A . n A 1 80 ILE 80 77 77 ILE ILE A . n A 1 81 HIS 81 78 78 HIS HIS A . n A 1 82 TYR 82 79 79 TYR TYR A . n A 1 83 TRP 83 80 80 TRP TRP A . n A 1 84 GLU 84 81 81 GLU GLU A . n A 1 85 VAL 85 82 82 VAL VAL A . n A 1 86 GLU 86 83 83 GLU GLU A . n A 1 87 LEU 87 84 84 LEU LEU A . n A 1 88 GLN 88 85 85 GLN GLN A . n A 1 89 LYS 89 86 86 LYS LYS A . n A 1 90 ASN 90 87 87 ASN ASN A . n A 1 91 ASN 91 88 88 ASN ASN A . n A 1 92 PHE 92 89 89 PHE PHE A . n A 1 93 CYS 93 90 90 CYS CYS A . n A 1 94 GLY 94 91 91 GLY GLY A . n A 1 95 VAL 95 92 92 VAL VAL A . n A 1 96 GLY 96 93 93 GLY GLY A . n A 1 97 ILE 97 94 94 ILE ILE A . n A 1 98 CYS 98 95 95 CYS CYS A . n A 1 99 TYR 99 96 96 TYR TYR A . n A 1 100 GLY 100 97 97 GLY GLY A . n A 1 101 SER 101 98 98 SER SER A . n A 1 102 MET 102 99 99 MET MET A . n A 1 103 ASN 103 100 100 ASN ASN A . n A 1 104 ARG 104 101 101 ARG ARG A . n A 1 105 GLN 105 102 102 GLN GLN A . n A 1 106 GLY 106 103 103 GLY GLY A . n A 1 107 PRO 107 104 104 PRO PRO A . n A 1 108 GLU 108 105 105 GLU GLU A . n A 1 109 SER 109 106 106 SER SER A . n A 1 110 ARG 110 107 107 ARG ARG A . n A 1 111 LEU 111 108 108 LEU LEU A . n A 1 112 GLY 112 109 109 GLY GLY A . n A 1 113 ARG 113 110 110 ARG ARG A . n A 1 114 ASN 114 111 111 ASN ASN A . n A 1 115 SER 115 112 112 SER SER A . n A 1 116 ALA 116 113 113 ALA ALA A . n A 1 117 SER 117 114 114 SER SER A . n A 1 118 TRP 118 115 115 TRP TRP A . n A 1 119 CYS 119 116 116 CYS CYS A . n A 1 120 VAL 120 117 117 VAL VAL A . n A 1 121 GLU 121 118 118 GLU GLU A . n A 1 122 TRP 122 119 119 TRP TRP A . n A 1 123 PHE 123 120 120 PHE PHE A . n A 1 124 ASN 124 121 121 ASN ASN A . n A 1 125 THR 125 122 122 THR THR A . n A 1 126 LYS 126 123 123 LYS LYS A . n A 1 127 ILE 127 124 124 ILE ILE A . n A 1 128 SER 128 125 125 SER SER A . n A 1 129 ALA 129 126 126 ALA ALA A . n A 1 130 TRP 130 127 127 TRP TRP A . n A 1 131 HIS 131 128 128 HIS HIS A . n A 1 132 ASN 132 129 129 ASN ASN A . n A 1 133 ASN 133 130 130 ASN ASN A . n A 1 134 VAL 134 131 131 VAL VAL A . n A 1 135 GLU 135 132 132 GLU GLU A . n A 1 136 LYS 136 133 133 LYS LYS A . n A 1 137 THR 137 134 134 THR THR A . n A 1 138 LEU 138 135 135 LEU LEU A . n A 1 139 PRO 139 136 136 PRO PRO A . n A 1 140 SER 140 137 137 SER SER A . n A 1 141 THR 141 138 138 THR THR A . n A 1 142 LYS 142 139 139 LYS LYS A . n A 1 143 ALA 143 140 140 ALA ALA A . n A 1 144 THR 144 141 141 THR THR A . n A 1 145 ARG 145 142 142 ARG ARG A . n A 1 146 VAL 146 143 143 VAL VAL A . n A 1 147 GLY 147 144 144 GLY GLY A . n A 1 148 VAL 148 145 145 VAL VAL A . n A 1 149 LEU 149 146 146 LEU LEU A . n A 1 150 LEU 150 147 147 LEU LEU A . n A 1 151 ASN 151 148 148 ASN ASN A . n A 1 152 CYS 152 149 149 CYS CYS A . n A 1 153 ASP 153 150 150 ASP ASP A . n A 1 154 HIS 154 151 151 HIS HIS A . n A 1 155 GLY 155 152 152 GLY GLY A . n A 1 156 PHE 156 153 153 PHE PHE A . n A 1 157 VAL 157 154 154 VAL VAL A . n A 1 158 ILE 158 155 155 ILE ILE A . n A 1 159 PHE 159 156 156 PHE PHE A . n A 1 160 PHE 160 157 157 PHE PHE A . n A 1 161 ALA 161 158 158 ALA ALA A . n A 1 162 VAL 162 159 159 VAL VAL A . n A 1 163 ALA 163 160 160 ALA ALA A . n A 1 164 ASP 164 161 161 ASP ASP A . n A 1 165 LYS 165 162 162 LYS LYS A . n A 1 166 VAL 166 163 163 VAL VAL A . n A 1 167 HIS 167 164 164 HIS HIS A . n A 1 168 LEU 168 165 165 LEU LEU A . n A 1 169 MET 169 166 166 MET MET A . n A 1 170 TYR 170 167 167 TYR TYR A . n A 1 171 LYS 171 168 168 LYS LYS A . n A 1 172 PHE 172 169 169 PHE PHE A . n A 1 173 ARG 173 170 170 ARG ARG A . n A 1 174 VAL 174 171 171 VAL VAL A . n A 1 175 ASP 175 172 172 ASP ASP A . n A 1 176 PHE 176 173 173 PHE PHE A . n A 1 177 THR 177 174 174 THR THR A . n A 1 178 GLU 178 175 175 GLU GLU A . n A 1 179 ALA 179 176 176 ALA ALA A . n A 1 180 LEU 180 177 177 LEU LEU A . n A 1 181 TYR 181 178 178 TYR TYR A . n A 1 182 PRO 182 179 179 PRO PRO A . n A 1 183 ALA 183 180 180 ALA ALA A . n A 1 184 PHE 184 181 181 PHE PHE A . n A 1 185 TRP 185 182 182 TRP TRP A . n A 1 186 VAL 186 183 183 VAL VAL A . n A 1 187 PHE 187 184 184 PHE PHE A . n A 1 188 SER 188 185 185 SER SER A . n A 1 189 ALA 189 186 186 ALA ALA A . n A 1 190 GLY 190 187 187 GLY GLY A . n A 1 191 ALA 191 188 188 ALA ALA A . n A 1 192 THR 192 189 189 THR THR A . n A 1 193 LEU 193 190 190 LEU LEU A . n A 1 194 SER 194 191 191 SER SER A . n A 1 