data_9IBR # _entry.id 9IBR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.404 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9IBR pdb_00009ibr 10.2210/pdb9ibr/pdb WWPDB D_1292145450 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-08-13 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9IBR _pdbx_database_status.recvd_initial_deposition_date 2025-02-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 2 _pdbx_contact_author.email daniel.merk@cup.lmu.de _pdbx_contact_author.name_first Daniel _pdbx_contact_author.name_last Merk _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-5359-8128 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Morozov, V.' 1 ? 'Merk, D.' 2 ? 'Schallmayer, A.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 68 _citation.language ? _citation.page_first 10410 _citation.page_last 10424 _citation.title 'A First-in-Class Hepatocyte Nuclear Factor 4 Agonist.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.5c00595 _citation.pdbx_database_id_PubMed 40336482 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Schallmayer, E.' 1 ? primary 'Morozov, V.' 2 ? primary 'Duensing-Kropp, S.' 3 ? primary 'Schallmayer, L.' 4 ? primary 'Schuffner, L.' 5 ? primary 'Schubert-Zsilavecz, M.' 6 ? primary 'Pabel, J.' 7 0000-0002-0174-9772 primary 'Hofner, G.' 8 ? primary 'Heering, J.' 9 0000-0002-4922-1993 primary 'Marschner, J.A.' 10 ? primary 'Merk, D.' 11 0000-0002-5359-8128 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Hepatocyte nuclear factor 4-alpha' 25993.256 1 ? ? ? ? 2 polymer syn 'Nuclear receptor coactivator 2' 1276.530 1 ? ? ? ? 3 non-polymer syn '2-hydroxy-5-(phenylethynyl)benzoic acid' 237.230 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'HNF-4-alpha,Nuclear receptor subfamily 2 group A member 1,Transcription factor 14,TCF-14,Transcription factor HNF-4' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;SLPSINALLQAEVLSRQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEH LLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGK IKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGG ; ;SLPSINALLQAEVLSRQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEH LLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGK IKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGG ; A ? 2 'polypeptide(L)' no no HKILHRLLQD HKILHRLLQD B ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name '2-hydroxy-5-(phenylethynyl)benzoic acid' _pdbx_entity_nonpoly.comp_id A1I1W # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 LEU n 1 3 PRO n 1 4 SER n 1 5 ILE n 1 6 ASN n 1 7 ALA n 1 8 LEU n 1 9 LEU n 1 10 GLN n 1 11 ALA n 1 12 GLU n 1 13 VAL n 1 14 LEU n 1 15 SER n 1 16 ARG n 1 17 GLN n 1 18 ILE n 1 19 THR n 1 20 SER n 1 21 PRO n 1 22 VAL n 1 23 SER n 1 24 GLY n 1 25 ILE n 1 26 ASN n 1 27 GLY n 1 28 ASP n 1 29 ILE n 1 30 ARG n 1 31 ALA n 1 32 LYS n 1 33 LYS n 1 34 ILE n 1 35 ALA n 1 36 SER n 1 37 ILE n 1 38 ALA n 1 39 ASP n 1 40 VAL n 1 41 CYS n 1 42 GLU n 1 43 SER n 1 44 MET n 1 45 LYS n 1 46 GLU n 1 47 GLN n 1 48 LEU n 1 49 LEU n 1 50 VAL n 1 51 LEU n 1 52 VAL n 1 53 GLU n 1 54 TRP n 1 55 ALA n 1 56 LYS n 1 57 TYR n 1 58 ILE n 1 59 PRO n 1 60 ALA n 1 61 PHE n 1 62 CYS n 1 63 GLU n 1 64 LEU n 1 65 PRO n 1 66 LEU n 1 67 ASP n 1 68 ASP n 1 69 GLN n 1 70 VAL n 1 71 ALA n 1 72 LEU n 1 73 LEU n 1 74 ARG n 1 75 ALA n 1 76 HIS n 1 77 ALA n 1 78 GLY n 1 79 GLU n 1 80 HIS n 1 81 LEU n 1 82 LEU n 1 83 LEU n 1 84 GLY n 1 85 ALA n 1 86 THR n 1 87 LYS n 1 88 ARG n 1 89 SER n 1 90 MET n 1 91 VAL n 1 92 PHE n 1 93 LYS n 1 94 ASP n 1 95 VAL n 1 96 LEU n 1 97 LEU n 1 98 LEU n 1 99 GLY n 1 100 ASN n 1 101 ASP n 1 102 TYR n 1 103 ILE n 1 104 VAL n 1 105 PRO n 1 106 ARG n 1 107 HIS n 1 108 CYS n 1 109 PRO n 1 110 GLU n 1 111 LEU n 1 112 ALA n 1 113 GLU n 1 114 MET n 1 115 SER n 1 116 ARG n 1 117 VAL n 1 118 SER n 1 119 ILE n 1 120 ARG n 1 121 ILE n 1 122 LEU n 1 123 ASP n 1 124 GLU n 1 125 LEU n 1 126 VAL n 1 127 LEU n 1 128 PRO n 1 129 PHE n 1 130 GLN n 1 131 GLU n 1 132 LEU n 1 133 GLN n 1 134 ILE n 1 135 ASP n 1 136 ASP n 1 137 ASN n 1 138 GLU n 1 139 TYR n 1 140 ALA n 1 141 TYR n 1 142 LEU n 1 143 LYS n 1 144 ALA n 1 145 ILE n 1 146 ILE n 1 147 PHE n 1 148 PHE n 1 149 ASP n 1 150 PRO n 1 151 ASP n 1 152 ALA n 1 153 LYS n 1 154 GLY n 1 155 LEU n 1 156 SER n 1 157 ASP n 1 158 PRO n 1 159 GLY n 1 160 LYS n 1 161 ILE n 1 162 LYS n 1 163 ARG n 1 164 LEU n 1 165 ARG n 1 166 SER n 1 167 GLN n 1 168 VAL n 1 169 GLN n 1 170 VAL n 1 171 SER n 1 172 LEU n 1 173 GLU n 1 174 ASP n 1 175 TYR n 1 176 ILE n 1 177 ASN n 1 178 ASP n 1 179 ARG n 1 180 GLN n 1 181 TYR n 1 182 ASP n 1 183 SER n 1 184 ARG n 1 185 GLY n 1 186 ARG n 1 187 PHE n 1 188 GLY n 1 189 GLU n 1 190 LEU n 1 191 LEU n 1 192 LEU n 1 193 LEU n 1 194 LEU n 1 195 PRO n 1 196 THR n 1 197 LEU n 1 198 GLN n 1 199 SER n 1 200 ILE n 1 201 THR n 1 202 TRP n 1 203 GLN n 1 204 MET n 1 205 ILE n 1 206 GLU n 1 207 GLN n 1 208 ILE n 1 209 GLN n 1 210 PHE n 1 211 ILE n 1 212 LYS n 1 213 LEU n 1 214 PHE n 1 215 GLY n 1 216 MET n 1 217 ALA n 1 218 LYS n 1 219 ILE n 1 220 ASP n 1 221 ASN n 1 222 LEU n 1 223 LEU n 1 224 GLN n 1 225 GLU n 1 226 MET n 1 227 LEU n 1 228 LEU n 1 229 GLY n 1 230 GLY n 2 1 HIS n 2 2 LYS n 2 3 ILE n 2 4 LEU n 2 5 HIS n 2 6 ARG n 2 7 LEU n 2 8 LEU n 2 9 GLN n 2 10 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 230 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'HNF4A, HNF4, NR2A1, TCF14' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 10 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1I1W non-polymer . '2-hydroxy-5-(phenylethynyl)benzoic acid' ? 'C15 H9 O3 -1' 237.230 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 139 139 SER SER A . n A 1 2 LEU 2 140 140 LEU LEU A . n A 1 3 PRO 3 141 141 PRO PRO A . n A 1 4 SER 4 142 142 SER SER A . n A 1 5 ILE 5 143 143 ILE ILE A . n A 1 6 ASN 6 144 144 ASN ASN A . n A 1 7 ALA 7 145 145 ALA ALA A . n A 1 8 LEU 8 146 146 LEU LEU A . n A 1 9 LEU 9 147 147 LEU LEU A . n A 1 10 GLN 10 148 148 GLN GLN A . n A 1 11 ALA 11 149 149 ALA ALA A . n A 1 12 GLU 12 150 150 GLU GLU A . n A 1 13 VAL 13 151 151 VAL VAL A . n A 1 14 LEU 14 152 152 LEU LEU A . n A 1 15 SER 15 153 153 SER SER A . n A 1 16 ARG 16 154 154 ARG ARG A . n A 1 17 GLN 17 155 155 GLN GLN A . n A 1 18 ILE 18 156 156 ILE ILE A . n A 1 19 THR 19 157 157 THR THR A . n A 1 20 SER 20 158 158 SER SER A . n A 1 21 PRO 21 159 159 PRO PRO A . n A 1 22 VAL 22 160 160 VAL VAL A . n A 1 23 SER 23 161 161 SER SER A . n A 1 24 GLY 24 162 162 GLY GLY A . n A 1 25 ILE 25 163 163 ILE ILE A . n A 1 26 ASN 26 164 164 ASN ASN A . n A 1 27 GLY 27 165 165 GLY GLY A . n A 1 28 ASP 28 166 166 ASP ASP A . n A 1 29 ILE 29 167 ? ? ? A . n A 1 30 ARG 30 168 168 ARG ARG A . n A 1 31 ALA 31 169 169 ALA ALA A . n A 1 32 LYS 32 170 170 LYS LYS A . n A 1 33 LYS 33 171 171 LYS LYS A . n A 1 34 ILE 34 172 172 ILE ILE A . n A 1 35 ALA 35 173 173 ALA ALA A . n A 1 36 SER 36 174 174 SER SER A . n A 1 37 ILE 37 175 175 ILE ILE A . n A 1 38 ALA 38 176 176 ALA ALA A . n A 1 39 ASP 39 177 177 ASP ASP A . n A 1 40 VAL 40 178 178 VAL VAL A . n A 1 41 CYS 41 179 179 CYS CYS A . n A 1 42 GLU 42 180 180 GLU GLU A . n A 1 43 SER 43 181 181 SER SER A . n A 1 44 MET 44 182 182 MET MET A . n A 1 45 LYS 45 183 183 LYS LYS A . n A 1 46 GLU 46 184 184 GLU GLU A . n A 1 47 GLN 47 185 185 GLN GLN A . n A 1 48 LEU 48 186 186 LEU LEU A . n A 1 49 LEU 49 187 187 LEU LEU A . n A 1 50 VAL 50 188 188 VAL VAL A . n A 1 51 LEU 51 189 189 LEU LEU A . n A 1 52 VAL 52 190 190 VAL VAL A . n A 1 53 GLU 53 191 191 GLU GLU A . n A 1 54 TRP 54 192 192 TRP TRP A . n A 1 55 ALA 55 193 193 ALA ALA A . n A 1 56 LYS 56 194 194 LYS LYS A . n A 1 57 TYR 57 195 195 TYR TYR A . n A 1 58 ILE 58 196 196 ILE ILE A . n A 1 59 PRO 59 