195 ILE 195 192 192 ILE ILE A . n A 1 196 CYS 196 193 193 CYS CYS A . n A 1 197 SER 197 194 194 SER SER A . n A 1 198 PRO 198 195 195 PRO PRO A . n A 1 199 LYS 199 196 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1IZK _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1IZK _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 A1IZK 1 201 1 A1IZK DRG A . C 3 HOH 1 301 27 HOH HOH A . C 3 HOH 2 302 6 HOH HOH A . C 3 HOH 3 303 20 HOH HOH A . C 3 HOH 4 304 12 HOH HOH A . C 3 HOH 5 305 79 HOH HOH A . C 3 HOH 6 306 253 HOH HOH A . C 3 HOH 7 307 257 HOH HOH A . C 3 HOH 8 308 10 HOH HOH A . C 3 HOH 9 309 40 HOH HOH A . C 3 HOH 10 310 89 HOH HOH A . C 3 HOH 11 311 255 HOH HOH A . C 3 HOH 12 312 5 HOH HOH A . C 3 HOH 13 313 178 HOH HOH A . C 3 HOH 14 314 41 HOH HOH A . C 3 HOH 15 315 28 HOH HOH A . C 3 HOH 16 316 30 HOH HOH A . C 3 HOH 17 317 45 HOH HOH A . C 3 HOH 18 318 3 HOH HOH A . C 3 HOH 19 319 61 HOH HOH A . C 3 HOH 20 320 48 HOH HOH A . C 3 HOH 21 321 8 HOH HOH A . C 3 HOH 22 322 25 HOH HOH A . C 3 HOH 23 323 26 HOH HOH A . C 3 HOH 24 324 62 HOH HOH A . C 3 HOH 25 325 2 HOH HOH A . C 3 HOH 26 326 21 HOH HOH A . C 3 HOH 27 327 23 HOH HOH A . C 3 HOH 28 328 9 HOH HOH A . C 3 HOH 29 329 18 HOH HOH A . C 3 HOH 30 330 76 HOH HOH A . C 3 HOH 31 331 49 HOH HOH A . C 3 HOH 32 332 16 HOH HOH A . C 3 HOH 33 333 17 HOH HOH A . C 3 HOH 34 334 63 HOH HOH A . C 3 HOH 35 335 35 HOH HOH A . C 3 HOH 36 336 99 HOH HOH A . C 3 HOH 37 337 7 HOH HOH A . C 3 HOH 38 338 14 HOH HOH A . C 3 HOH 39 339 251 HOH HOH A . C 3 HOH 40 340 100 HOH HOH A . C 3 HOH 41 341 15 HOH HOH A . C 3 HOH 42 342 31 HOH HOH A . C 3 HOH 43 343 258 HOH HOH A . C 3 HOH 44 344 81 HOH HOH A . C 3 HOH 45 345 4 HOH HOH A . C 3 HOH 46 346 85 HOH HOH A . C 3 HOH 47 347 37 HOH HOH A . C 3 HOH 48 348 86 HOH HOH A . C 3 HOH 49 349 90 HOH HOH A . C 3 HOH 50 350 46 HOH HOH A . C 3 HOH 51 351 24 HOH HOH A . C 3 HOH 52 352 259 HOH HOH A . C 3 HOH 53 353 33 HOH HOH A . C 3 HOH 54 354 60 HOH HOH A . C 3 HOH 55 355 261 HOH HOH A . C 3 HOH 56 356 1 HOH HOH A . C 3 HOH 57 357 101 HOH HOH A . C 3 HOH 58 358 126 HOH HOH A . C 3 HOH 59 359 96 HOH HOH A . C 3 HOH 60 360 254 HOH HOH A . C 3 HOH 61 361 130 HOH HOH A . C 3 HOH 62 362 73 HOH HOH A . C 3 HOH 63 363 51 HOH HOH A . C 3 HOH 64 364 70 HOH HOH A . C 3 HOH 65 365 262 HOH HOH A . C 3 HOH 66 366 263 HOH HOH A . C 3 HOH 67 367 88 HOH HOH A . C 3 HOH 68 368 260 HOH HOH A . C 3 HOH 69 369 54 HOH HOH A . C 3 HOH 70 370 220 HOH HOH A . C 3 HOH 71 371 50 HOH HOH A . C 3 HOH 72 372 58 HOH HOH A . C 3 HOH 73 373 128 HOH HOH A . C 3 HOH 74 374 55 HOH HOH A . C 3 HOH 75 375 136 HOH HOH A . C 3 HOH 76 376 42 HOH HOH A . C 3 HOH 77 377 198 HOH HOH A . C 3 HOH 78 378 39 HOH HOH A . C 3 HOH 79 379 66 HOH HOH A . C 3 HOH 80 380 64 HOH HOH A . C 3 HOH 81 381 111 HOH HOH A . C 3 HOH 82 382 57 HOH HOH A . C 3 HOH 83 383 146 HOH HOH A . C 3 HOH 84 384 156 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21.2_5419 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9I0T _cell.details ? _cell.formula_units_Z ? _cell.length_a 44.360 _cell.length_a_esd ? _cell.length_b 68.782 _cell.length_b_esd ? _cell.length_c 69.831 _cell.length_c_esd ? _cell.volume 213063.279 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9I0T _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall 'P 2ac 2ab' _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9I0T _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.35 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.59 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 9.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M CHES, 20% w/v PEG 8000' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 XE 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2023-07-21 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9537 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I04' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9537 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I04 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate 20.21 _reflns.entry_id 9I0T _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.80 _reflns.d_resolution_low 49 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 20050 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.64 