197 197 PRO PRO A . n A 1 60 ALA 60 198 198 ALA ALA A . n A 1 61 PHE 61 199 199 PHE PHE A . n A 1 62 CYS 62 200 200 CYS CYS A . n A 1 63 GLU 63 201 201 GLU GLU A . n A 1 64 LEU 64 202 202 LEU LEU A . n A 1 65 PRO 65 203 203 PRO PRO A . n A 1 66 LEU 66 204 204 LEU LEU A . n A 1 67 ASP 67 205 205 ASP ASP A . n A 1 68 ASP 68 206 206 ASP ASP A . n A 1 69 GLN 69 207 207 GLN GLN A . n A 1 70 VAL 70 208 208 VAL VAL A . n A 1 71 ALA 71 209 209 ALA ALA A . n A 1 72 LEU 72 210 210 LEU LEU A . n A 1 73 LEU 73 211 211 LEU LEU A . n A 1 74 ARG 74 212 212 ARG ARG A . n A 1 75 ALA 75 213 213 ALA ALA A . n A 1 76 HIS 76 214 214 HIS HIS A . n A 1 77 ALA 77 215 215 ALA ALA A . n A 1 78 GLY 78 216 216 GLY GLY A . n A 1 79 GLU 79 217 217 GLU GLU A . n A 1 80 HIS 80 218 218 HIS HIS A . n A 1 81 LEU 81 219 219 LEU LEU A . n A 1 82 LEU 82 220 220 LEU LEU A . n A 1 83 LEU 83 221 221 LEU LEU A . n A 1 84 GLY 84 222 222 GLY GLY A . n A 1 85 ALA 85 223 223 ALA ALA A . n A 1 86 THR 86 224 224 THR THR A . n A 1 87 LYS 87 225 225 LYS LYS A . n A 1 88 ARG 88 226 226 ARG ARG A . n A 1 89 SER 89 227 227 SER SER A . n A 1 90 MET 90 228 228 MET MET A . n A 1 91 VAL 91 229 229 VAL VAL A . n A 1 92 PHE 92 230 230 PHE PHE A . n A 1 93 LYS 93 231 231 LYS LYS A . n A 1 94 ASP 94 232 232 ASP ASP A . n A 1 95 VAL 95 233 233 VAL VAL A . n A 1 96 LEU 96 234 234 LEU LEU A . n A 1 97 LEU 97 235 235 LEU LEU A . n A 1 98 LEU 98 236 236 LEU LEU A . n A 1 99 GLY 99 237 237 GLY GLY A . n A 1 100 ASN 100 238 238 ASN ASN A . n A 1 101 ASP 101 239 239 ASP ASP A . n A 1 102 TYR 102 240 240 TYR TYR A . n A 1 103 ILE 103 241 241 ILE ILE A . n A 1 104 VAL 104 242 242 VAL VAL A . n A 1 105 PRO 105 243 243 PRO PRO A . n A 1 106 ARG 106 244 244 ARG ARG A . n A 1 107 HIS 107 245 245 HIS HIS A . n A 1 108 CYS 108 246 246 CYS CYS A . n A 1 109 PRO 109 247 247 PRO PRO A . n A 1 110 GLU 110 248 248 GLU GLU A . n A 1 111 LEU 111 249 249 LEU LEU A . n A 1 112 ALA 112 250 250 ALA ALA A . n A 1 113 GLU 113 251 251 GLU GLU A . n A 1 114 MET 114 252 252 MET MET A . n A 1 115 SER 115 253 253 SER SER A . n A 1 116 ARG 116 254 254 ARG ARG A . n A 1 117 VAL 117 255 255 VAL VAL A . n A 1 118 SER 118 256 256 SER SER A . n A 1 119 ILE 119 257 257 ILE ILE A . n A 1 120 ARG 120 258 258 ARG ARG A . n A 1 121 ILE 121 259 259 ILE ILE A . n A 1 122 LEU 122 260 260 LEU LEU A . n A 1 123 ASP 123 261 261 ASP ASP A . n A 1 124 GLU 124 262 262 GLU GLU A . n A 1 125 LEU 125 263 263 LEU LEU A . n A 1 126 VAL 126 264 264 VAL VAL A . n A 1 127 LEU 127 265 265 LEU LEU A . n A 1 128 PRO 128 266 266 PRO PRO A . n A 1 129 PHE 129 267 267 PHE PHE A . n A 1 130 GLN 130 268 268 GLN GLN A . n A 1 131 GLU 131 269 269 GLU GLU A . n A 1 132 LEU 132 270 270 LEU LEU A . n A 1 133 GLN 133 271 271 GLN GLN A . n A 1 134 ILE 134 272 272 ILE ILE A . n A 1 135 ASP 135 273 273 ASP ASP A . n A 1 136 ASP 136 274 274 ASP ASP A . n A 1 137 ASN 137 275 275 ASN ASN A . n A 1 138 GLU 138 276 276 GLU GLU A . n A 1 139 TYR 139 277 277 TYR TYR A . n A 1 140 ALA 140 278 278 ALA ALA A . n A 1 141 TYR 141 279 279 TYR TYR A . n A 1 142 LEU 142 280 280 LEU LEU A . n A 1 143 LYS 143 281 281 LYS LYS A . n A 1 144 ALA 144 282 282 ALA ALA A . n A 1 145 ILE 145 283 283 ILE ILE A . n A 1 146 ILE 146 284 284 ILE ILE A . n A 1 147 PHE 147 285 285 PHE PHE A . n A 1 148 PHE 148 286 286 PHE PHE A . n A 1 149 ASP 149 287 287 ASP ASP A . n A 1 150 PRO 150 288 288 PRO PRO A . n A 1 151 ASP 151 289 289 ASP ASP A . n A 1 152 ALA 152 290 290 ALA ALA A . n A 1 153 LYS 153 291 291 LYS LYS A . n A 1 154 GLY 154 292 292 GLY GLY A . n A 1 155 LEU 155 293 293 LEU LEU A . n A 1 156 SER 156 294 294 SER SER A . n A 1 157 ASP 157 295 295 ASP ASP A . n A 1 158 PRO 158 296 296 PRO PRO A . n A 1 159 GLY 159 297 297 GLY GLY A . n A 1 160 LYS 160 298 298 LYS LYS A . n A 1 161 ILE 161 299 299 ILE ILE A . n A 1 162 LYS 162 300 300 LYS LYS A . n