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.0 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 20.98 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.06225 _reflns.pdbx_Rpim_I_all 0.01753 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1 _reflns.pdbx_CC_star 1 _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.05966 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.8 _reflns_shell.d_res_low 1.9 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.24 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2585 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 7.7 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.3213 _reflns_shell.pdbx_Rpim_I_all 0.1093 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.974 _reflns_shell.pdbx_CC_star 0.993 _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 89.86 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.3006 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 24.01 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9I0T _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.80 _refine.ls_d_res_low 49.00 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 19922 _refine.ls_number_reflns_R_free 971 _refine.ls_number_reflns_R_work 18951 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.64 _refine.ls_percent_reflns_R_free 4.87 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2227 _refine.ls_R_factor_R_free 0.2449 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2215 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.5994 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2187 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.80 _refine_hist.d_res_low 49.00 _refine_hist.number_atoms_solvent 84 _refine_hist.number_atoms_total 1692 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1583 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 25 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0058 ? 1656 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.8026 ? 2248 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0570 ? 238 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0058 ? 281 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 12.9662 ? 597 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.80 1.90 . . 129 2440 89.86 . . . . 0.2327 . . . . . . . . . . . 0.3056 'X-RAY DIFFRACTION' 1.90 2.01 . . 123 2624 96.02 . . . . 0.2995 . . . . . . . . . . . 0.3542 'X-RAY DIFFRACTION' 2.01 2.17 . . 146 2722 99.83 . . . . 0.2354 . . . . . . . . . . . 0.2945 'X-RAY DIFFRACTION' 2.17 2.39 . . 155 2671 97.72 . . . . 0.2647 . . . . . . . . . . . 0.3046 'X-RAY DIFFRACTION' 2.39 2.73 . . 133 2763 99.97 . . . . 0.2383 . . . . . . . . . . . 0.2377 'X-RAY DIFFRACTION' 2.73 3.44 . . 135 2810 99.97 . . . . 0.2221 . . . . . . . . . . . 0.2466 'X-RAY DIFFRACTION' 3.44 49.00 . . 150 2921 99.87 . . . . 0.1821 . . . . . . . . . . . 0.1895 # _struct.entry_id 9I0T _struct.title 'Crystal structure of TRIM25 PRYSPRY covalently bound to 2-chloro-1-[4-(3-methyl-4-phenyl-phenyl)carbonyl-1,4-diazepan-1-yl]ethanone' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9I0T _struct_keywords.text 'Ubiquitin, E3 Ligase, small molecule ligand, PRYSPRY, LIGASE' _struct_keywords.pdbx_keywords LIGASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TRI25_HUMAN _struct_ref.pdbx_db_accession Q14258 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SLKAKVLETFLAKSRPELLEYYIKVILDYNTAHNKVALSECYTVASVAEMPQNYRPHPQRFTYCSQVLGLHCYKKGIHYW EVELQKNNFCGVGICYGSMNRQGPESRLGRNSASWCVEWFNTKISAWHNNVEKTLPSTKATRVGVLLNCDHGFVIFFAVA DKVHLMYKFRVDFTEALYPAFWVFSAGATLSICSPK ; _struct_ref.pdbx_align_begin 435 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9I0T _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 199 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q14258 _struct_ref_seq.db_align_beg 435 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 630 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 196 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9I0T GLY A 1 ? UNP Q14258 ? ? 'expression tag' -2 1 1 9I0T MET A 2 ? UNP Q14258 ? ? 'expression tag' -1 2 1 9I0T ALA A 3 ? UNP Q14258 ? ? 'expression tag' 0 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 9720 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MET A 2 ? ALA A 15 ? MET A -1 ALA A 12 1 ? 14 HELX_P HELX_P2 AA2 SER A 17 ? LEU A 22 ? SER A 14 LEU A 19 1 ? 6 HELX_P HELX_P3 AA3 GLU A 23 ? TYR A 25 ? GLU A 20 TYR A 22 5 ? 3 HELX_P HELX_P4 AA4 ASP A 31 ? ALA A 35 ? ASP A 28 ALA A 32 5 ? 5 HELX_P HELX_P5 AA5 GLY A 106 ? ARG A 110 ? GLY A 103 ARG A 107 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 67 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id A1IZK _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C1 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 64 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id A1IZK _struct_conn.ptnr2_auth_seq_id 201 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.814 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id A1IZK _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 67 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id A1IZK _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 201 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 64 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom C1 _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id A1IZK _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Covalent chemical modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 39 ? SER A 42 ? VAL A 36 SER A 39 AA1 2 VAL A 47 ? VAL A 50 ? VAL A 44 VAL A 47 AA1 3 THR A 192 ? ILE A 195 ? THR A 189 ILE A 192 AA1 4 ILE A 80 ? LEU A 87 ? ILE A 77 LEU A 84 AA1 5 ARG A 145 ? ASN A 151 ? ARG A 142 ASN A 148 AA1 6 PHE A 156 ? VAL A 162 ? PHE A 153 VAL A 159 AA1 7 VAL A 166 ? ARG A 173 ? VAL A 163 ARG A 170 AA2 1 GLN A 69 ? LEU A 71 ? GLN A 66 LEU A 68 AA2 2 LEU A 180 ? VAL A 186 ? LEU A 177 VAL A 183 AA2 3 CYS A 93 ? TYR A 99 ? CYS A 90 TYR A 96 AA2 4 SER A 117 ? PHE A 123 ? SER A 114 PHE A 120 AA2 5 LYS A 126 ? HIS A 131 ? LYS A 123 HIS A 128 AA2 6 VAL A 134 ? LEU A 138 ? VAL A 131 LEU A 135 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ALA A 40 ? N ALA A 37 O SER A 49 ? O SER A 46 AA1 2 3 N ALA A 48 ? N ALA A 45 O LEU A 193 ? O LEU A 190 AA1 3 4 O SER A 194 ? O SER A 191 N GLU A 86 ? N GLU A 83 AA1 4 5 N HIS A 81 ? N HIS A 78 O LEU A 150 ? O LEU A 147 AA1 5 6 N GLY A 147 ? N GLY A 144 O PHE A 160 ? O PHE A 157 AA1 6 7 N ALA A 161 ? N ALA A 158 O HIS A 167 ? O HIS A 164 AA2 1 2 N VAL A 70 ? N VAL A 67 O PHE A 184 ? O PHE A 181 AA2 2 3 O TYR A 181 ? O TYR A 178 N CYS A 98 ? N CYS A 95 AA2 3 4 N CYS A 93 ? N CYS A 90 O TRP A 122 ? O TRP A 119 AA2 4 5 N CYS A 119 ? N CYS A 116 O TRP A 130 ? O TRP A 127 AA2 5 6 N ALA A 129 ? N ALA A 126 O LYS A 136 ? O LYS A 133 # _pdbx_entry_details.entry_id 9I0T _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 160 ? ? -133.18 -142.48 2 1 PHE A 184 ? ? -135.47 -47.95 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x+1/2,-y+1/2,-z 3 -x,y+1/2,-z+1/2 4 -x+1/2,-y,z+1/2 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 384 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.47 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A LYS 196 ? A LYS 199 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1IZK C4 C N N 1 A1IZK C14 C Y N 2 A1IZK C5 C N N 3 A1IZK C6 C N N 4 A1IZK C11 C Y N 5 A1IZK C7 C Y N 6 A1IZK C8 C Y N 7 A1IZK C9 C Y N 8 A1IZK C10 C Y N 9 A1IZK C12 C Y N 10 A1IZK C13 C Y N 11 A1IZK N1 N N N 12 A1IZK N2 N N N 13 A1IZK C3 C N N 14 A1IZK C1 C N N 15 A1IZK C15 C Y N 16 A1IZK C16 C Y N 17 A1IZK C17 C Y N 18 A1IZK C18 C N N 19 A1IZK C19 C Y N 20 A1IZK C2 C N N 21 A1IZK C20 C N N 22 A1IZK C21 C N N 23 A1IZK O1 O N N 24 A1IZK O2 O N N 25 A1IZK H7 H N N 26 A1IZK H6 H N N 27 A1IZK H14 H N N 28 A1IZK H9 H N N 29 A1IZK H8 H N N 30 A1IZK H10 H N N 31 A1IZK H11 H N N 32 A1IZK H12 H N N 33 A1IZK H13 H N N 34 A1IZK H4 H N N 35 A1IZK H5 H N N 36 A1IZK H2 H N N 37 A1IZK H1 H N N 38 A1IZK H3 H N N 39 A1IZK H15 H N N 40 A1IZK H16 H N N 41 A1IZK H19 H N N 42 A1IZK H18 H N N 43 A1IZK H17 H N N 44 A1IZK H20 H N N 45 A1IZK H21 H N N 46 A1IZK H22 H N N 47 A1IZK H24 H N N 48 A1IZK H23 H N N 49 ALA N N N N 50 ALA CA C N S 51 ALA C C N N 52 ALA O O N N 53 ALA CB C N N 54 ALA OXT O N N 55 ALA H H N N 56 ALA H2 H N N 57 ALA HA H N N 58 ALA HB1 H N N 59 ALA HB2 H N N 60 ALA HB3 H N N 61 ALA HXT H N N 62 ARG N N N N 63 ARG CA C N S 64 ARG C C N N 65 ARG O O N N 66 ARG CB C N N 67 ARG CG C N N 68 ARG CD C N N 69 ARG NE N N N 70 ARG CZ C N N 71 ARG NH1 N N N 72 ARG NH2 N N N 73 