A 1 163 ARG 163 301 301 ARG ARG A . n A 1 164 LEU 164 302 302 LEU LEU A . n A 1 165 ARG 165 303 303 ARG ARG A . n A 1 166 SER 166 304 304 SER SER A . n A 1 167 GLN 167 305 305 GLN GLN A . n A 1 168 VAL 168 306 306 VAL VAL A . n A 1 169 GLN 169 307 307 GLN GLN A . n A 1 170 VAL 170 308 308 VAL VAL A . n A 1 171 SER 171 309 309 SER SER A . n A 1 172 LEU 172 310 310 LEU LEU A . n A 1 173 GLU 173 311 311 GLU GLU A . n A 1 174 ASP 174 312 312 ASP ASP A . n A 1 175 TYR 175 313 313 TYR TYR A . n A 1 176 ILE 176 314 314 ILE ILE A . n A 1 177 ASN 177 315 315 ASN ASN A . n A 1 178 ASP 178 316 316 ASP ASP A . n A 1 179 ARG 179 317 317 ARG ARG A . n A 1 180 GLN 180 318 318 GLN GLN A . n A 1 181 TYR 181 319 319 TYR TYR A . n A 1 182 ASP 182 320 ? ? ? A . n A 1 183 SER 183 321 321 SER SER A . n A 1 184 ARG 184 322 322 ARG ARG A . n A 1 185 GLY 185 323 323 GLY GLY A . n A 1 186 ARG 186 324 324 ARG ARG A . n A 1 187 PHE 187 325 325 PHE PHE A . n A 1 188 GLY 188 326 326 GLY GLY A . n A 1 189 GLU 189 327 327 GLU GLU A . n A 1 190 LEU 190 328 328 LEU LEU A . n A 1 191 LEU 191 329 329 LEU LEU A . n A 1 192 LEU 192 330 330 LEU LEU A . n A 1 193 LEU 193 331 331 LEU LEU A . n A 1 194 LEU 194 332 332 LEU LEU A . n A 1 195 PRO 195 333 333 PRO PRO A . n A 1 196 THR 196 334 334 THR THR A . n A 1 197 LEU 197 335 335 LEU LEU A . n A 1 198 GLN 198 336 336 GLN GLN A . n A 1 199 SER 199 337 337 SER SER A . n A 1 200 ILE 200 338 338 ILE ILE A . n A 1 201 THR 201 339 339 THR THR A . n A 1 202 TRP 202 340 340 TRP TRP A . n A 1 203 GLN 203 341 341 GLN GLN A . n A 1 204 MET 204 342 342 MET MET A . n A 1 205 ILE 205 343 343 ILE ILE A . n A 1 206 GLU 206 344 344 GLU GLU A . n A 1 207 GLN 207 345 345 GLN GLN A . n A 1 208 ILE 208 346 346 ILE ILE A . n A 1 209 GLN 209 347 347 GLN GLN A . n A 1 210 PHE 210 348 348 PHE PHE A . n A 1 211 ILE 211 349 349 ILE ILE A . n A 1 212 LYS 212 350 350 LYS LYS A . n A 1 213 LEU 213 351 351 LEU LEU A . n A 1 214 PHE 214 352 352 PHE PHE A . n A 1 215 GLY 215 353 353 GLY GLY A . n A 1 216 MET 216 354 354 MET MET A . n A 1 217 ALA 217 355 355 ALA ALA A . n A 1 218 LYS 218 356 ? ? ? A . n A 1 219 ILE 219 357 357 ILE ILE A . n A 1 220 ASP 220 358 358 ASP ASP A . n A 1 221 ASN 221 359 359 ASN ASN A . n A 1 222 LEU 222 360 360 LEU LEU A . n A 1 223 LEU 223 361 361 LEU LEU A . n A 1 224 GLN 224 362 362 GLN GLN A . n A 1 225 GLU 225 363 363 GLU GLU A . n A 1 226 MET 226 364 364 MET MET A . n A 1 227 LEU 227 365 365 LEU LEU A . n A 1 228 LEU 228 366 366 LEU LEU A . n A 1 229 GLY 229 367 367 GLY GLY A . n A 1 230 GLY 230 368 368 GLY GLY A . n B 2 1 HIS 1 7 ? ? ? B . n B 2 2 LYS 2 8 8 LYS LYS B . n B 2 3 ILE 3 9 9 ILE ILE B . n B 2 4 LEU 4 10 10 LEU LEU B . n B 2 5 HIS 5 11 11 HIS HIS B . n B 2 6 ARG 6 12 12 ARG ARG B . n B 2 7 LEU 7 13 13 LEU LEU B . n B 2 8 LEU 8 14 14 LEU LEU B . n B 2 9 GLN 9 15 ? ? ? B . n B 2 10 ASP 10 16 ? ? ? B . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1I1W _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1I1W _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_nonpoly_scheme.asym_id C _pdbx_nonpoly_scheme.entity_id 3 _pdbx_nonpoly_scheme.mon_id A1I1W _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 401 _pdbx_nonpoly_scheme.auth_seq_num 401 _pdbx_nonpoly_scheme.pdb_mon_id A1I1W _pdbx_nonpoly_scheme.auth_mon_id T72 _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ILE 143 ? CG1 ? A ILE 5 CG1 2 1 Y 1 A ILE 143 ? CG2 ? A ILE 5 CG2 3 1 Y 1 A ILE 143 ? CD1 ? A ILE 5 CD1 4 1 Y 1 A LEU 147 ? CG ? A LEU 9 CG 5 1 Y 1 A LEU 147 ? CD1 ? A LEU 9 CD1 6 1 Y 1 A LEU 147 ? CD2 ? A LEU 9 CD2 7 1 Y 1 A GLN 148 ? CG ? A GLN 10 CG 8 1 Y 1 A GLN 148 ? CD ? A GLN 10 CD 9 1 Y 1 A GLN 148 ? OE1 ? A GLN 10 OE1 10 1 Y 1 A GLN 148 ? NE2 ? A GLN 10 NE2 11 1 Y 1 A VAL 151 ? CG1 ? A VAL 13 CG1 12 1 Y 1 A VAL 151 ? CG2 ? A VAL 13 CG2 13 1 Y 1 A ARG 154 ? CG ? A ARG 16 CG 14 1 Y 1 A