ARG OXT O N N 74 ARG H H N N 75 ARG H2 H N N 76 ARG HA H N N 77 ARG HB2 H N N 78 ARG HB3 H N N 79 ARG HG2 H N N 80 ARG HG3 H N N 81 ARG HD2 H N N 82 ARG HD3 H N N 83 ARG HE H N N 84 ARG HH11 H N N 85 ARG HH12 H N N 86 ARG HH21 H N N 87 ARG HH22 H N N 88 ARG HXT H N N 89 ASN N N N N 90 ASN CA C N S 91 ASN C C N N 92 ASN O O N N 93 ASN CB C N N 94 ASN CG C N N 95 ASN OD1 O N N 96 ASN ND2 N N N 97 ASN OXT O N N 98 ASN H H N N 99 ASN H2 H N N 100 ASN HA H N N 101 ASN HB2 H N N 102 ASN HB3 H N N 103 ASN HD21 H N N 104 ASN HD22 H N N 105 ASN HXT H N N 106 ASP N N N N 107 ASP CA C N S 108 ASP C C N N 109 ASP O O N N 110 ASP CB C N N 111 ASP CG C N N 112 ASP OD1 O N N 113 ASP OD2 O N N 114 ASP OXT O N N 115 ASP H H N N 116 ASP H2 H N N 117 ASP HA H N N 118 ASP HB2 H N N 119 ASP HB3 H N N 120 ASP HD2 H N N 121 ASP HXT H N N 122 CYS N N N N 123 CYS CA C N R 124 CYS C C N N 125 CYS O O N N 126 CYS CB C N N 127 CYS SG S N N 128 CYS OXT O N N 129 CYS H H N N 130 CYS H2 H N N 131 CYS HA H N N 132 CYS HB2 H N N 133 CYS HB3 H N N 134 CYS HG H N N 135 CYS HXT H N N 136 GLN N N N N 137 GLN CA C N S 138 GLN C C N N 139 GLN O O N N 140 GLN CB C N N 141 GLN CG C N N 142 GLN CD C N N 143 GLN OE1 O N N 144 GLN NE2 N N N 145 GLN OXT O N N 146 GLN H H N N 147 GLN H2 H N N 148 GLN HA H N N 149 GLN HB2 H N N 150 GLN HB3 H N N 151 GLN HG2 H N N 152 GLN HG3 H N N 153 GLN HE21 H N N 154 GLN HE22 H N N 155 GLN HXT H N N 156 GLU N N N N 157 GLU CA C N S 158 GLU C C N N 159 GLU O O N N 160 GLU CB C N N 161 GLU CG C N N 162 GLU CD C N N 163 GLU OE1 O N N 164 GLU OE2 O N N 165 GLU OXT O N N 166 GLU H H N N 167 GLU H2 H N N 168 GLU HA H N N 169 GLU HB2 H N N 170 GLU HB3 H N N 171 GLU HG2 H N N 172 GLU HG3 H N N 173 GLU HE2 H N N 174 GLU HXT H N N 175 GLY N N N N 176 GLY CA C N N 177 GLY C C N N 178 GLY O O N N 179 GLY OXT O N N 180 GLY H H N N 181 GLY H2 H N N 182 GLY HA2 H N N 183 GLY HA3 H N N 184 GLY HXT H N N 185 HIS N N N N 186 HIS CA C N S 187 HIS C C N N 188 HIS O O N N 189 HIS CB C N N 190 HIS CG C Y N 191 HIS ND1 N Y N 192 HIS CD2 C Y N 193 HIS CE1 C Y N 194 HIS NE2 N Y N 195 HIS OXT O N N 196 HIS H H N N 197 HIS H2 H N N 198 HIS HA H N N 199 HIS HB2 H N N 200 HIS HB3 H N N 201 HIS HD1 H N N 202 HIS HD2 H N N 203 HIS HE1 H N N 204 HIS HE2 H N N 205 HIS HXT H N N 206 HOH O O N N 207 HOH H1 H N N 208 HOH H2 H N N 209 ILE N N N N 210 ILE CA C N S 211 ILE C C N N 212 ILE O O N N 213 ILE CB C N S 214 ILE CG1 C N N 215 ILE CG2 C N N 216 ILE CD1 C N N 217 ILE OXT O N N 218 ILE H H N N 219 ILE H2 H N N 220 ILE HA H N N 221 ILE HB H N N 222 ILE HG12 H N N 223 ILE HG13 H N N 224 ILE HG21 H N N 225 ILE HG22 H N N 226 ILE HG23 H N N 227 ILE HD11 H N N 228 ILE HD12 H N N 229 ILE HD13 H N N 230 ILE HXT H N N 231 LEU N N N N 232 LEU CA C N S 233 LEU C C N N 234 LEU O O N N 235 LEU CB C N N 236 LEU CG C N N 237 LEU CD1 C N N 238 LEU CD2 C N N 239 LEU OXT O N N 240 LEU H H N N 241 LEU H2 H N N 242 LEU HA H N N 243 LEU HB2 H N N 244 LEU HB3 H N N 245 LEU HG H N N 246 LEU HD11 H N N 247 LEU HD12 H N N 248 LEU HD13 H N N 249 LEU HD21 H N N 250 LEU HD22 H N N 251 LEU HD23 H N N 252 LEU HXT H N N 253 LYS N N N N 254 LYS CA C N S 255 LYS C C N N 256 LYS O O N N 257 LYS CB C N N 258 LYS CG C N N 259 LYS CD C N N 260 LYS CE C N N 261 LYS NZ N N N 262 LYS OXT O N N 263 LYS H H N N 264 LYS H2 H N N 265 LYS HA H N N 266 LYS HB2 H N N 267 LYS HB3 H N N 268 LYS HG2 H N N 269 LYS HG3 H N N 270 LYS HD2 H N N 271 LYS HD3 H N N 272 LYS HE2 H N N 273 LYS HE3 H N N 274 LYS HZ1 H N N 275 LYS HZ2 H N N 276 LYS HZ3 H N N 277 LYS HXT H N N 278 MET N N N N 279 MET CA C N S 280 MET C C N N 281 MET O O N N 282 MET CB C N N 283 MET CG C N N 284 MET SD S N N 285 MET CE C N N 286 MET OXT O N N 287 MET H H N N 288 MET H2 H N N 289 MET HA H N N 290 MET HB2 H N N 291 MET HB3 H N N 292 MET HG2 H N N 293 MET HG3 H N N 294 MET HE1 H N N 295 MET HE2 H N N 296 MET HE3 H N N 297 MET HXT H N N 298 PHE N N N N 299 PHE CA C N S 300 PHE C C N N 301 PHE O O N N 302 PHE CB C N N 303 PHE CG C Y N 304 PHE CD1 C Y N 305 PHE CD2 C Y N 306 PHE CE1 C Y N 307 PHE CE2 C Y N 308 PHE CZ C Y N 309 PHE OXT O N N 310 PHE H H N N 311 PHE H2 H N N 312 PHE HA H N N 313 PHE HB2 H N N 314 PHE HB3 H N N 315 PHE HD1 H N N 316 PHE HD2 H N N 317 PHE HE1 H N N 318 PHE HE2 H N N 319 PHE HZ H N N 320 PHE HXT H N N 321 PRO N N N N 322 PRO CA C N S 323 PRO C C N N 324 PRO O O N N 325 PRO CB C N N 326 PRO CG C N N 327 PRO CD C N N 328 PRO OXT O N N 329 PRO H H N N 330 PRO HA H N N 331 PRO HB2 H N N 332 PRO HB3 H N N 333 PRO HG2 H N N 334 PRO HG3 H N N 335 PRO HD2 H N N 336 PRO HD3 H N N 337 PRO HXT H N N 338 SER N N N N 339 SER CA C N S 340 SER C C N N 341 SER O O N N 342 SER CB C N N 343 SER OG O N N 344 SER OXT O N N 345 SER H H N N 346 SER H2 H N N 347 SER HA H N N 348 SER HB2 H N N 349 SER HB3 H N N 350 SER HG H N N 351 SER HXT H N N 352 THR N N N N 353 THR CA C N S 354 THR C C N N 355 THR O O N N 356 THR CB C N R 357 THR OG1 O N N 358 THR CG2 C N N 359 THR OXT O N N 360 THR H H N N 361 THR H2 H N N 362 THR HA H N N 363 THR HB H N N 364 THR HG1 H N N 365 THR HG21 H N N 366 THR HG22 H N N 367 THR HG23 H N N 368 THR HXT H N N 369 TRP N N N N 370 TRP CA C N S 371 TRP C C N N 372 TRP O O N N 373 TRP CB C N N 374 TRP CG C Y N 375 TRP CD1 C Y N 376 TRP CD2 C Y N 377 TRP NE1 N Y N 378 TRP CE2 C Y N 379 TRP CE3 C Y N 380 TRP CZ2 C Y N 381 TRP CZ3 C Y N 382 TRP CH2 C Y N 383 TRP OXT O N N 384 TRP H H N N 385 TRP H2 H N N 386 TRP HA H N N 387 TRP HB2 H N N 388 TRP HB3 H N N 389 TRP HD1 H N N 390 TRP HE1 H N N 391 TRP HE3 H N N 392 TRP HZ2 H N N 393 TRP HZ3 H N N 394 TRP HH2 H N N 395 TRP HXT H N N 396 TYR N N N N 397 TYR CA C N S 398 TYR C C N N 399 TYR O O N N 400 TYR CB C N N 401 TYR CG C Y N 402 TYR CD1 C Y N 403 TYR CD2 C Y N 404 TYR CE1 C Y N 405 TYR CE2 C Y N 406 TYR CZ C Y N 407 TYR OH O N N 408 TYR OXT O N N 409 TYR H H N N 410 TYR H2 H N N 411 TYR HA H N N 412 TYR HB2 H N N 413 TYR HB3 H N N 414 TYR HD1 H N N 415 TYR HD2 H N N 416 TYR HE1 H N N 417 TYR HE2 H N N 418 TYR HH H N N 419 TYR HXT H N N 420 VAL N N N N 421 VAL CA C N S 422 VAL C C N N 423 VAL O O N N 424 VAL CB C N N 425 VAL CG1 C N N 426 VAL CG2 C N N 427 VAL OXT O N N 428 VAL H H N N 429 VAL H2 H N N 430 VAL HA H N N 431 VAL HB H N N 432 VAL HG11 H N N 433 VAL HG12 H N N 434 VAL HG13 H N N 435 VAL HG21 H N N 436 VAL HG22 H N N 437 VAL HG23 H N N 438 VAL HXT H N N 439 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1IZK C1 C2 sing N N 1 A1IZK C10 C11 sing N N 2 A1IZK C10 C17 doub Y N 3 A1IZK C10 C9 sing Y N 4 A1IZK C11 C12 doub Y N 5 A1IZK C11 C16 sing Y N 6 A1IZK C12 C13 sing Y N 7 A1IZK C13 C14 doub Y N 8 A1IZK C14 C15 sing Y N 9 A1IZK C15 C16 doub Y N 10 A1IZK C17 C18 sing N N 11 A1IZK C17 C19 sing Y N 12 A1IZK C19 C7 doub Y N 13 A1IZK C2 N1 sing N N 14 A1IZK C2 O1 doub N N 15 A1IZK C20 C21 sing N N 16 A1IZK C20 N2 sing N N 17 A1IZK C21 N1 sing N N 18 A1IZK C3 C4 sing N N 19 A1IZK C3 N1 sing N N 20 A1IZK C4 C5 sing N N 21 A1IZK C5 N2 sing N N 22 A1IZK C6 C7 sing N N 23 A1IZK C6 N2 sing N N 24 A1IZK C6 O2 doub N N 25 A1IZK C7 C8 sing Y N 26 A1IZK C8 C9 doub Y N 27 A1IZK C4 H7 sing N N 28 A1IZK C4 H6 sing N N 29 A1IZK C14 H14 sing N N 30 A1IZK C5 H9 sing N N 31 A1IZK C5 H8 sing N N 32 A1IZK C8 H10 sing N N 33 A1IZK C9 H11 sing N N 34 A1IZK C12 H12 sing N N 35 A1IZK C13 H13 sing N N 36 A1IZK C3 H4 sing N N 37 A1IZK C3 H5 sing N N 38 A1IZK C1 H2 sing N N 39 A1IZK C1 H1 sing N N 40 A1IZK C1 H3 sing N N 41 A1IZK C15 H15 sing N N 42 A1IZK C16 H16 sing N N 43 A1IZK C18 H19 sing N N 44 A1IZK C18 H18 sing N N 45 A1IZK C18 H17 sing N N 46 A1IZK C19 H20 sing N N 47 A1IZK C20 H21 sing N N 48 A1IZK C20 H22 sing N N 49 A1IZK C21 H24 sing N N 50 A1IZK C21 H23 sing N N 51 ALA N CA sing N N 52 ALA N H sing N N 53 ALA N H2 sing N N 54 ALA CA C sing N N 55 ALA CA CB sing N N 56 ALA CA HA sing N N 57 ALA C O doub N N 58 ALA C OXT sing N N 59 ALA CB HB1 sing N N 60 ALA CB HB2 sing N N 61 ALA CB HB3 sing N N 62 ALA OXT HXT sing N N 63 ARG N CA sing N N 64 ARG N H sing N N 65 ARG N H2 sing N N 66 ARG CA C sing N N 67 ARG CA CB sing N N 68 ARG CA HA sing N N 69 ARG C O doub N N 70 ARG C OXT sing N N 71 ARG CB CG sing N N 72 ARG CB HB2 sing N N 73 ARG CB HB3 sing N N 74 ARG CG CD sing N N 75 ARG CG HG2 sing N N 76 ARG CG HG3 sing N N 77 ARG CD NE sing N N 78 ARG CD HD2 sing N N 79 ARG CD HD3 sing N N 80 ARG NE CZ sing N N 81 ARG NE HE sing N N 82 ARG CZ NH1 sing N N 83 ARG CZ NH2 doub N N 84 ARG NH1 HH11 sing N N 85 ARG NH1 HH12 sing N N 86 ARG NH2 HH21 sing N N 87 ARG NH2 HH22 sing N N 88 ARG OXT HXT sing N N 89 ASN N CA sing N N 90 ASN N H sing N N 91 ASN N H2 sing N N 92 ASN CA C sing N