ARG 154 ? CD ? A ARG 16 CD 15 1 Y 1 A ARG 154 ? NE ? A ARG 16 NE 16 1 Y 1 A ARG 154 ? CZ ? A ARG 16 CZ 17 1 Y 1 A ARG 154 ? NH1 ? A ARG 16 NH1 18 1 Y 1 A ARG 154 ? NH2 ? A ARG 16 NH2 19 1 Y 1 A SER 161 ? OG ? A SER 23 OG 20 1 Y 1 A ILE 163 ? CG1 ? A ILE 25 CG1 21 1 Y 1 A ILE 163 ? CG2 ? A ILE 25 CG2 22 1 Y 1 A ILE 163 ? CD1 ? A ILE 25 CD1 23 1 Y 1 A ARG 168 ? CG ? A ARG 30 CG 24 1 Y 1 A ARG 168 ? CD ? A ARG 30 CD 25 1 Y 1 A ARG 168 ? NE ? A ARG 30 NE 26 1 Y 1 A ARG 168 ? CZ ? A ARG 30 CZ 27 1 Y 1 A ARG 168 ? NH1 ? A ARG 30 NH1 28 1 Y 1 A ARG 168 ? NH2 ? A ARG 30 NH2 29 1 Y 1 A LYS 170 ? CG ? A LYS 32 CG 30 1 Y 1 A LYS 170 ? CD ? A LYS 32 CD 31 1 Y 1 A LYS 170 ? CE ? A LYS 32 CE 32 1 Y 1 A LYS 170 ? NZ ? A LYS 32 NZ 33 1 Y 1 A ASP 177 ? CG ? A ASP 39 CG 34 1 Y 1 A ASP 177 ? OD1 ? A ASP 39 OD1 35 1 Y 1 A ASP 177 ? OD2 ? A ASP 39 OD2 36 1 Y 1 A TYR 195 ? CG ? A TYR 57 CG 37 1 Y 1 A TYR 195 ? CD1 ? A TYR 57 CD1 38 1 Y 1 A TYR 195 ? CD2 ? A TYR 57 CD2 39 1 Y 1 A TYR 195 ? CE1 ? A TYR 57 CE1 40 1 Y 1 A TYR 195 ? CE2 ? A TYR 57 CE2 41 1 Y 1 A TYR 195 ? CZ ? A TYR 57 CZ 42 1 Y 1 A TYR 195 ? OH ? A TYR 57 OH 43 1 Y 1 A ILE 196 ? CG1 ? A ILE 58 CG1 44 1 Y 1 A ILE 196 ? CG2 ? A ILE 58 CG2 45 1 Y 1 A ILE 196 ? CD1 ? A ILE 58 CD1 46 1 Y 1 A PRO 197 ? CG ? A PRO 59 CG 47 1 Y 1 A PRO 197 ? CD ? A PRO 59 CD 48 1 Y 1 A LEU 202 ? CG ? A LEU 64 CG 49 1 Y 1 A LEU 202 ? CD1 ? A LEU 64 CD1 50 1 Y 1 A LEU 202 ? CD2 ? A LEU 64 CD2 51 1 Y 1 A GLN 207 ? CG ? A GLN 69 CG 52 1 Y 1 A GLN 207 ? CD ? A GLN 69 CD 53 1 Y 1 A GLN 207 ? OE1 ? A GLN 69 OE1 54 1 Y 1 A GLN 207 ? NE2 ? A GLN 69 NE2 55 1 Y 1 A VAL 233 ? CG1 ? A VAL 95 CG1 56 1 Y 1 A VAL 233 ? CG2 ? A VAL 95 CG2 57 1 Y 1 A ASN 238 ? CG ? A ASN 100 CG 58 1 Y 1 A ASN 238 ? OD1 ? A ASN 100 OD1 59 1 Y 1 A ASN 238 ? ND2 ? A ASN 100 ND2 60 1 Y 1 A HIS 245 ? CG ? A HIS 107 CG 61 1 Y 1 A HIS 245 ? ND1 ? A HIS 107 ND1 62 1 Y 1 A HIS 245 ? CD2 ? A HIS 107 CD2 63 1 Y 1 A HIS 245 ? CE1 ? A HIS 107 CE1 64 1 Y 1 A HIS 245 ? NE2 ? A HIS 107 NE2 65 1 Y 1 A CYS 246 ? SG ? A CYS 108 SG 66 1 Y 1 A LEU 260 ? CG ? A LEU 122 CG 67 1 Y 1 A LEU 260 ? CD1 ? A LEU 122 CD1 68 1 Y 1 A LEU 260 ? CD2 ? A LEU 122 CD2 69 1 Y 1 A GLU 262 ? CG ? A GLU 124 CG 70 1 Y 1 A GLU 262 ? CD ? A GLU 124 CD 71 1 Y 1 A GLU 262 ? OE1 ? A GLU 124 OE1 72 1 Y 1 A GLU 262 ? OE2 ? A GLU 124 OE2 73 1 Y 1 A VAL 264 ? CG1 ? A VAL 126 CG1 74 1 Y 1 A VAL 264 ? CG2 ? A VAL 126 CG2 75 1 Y 1 A LEU 265 ? CG ? A LEU 127 CG 76 1 Y 1 A LEU 265 ? CD1 ? A LEU 127 CD1 77 1 Y 1 A LEU 265 ? CD2 ? A LEU 127 CD2 78 1 Y 1 A ILE 272 ? CG1 ? A ILE 134 CG1 79 1 Y 1 A ILE 272 ? CG2 ? A ILE 134 CG2 80 1 Y 1 A ILE 272 ? CD1 ? A ILE 134 CD1 81 1 Y 1 A ASP 273 ? CG ? A ASP 135 CG 82 1 Y 1 A ASP 273 ? OD1 ? A ASP 135 OD1 83 1 Y 1 A ASP 273 ? OD2 ? A ASP 135 OD2 84 1 Y 1 A ASP 274 ? CG ? A ASP 136 CG 85 1 Y 1 A ASP 274 ? OD1 ? A ASP 136 OD1 86 1 Y 1 A ASP 274 ? OD2 ? A ASP 136 OD2 87 1 Y 1 A ASN 275 ? CG ? A ASN 137 CG 88 1 Y 1 A ASN 275 ? OD1 ? A ASN 137 OD1 89 1 Y 1 A ASN 275 ? ND2 ? A ASN 137 ND2 90 1 Y 1 A ASP 295 ? CG ? A ASP 157 CG 91 1 Y 1 A ASP 295 ? OD1 ? A ASP 157 OD1 92 1 Y 1 A ASP 295 ? OD2 ? A ASP 157 OD2 93 1 Y 1 A LYS 298 ? CG ? A LYS 160 CG 94 1 Y 1 A LYS 298 ? CD ? A LYS 160 CD 95 1 Y 1 A LYS 298 ? CE ? A LYS 160 CE 96 1 Y 1 A LYS 298 ? NZ ? A LYS 160 NZ 97 1 Y 1 A GLN 305 ? CG ? A GLN 167 CG 98 1 Y 1 A GLN 305 ? CD ? A GLN 167 CD 99 1 Y 1 A GLN 305 ? OE1 ? A GLN 167 OE1 100 1 Y 1 A GLN 305 ? NE2 ? A GLN 167 NE2 101 1 Y 1 A VAL 308 ? CG1 ? A VAL 170 CG1 102 1 Y 1 A VAL 308 ? CG2 ? A VAL 170 CG2 103 1 Y 1 A LEU 310 ? CG ? A LEU 172 CG 104 1 Y 1 A LEU 310 ? CD1 ? A LEU 172 CD1 105 1 Y 1 A LEU 310 ? CD2 ? A LEU 172 CD2 106 1 Y 1 A ILE 314 ? CG1 ? A ILE 176 CG1 107 1 Y 1 A ILE 314 ? CG2 ? A ILE 176 CG2 108 1 Y 1 A ILE 314 ? CD1 ? A ILE 176 CD1 109 1 Y 1 A TYR 319 ? CG ? A TYR 181 CG 110 1 Y 1 A TYR 319 ? CD1 ? A TYR 181 CD1 111 1 Y 1 A TYR 319 ? CD2 ? A TYR 181 CD2 112 1 Y 1 A TYR 319 ? CE1 ? A TYR 181 CE1 113 1 Y 1 A TYR 319 ? CE2 ? A TYR 181 CE2 114 1 Y 1 A TYR 319 ? CZ ? A TYR 181 CZ 115 1 Y 1 A TYR 319 ? OH ? A TYR 181 OH 116 1 Y 1 A ARG 324 ? CG ? A ARG 186 CG 117 1 Y 1 A ARG 324 ? CD ? A ARG 186 CD 118 1 Y 1 A ARG 324 ? NE ? A ARG 186 NE 119 1 Y 1 A ARG 324 ? CZ ? A ARG 186 CZ 120 1 Y 1 A ARG 324 ? NH1 ? A ARG 186 NH1 121 1 Y 1 A ARG 324 ? NH2 ? A ARG 186 NH2 122 1 Y 1 A LEU 330 ? CG ? A LEU 192 CG 123 1 Y 1 A LEU 330 ? CD1 ? A LEU 192 CD1 124 1 Y 1 A LEU 330 ? CD2 ? A LEU 192 CD2 125 1 Y 1 A TRP 340 ? CG ? A TRP 202 CG 126 1 Y 1 A TRP 340 ? CD1 ? A TRP 202 CD1 127 1 Y 1 A TRP 340 ? CD2 ? A TRP 202 CD2 128 1 Y 1 A TRP 340 ? NE1 ? A TRP 202 NE1 129 1 Y 1 A TRP 340 ? CE2 ? A TRP 202 CE2 130 1 Y 1 A TRP 340 ? CE3 ? A TRP 202 CE3 131 1 Y 1 A TRP 340 ? CZ2 ? A TRP 202 CZ2 132 1 Y 1 A TRP 340 ? CZ3 ? A TRP 202 CZ3 133 1 Y 1 A TRP 340 ? CH2 ? A TRP 202 CH2 134 1 Y 1 A GLN 341 ? CG ? A GLN 203 CG 135 1 Y 1 A GLN 341 ? CD ? A GLN 203 CD 136 1 Y 1 A GLN 341 ? OE1 ? A GLN 203 OE1 137 1 Y 1 A GLN 341 ? NE2 ? A GLN 203 NE2 138 1 Y 1 A PHE 348 ? CG ? A PHE 210 CG 139 1 Y 1 A PHE 348 ? CD1 ? A PHE 210 CD1 140 1 Y 1 A PHE 348 ? CD2 ? A PHE 210 CD2 141 1 Y 1 A PHE 348 ? CE1 ? A PHE 210 CE1 142 1 Y 1 A PHE 348 ? CE2 ? A PHE 210 CE2 143 1 Y 1 A PHE 348 ? CZ ? A PHE 210 CZ 144 1 Y 1 A PHE 352 ? CG ? A PHE 214 CG 145 1 Y 1 A PHE 352 ? CD1 ? A PHE 214 CD1 146 1 Y 1 A PHE 352 ? CD2 ? A PHE 214 CD2 147 1 Y 1 A PHE 352 ? CE1 ? A PHE 214 CE1 148 1 Y 1 A PHE 352 ? CE2 ? A PHE 214 CE2 149 1 Y 1 A PHE 352 ? CZ ? A PHE 214 CZ 150 1 Y 1 A GLN 362 ? CG ? A GLN 224 CG 151 1 Y 1 A GLN 362 ? CD ? A GLN 224 CD 152 1 Y 1 A GLN 362 ? OE1 ? A GLN 224 OE1 153 1 Y 1 A GLN 362 ? NE2 ? A GLN 224 NE2 154 1 Y 1 A GLU 363 ? CG ? A GLU 225 CG 155 1 Y 1 A GLU 363 ? CD ? A GLU 225 CD 156 1 Y 1 A GLU 363 ? OE1 ? A GLU 225 OE1 157 1 Y 1 A GLU 363 ? OE2 ? A GLU 225 OE2 158 1 Y 1 B LYS 8 ? CG ? B LYS 2 CG 159 1 Y 1 B LYS 8 ? CD ? B LYS 2 CD 160 1 Y 1 B LYS 8 ? CE ? B LYS 2 CE 161 1 Y 1 B LYS 8 ? NZ ? B LYS 2 NZ 162 1 Y 1 B ILE 9 ? CG1 ? B ILE 3 CG1 163 1 Y 1 B ILE 9 ? CG2 ? B ILE 3 CG2 164 1 Y 1 B ILE 9 ? CD1 ? B ILE 3 CD1 165 1 Y 1 B LEU 10 ? CG ? B LEU 4 CG 166 1 Y 1 B LEU 10 ? CD1 ? B LEU 4 CD1 167 1 Y 1 B LEU 10 ? CD2 ? B LEU 4 CD2 168 1 Y 1 B HIS 11 ? CG ? B HIS 5 CG 169 1 Y 1 B HIS 11 ? ND1 ? B HIS 5 ND1 170 1 Y 1 B HIS 11 ? CD2 ? B HIS 5 CD2 171 1 Y 1 B HIS 11 ? CE1 ? B HIS 5 CE1 172 1 Y 1 B HIS 11 ? NE2 ? B HIS 5 NE2 173 1 Y 1 B ARG 12 ? CG ? B ARG 6 CG 174 1 Y 1 B ARG 12 ? CD ? B ARG 6 CD 175 1 Y 1 B ARG 12 ? NE ? B ARG 6 NE 176 1 Y 1 B ARG 12 ? CZ ? B ARG 6 CZ 177 1 Y 1 B ARG 12 ? NH1 ? B ARG 6 NH1 178 1 Y 1 B ARG 12 ? NH2 ? B ARG 6 NH2 179 1 Y 1 B LEU 14 ? CG ? B LEU 8 CG 180 1 Y 1 B LEU 14 ? CD1 ? B LEU 8 CD1 181 1 Y 1 B LEU 14 ? CD2 ? B LEU 8 CD2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.21.1_5286 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? STARANISO ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 5 ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . 6 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 9IBR _cell.details ? _cell.formula_units_Z ? _cell.length_a 87.769 _cell.length_a_esd ? _cell.length_b 87.769 _cell.length_b_esd ? _cell.length_c 62.884 _cell.length_c_esd ? _cell.volume 484420.440 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9IBR _symmetry.cell_setting ? _symmetry.Int_Tables_number 94 _symmetry.space_group_name_Hall 'P 4n 2n' _symmetry.space_group_name_H-M 'P 42 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9IBR _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.22 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.61 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;16% PEG3350 8% ethylene glycol 0.1M bis-tris-propane pH 8.5 - ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 289 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2025-02-02 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.8731 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.8731 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-2 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9IBR _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.13 _reflns.d_resolution_low 51.12 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 4630 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 92.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.69 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.777 _reflns_shell.d_res_low 3.031 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 231 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.103 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 70.54 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9IBR _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.78 _refine.ls_d_res_low 51.12 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 4629 _refine.ls_number_reflns_R_free 245 _refine.ls_number_reflns_R_work 4384 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 70.21 _refine.ls_percent_reflns_R_free 5.29 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2923 _refine.ls_R_factor_R_free 0.3546 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2898 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 30.8201 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4001 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.78 _refine_hist.d_res_low 51.12 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1699 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1681 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 18 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0121 ? 1718 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.5223 ? 2327 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0777 ? 281 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0094 ? 301 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 18.8319 ? 604 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.78 3.50 . . 80 1170 38.92 . . . . 0.3627 . . . . . . . . . . . 0.3931 'X-RAY DIFFRACTION' 3.50 51.12 . . 165 3214 99.94 . . . . 0.2784 . . . . . . . . . . . 0.3477 # _struct.entry_id 9IBR _struct.title 'Crystal structure of HNF4 alpha LBD complexed with GRIP-1 peptide and ESY13' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9IBR _struct_keywords.text 'Hepatocyte nuclear factor 4-alpha, Nuclear receptor, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP HNF4A_HUMAN P41235 ? 1 ;SLPSINALLQAEVLSRQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEH LLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGK IKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGG ; 148 2 PDB 9IBR 9IBR ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 9IBR A 1 ? 230 ? P41235 148 ? 377 ? 139 368 2 2 9IBR B 1 ? 10 ? 9IBR 7 ? 16 ? 7 16 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C 1 2 A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_556 -y,-x,-z+1 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 62.8840000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 4 ? ARG A 16 ? SER A 142 ARG A 154 1 ? 13 HELX_P HELX_P2 AA2 SER A 36 ? TYR A 57 ? SER A 174 TYR A 195 1 ? 22 HELX_P HELX_P3 AA3 ILE A 58 ? GLU A 63 ? ILE A 196 GLU A 201 1 ? 6 HELX_P HELX_P4 AA4 PRO A 65 ? ALA A 75 ? PRO A 203 ALA A 213 1 ? 11 HELX_P HELX_P5 AA5 HIS A 76 ? MET A 90 ? HIS A 214 MET A 228 1 ? 15 HELX_P HELX_P6 AA6 LEU A 111 ? GLU A 113 ? LEU A 249 GLU A 251 5 ? 3 HELX_P HELX_P7 AA7 MET A 114 ? GLU A 124 ? MET A 252 GLU A 262 1 ? 11 HELX_P HELX_P8 AA8 LEU A 125 ? GLN A 133 ? LEU A 263 GLN A 271 1 ? 9 HELX_P HELX_P9 AA9 ASP A 135 ? PHE A 148 ? ASP A 273 PHE A 286 1 ? 14 HELX_P HELX_P10 AB1 ASP A 157 ? ASP A 178 ? ASP A 295 ASP A 316 1 ? 