N 93 ASN CA CB sing N N 94 ASN CA HA sing N N 95 ASN C O doub N N 96 ASN C OXT sing N N 97 ASN CB CG sing N N 98 ASN CB HB2 sing N N 99 ASN CB HB3 sing N N 100 ASN CG OD1 doub N N 101 ASN CG ND2 sing N N 102 ASN ND2 HD21 sing N N 103 ASN ND2 HD22 sing N N 104 ASN OXT HXT sing N N 105 ASP N CA sing N N 106 ASP N H sing N N 107 ASP N H2 sing N N 108 ASP CA C sing N N 109 ASP CA CB sing N N 110 ASP CA HA sing N N 111 ASP C O doub N N 112 ASP C OXT sing N N 113 ASP CB CG sing N N 114 ASP CB HB2 sing N N 115 ASP CB HB3 sing N N 116 ASP CG OD1 doub N N 117 ASP CG OD2 sing N N 118 ASP OD2 HD2 sing N N 119 ASP OXT HXT sing N N 120 CYS N CA sing N N 121 CYS N H sing N N 122 CYS N H2 sing N N 123 CYS CA C sing N N 124 CYS CA CB sing N N 125 CYS CA HA sing N N 126 CYS C O doub N N 127 CYS C OXT sing N N 128 CYS CB SG sing N N 129 CYS CB HB2 sing N N 130 CYS CB HB3 sing N N 131 CYS SG HG sing N N 132 CYS OXT HXT sing N N 133 GLN N CA sing N N 134 GLN N H sing N N 135 GLN N H2 sing N N 136 GLN CA C sing N N 137 GLN CA CB sing N N 138 GLN CA HA sing N N 139 GLN C O doub N N 140 GLN C OXT sing N N 141 GLN CB CG sing N N 142 GLN CB HB2 sing N N 143 GLN CB HB3 sing N N 144 GLN CG CD sing N N 145 GLN CG HG2 sing N N 146 GLN CG HG3 sing N N 147 GLN CD OE1 doub N N 148 GLN CD NE2 sing N N 149 GLN NE2 HE21 sing N N 150 GLN NE2 HE22 sing N N 151 GLN OXT HXT sing N N 152 GLU N CA sing N N 153 GLU N H sing N N 154 GLU N H2 sing N N 155 GLU CA C sing N N 156 GLU CA CB sing N N 157 GLU CA HA sing N N 158 GLU C O doub N N 159 GLU C OXT sing N N 160 GLU CB CG sing N N 161 GLU CB HB2 sing N N 162 GLU CB HB3 sing N N 163 GLU CG CD sing N N 164 GLU CG HG2 sing N N 165 GLU CG HG3 sing N N 166 GLU CD OE1 doub N N 167 GLU CD OE2 sing N N 168 GLU OE2 HE2 sing N N 169 GLU OXT HXT sing N N 170 GLY N CA sing N N 171 GLY N H sing N N 172 GLY N H2 sing N N 173 GLY CA C sing N N 174 GLY CA HA2 sing N N 175 GLY CA HA3 sing N N 176 GLY C O doub N N 177 GLY C OXT sing N N 178 GLY OXT HXT sing N N 179 HIS N CA sing N N 180 HIS N H sing N N 181 HIS N H2 sing N N 182 HIS CA C sing N N 183 HIS CA CB sing N N 184 HIS CA HA sing N N 185 HIS C O doub N N 186 HIS C OXT sing N N 187 HIS CB CG sing N N 188 HIS CB HB2 sing N N 189 HIS CB HB3 sing N N 190 HIS CG ND1 sing Y N 191 HIS CG CD2 doub Y N 192 HIS ND1 CE1 doub Y N 193 HIS ND1 HD1 sing N N 194 HIS CD2 NE2 sing Y N 195 HIS CD2 HD2 sing N N 196 HIS CE1 NE2 sing Y N 197 HIS CE1 HE1 sing N N 198 HIS NE2 HE2 sing N N 199 HIS OXT HXT sing N N 200 HOH O H1 sing N N 201 HOH O H2 sing N N 202 ILE N CA sing N N 203 ILE N H sing N N 204 ILE N H2 sing N N 205 ILE CA C sing N N 206 ILE CA CB sing N N 207 ILE CA HA sing N N 208 ILE C O doub N N 209 ILE C OXT sing N N 210 ILE CB CG1 sing N N 211 ILE CB CG2 sing N N 212 ILE CB HB sing N N 213 ILE CG1 CD1 sing N N 214 ILE CG1 HG12 sing N N 215 ILE CG1 HG13 sing N N 216 ILE CG2 HG21 sing N N 217 ILE CG2 HG22 sing N N 218 ILE CG2 HG23 sing N N 219 ILE CD1 HD11 sing N N 220 ILE CD1 HD12 sing N N 221 ILE CD1 HD13 sing N N 222 ILE OXT HXT sing N N 223 LEU N CA sing N N 224 LEU N H sing N N 225 LEU N H2 sing N N 226 LEU CA C sing N N 227 LEU CA CB sing N N 228 LEU CA HA sing N N 229 LEU C O doub N N 230 LEU C OXT sing N N 231 LEU CB CG sing N N 232 LEU CB HB2 sing N N 233 LEU CB HB3 sing N N 234 LEU CG CD1 sing N N 235 LEU CG CD2 sing N N 236 LEU CG HG sing N N 237 LEU CD1 HD11 sing N N 238 LEU CD1 HD12 sing N N 239 LEU CD1 HD13 sing N N 240 LEU CD2 HD21 sing N N 241 LEU CD2 HD22 sing N N 242 LEU CD2 HD23 sing N N 243 LEU OXT HXT sing N N 244 LYS N CA sing N N 245 LYS N H sing N N 246 LYS N H2 sing N N 247 LYS CA C sing N N 248 LYS CA CB sing N N 249 LYS CA HA sing N N 250 LYS C O doub N N 251 LYS C OXT sing N N 252 LYS CB CG sing N N 253 LYS CB HB2 sing N N 254 LYS CB HB3 sing N N 255 LYS CG CD sing N N 256 LYS CG HG2 sing N N 257 LYS CG HG3 sing N N 258 LYS CD CE sing N N 259 LYS CD HD2 sing N N 260 LYS CD HD3 sing N N 261 LYS CE NZ sing N N 262 LYS CE HE2 sing N N 263 LYS CE HE3 sing N N 264 LYS NZ HZ1 sing N N 265 LYS NZ HZ2 sing N N 266 LYS NZ HZ3 sing N N 267 LYS OXT HXT sing N N 268 MET N CA sing N N 269 MET N H sing N N 270 MET N H2 sing N N 271 MET CA C sing N N 272 MET CA CB sing N N 273 MET CA HA sing N N 274 MET C O doub N N 275 MET C OXT sing N N 276 MET CB CG sing N N 