22 HELX_P HELX_P11 AB2 GLY A 185 ? LEU A 192 ? GLY A 323 LEU A 330 1 ? 8 HELX_P HELX_P12 AB3 LEU A 193 ? PHE A 214 ? LEU A 331 PHE A 352 1 ? 22 HELX_P HELX_P13 AB4 ASP A 220 ? LEU A 227 ? ASP A 358 LEU A 365 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 95 ? LEU A 97 ? VAL A 233 LEU A 235 AA1 2 ILE A 103 ? PRO A 105 ? ILE A 241 PRO A 243 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id LEU _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 96 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id LEU _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 234 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id VAL _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 104 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 242 # _pdbx_entry_details.entry_id 9IBR _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 NE2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 GLN _pdbx_validate_symm_contact.auth_seq_id_1 336 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 NE2 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 GLN _pdbx_validate_symm_contact.auth_seq_id_2 336 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 8_556 _pdbx_validate_symm_contact.dist 1.79 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 154 ? ? -72.95 30.69 2 1 LYS A 194 ? ? -53.62 -8.78 3 1 PRO A 197 ? ? -47.37 -70.91 4 1 HIS A 214 ? ? -156.96 30.73 5 1 ASP A 232 ? ? 80.45 29.12 6 1 ASP A 239 ? ? 81.40 11.05 7 1 HIS A 245 ? ? -63.96 96.33 8 1 ALA A 250 ? ? 52.82 -124.12 9 1 LEU A 263 ? ? -132.20 -40.16 10 1 GLN A 271 ? ? 61.35 83.56 11 1 ASP A 295 ? ? -117.06 67.24 12 1 LEU A 366 ? ? -72.62 20.34 13 1 LEU B 10 ? ? 75.63 -36.76 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+1/2 3 y+1/2,-x+1/2,z+1/2 4 x+1/2,-y+1/2,-z+1/2 5 -x+1/2,y+1/2,-z+1/2 6 -x,-y,z 7 y,x,-z 8 -y,-x,-z # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ILE 167 ? A ILE 29 2 1 Y 1 A ASP 320 ? A ASP 182 3 1 Y 1 A LYS 356 ? A LYS 218 4 1 Y 1 B HIS 7 ? B HIS 1 5 1 Y 1 B GLN 15 ? B GLN 9 6 1 Y 1 B ASP 16 ? B ASP 10 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1I1W C11 C Y N 1 A1I1W C12 C Y N 2 A1I1W C14 C Y N 3 A1I1W C15 C N N 4 A1I1W C13 C Y N 5 A1I1W C5 C Y N 6 A1I1W C10 C Y N 7 A1I1W C9 C N N 8 A1I1W C8 C N N 9 A1I1W C7 C Y N 10 A1I1W C6 C Y N 11 A1I1W C01 C Y N 12 A1I1W C02 C Y N 13 A1I1W C03 C Y N 14 A1I1W C04 C Y N 15 A1I1W O16 O N N 16 A1I1W O17 O N N 17 A1I1W O18 O N N 18 A1I1W H11 H N N 19 A1I1W H14 H N N 20 A1I1W H71 H N N 21 A1I1W H61 H N N 22 A1I1W H01 H N N 23 A1I1W H02 H N N 24 A1I1W H03 H N N 25 A1I1W H04 H N N 26 A1I1W H18 H N N 27 ALA N N N N 28 ALA CA C N S 29 ALA C C N N 30 ALA O O N N 31 ALA CB C N N 32 ALA OXT O N N 33 ALA H H N N 34 ALA H2 H N N 35 ALA HA H N N 36 ALA HB1 H N N 37 ALA HB2 H N N 38 ALA HB3 H N N 39 ALA HXT H N N 40 ARG N N N N 41 ARG CA C N S 42 ARG C C N N 43 ARG O O N N 44 ARG CB C N N 45 ARG CG C N N 46 ARG CD C N N 47 ARG NE N N N 48 ARG CZ C N N 49 ARG NH1 N N N 50 ARG NH2 N N N 51 ARG OXT O N N 52 ARG H H N N 53 ARG H2 H N N 54 ARG HA H N N 55 ARG HB2 H N N 56 ARG HB3 H N N 57 ARG HG2 H N N 58 ARG HG3 H N N 59 ARG HD2 H N N 60 ARG HD3 H N N 61 ARG HE H N N 62 ARG HH11 H N N 63 ARG HH12 H N N 64 ARG HH21 H N N 65 ARG HH22 H N N 66 ARG HXT H N N 67 ASN N N N N 68 ASN CA C N S 69 ASN C C N N 70 ASN O O N N 71 ASN CB C N N 72 ASN CG C N N 73 ASN OD1 O N N 74 ASN ND2 N N N 75 ASN OXT O N N 76 ASN H H N N 77 ASN H2 H N N 78 ASN HA H N N 79 ASN HB2 H N N 80 ASN HB3 H N N 81 ASN HD21 H N N 82 ASN HD22 H N N 83 ASN HXT H N N 84 ASP N N N N 85 ASP CA C N S 86 ASP C C N N 87 ASP O O N N 88 ASP CB C N N 89 ASP CG C N N 90 ASP OD1 O N N 91 ASP OD2 O N N 92 ASP OXT O N N 93 ASP H H N N 94 ASP H2 H N N 95 ASP HA H N N 96 ASP HB2 H N N 97 ASP HB3 H N N 98 ASP HD2 H N N 99 ASP HXT H N N 100 CYS N N N N 101 CYS CA C N R 102 CYS C C N N 103 CYS O O N N 104