277 MET CB HB2 sing N N 278 MET CB HB3 sing N N 279 MET CG SD sing N N 280 MET CG HG2 sing N N 281 MET CG HG3 sing N N 282 MET SD CE sing N N 283 MET CE HE1 sing N N 284 MET CE HE2 sing N N 285 MET CE HE3 sing N N 286 MET OXT HXT sing N N 287 PHE N CA sing N N 288 PHE N H sing N N 289 PHE N H2 sing N N 290 PHE CA C sing N N 291 PHE CA CB sing N N 292 PHE CA HA sing N N 293 PHE C O doub N N 294 PHE C OXT sing N N 295 PHE CB CG sing N N 296 PHE CB HB2 sing N N 297 PHE CB HB3 sing N N 298 PHE CG CD1 doub Y N 299 PHE CG CD2 sing Y N 300 PHE CD1 CE1 sing Y N 301 PHE CD1 HD1 sing N N 302 PHE CD2 CE2 doub Y N 303 PHE CD2 HD2 sing N N 304 PHE CE1 CZ doub Y N 305 PHE CE1 HE1 sing N N 306 PHE CE2 CZ sing Y N 307 PHE CE2 HE2 sing N N 308 PHE CZ HZ sing N N 309 PHE OXT HXT sing N N 310 PRO N CA sing N N 311 PRO N CD sing N N 312 PRO N H sing N N 313 PRO CA C sing N N 314 PRO CA CB sing N N 315 PRO CA HA sing N N 316 PRO C O doub N N 317 PRO C OXT sing N N 318 PRO CB CG sing N N 319 PRO CB HB2 sing N N 320 PRO CB HB3 sing N N 321 PRO CG CD sing N N 322 PRO CG HG2 sing N N 323 PRO CG HG3 sing N N 324 PRO CD HD2 sing N N 325 PRO CD HD3 sing N N 326 PRO OXT HXT sing N N 327 SER N CA sing N N 328 SER N H sing N N 329 SER N H2 sing N N 330 SER CA C sing N N 331 SER CA CB sing N N 332 SER CA HA sing N N 333 SER C O doub N N 334 SER C OXT sing N N 335 SER CB OG sing N N 336 SER CB HB2 sing N N 337 SER CB HB3 sing N N 338 SER OG HG sing N N 339 SER OXT HXT sing N N 340 THR N CA sing N N 341 THR N H sing N N 342 THR N H2 sing N N 343 THR CA C sing N N 344 THR CA CB sing N N 345 THR CA HA sing N N 346 THR C O doub N N 347 THR C OXT sing N N 348 THR CB OG1 sing N N 349 THR CB CG2 sing N N 350 THR CB HB sing N N 351 THR OG1 HG1 sing N N 352 THR CG2 HG21 sing N N 353 THR CG2 HG22 sing N N 354 THR CG2 HG23 sing N N 355 THR OXT HXT sing N N 356 TRP N CA sing N N 357 TRP N H sing N N 358 TRP N H2 sing N N 359 TRP CA C sing N N 360 TRP CA CB sing N N 361 TRP CA HA sing N N 362 TRP C O doub N N 363 TRP C OXT sing N N 364 TRP CB CG sing N N 365 TRP CB HB2 sing N N 366 TRP CB HB3 sing N N 367 TRP CG CD1 doub Y N 368 TRP CG CD2 sing Y N 369 TRP CD1 NE1 sing Y N 370 TRP CD1 HD1 sing N N 371 TRP CD2 CE2 doub Y N 372 TRP CD2 CE3 sing Y N 373 TRP NE1 CE2 sing Y N 374 TRP NE1 HE1 sing N N 375 TRP CE2 CZ2 sing Y N 376 TRP CE3 CZ3 doub Y N 377 TRP CE3 HE3 sing N N 378 TRP CZ2 CH2 doub Y N 379 TRP CZ2 HZ2 sing N N 380 TRP CZ3 CH2 sing Y N 381 TRP CZ3 HZ3 sing N N 382 TRP CH2 HH2 sing N N 383 TRP OXT HXT sing N N 384 TYR N CA sing N N 385 TYR N H sing N N 386 TYR N H2 sing N N 387 TYR CA C sing N N 388 TYR CA CB sing N N 389 TYR CA HA sing N N 390 TYR C O doub N N 391 TYR C OXT sing N N 392 TYR CB CG sing N N 393 TYR CB HB2 sing N N 394 TYR CB HB3 sing N N 395 TYR CG CD1 doub Y N 396 TYR CG CD2 sing Y N 397 TYR CD1 CE1 sing Y N 398 TYR CD1 HD1 sing N N 399 TYR CD2 CE2 doub Y N 400 TYR CD2 HD2 sing N N 401 TYR CE1 CZ doub Y N 402 TYR CE1 HE1 sing N N 403 TYR CE2 CZ sing Y N 404 TYR CE2 HE2 sing N N 405 TYR CZ OH sing N N 406 TYR OH HH sing N N 407 TYR OXT HXT sing N N 408 VAL N CA sing N N 409 VAL N H sing N N 410 VAL N H2 sing N N 411 VAL CA C sing N N 412 VAL CA CB sing N N 413 VAL CA HA sing N N 414 VAL C O doub N N 415 VAL C OXT sing N N 416 VAL CB CG1 sing N N 417 VAL CB CG2 sing N N 418 VAL CB HB sing N N 419 VAL CG1 HG11 sing N N 420 VAL CG1 HG12 sing N N 421 VAL CG1 HG13 sing N N 422 VAL CG2 HG21 sing N N 423 VAL CG2 HG22 sing N N 424 VAL CG2 HG23 sing N N 425 VAL OXT HXT sing N N 426 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'The Francis Crick Institute' 'United Kingdom' CC2075 1 'Wellcome Trust' 'United Kingdom' CC2075 2 'Cancer Research UK' 'United Kingdom' CC2075 3 'Medical Research Council (MRC, United Kingdom)' 'United Kingdom' CC2075 4 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6FLM _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 21 21 21' _space_group.name_Hall 'P 2ac 2ab' _space_group.IT_number 19 _space_group.crystal_system orthorhombic _space_group.id 1 # _atom_sites.entry_id 9I0T _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.022543 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014539 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014320 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #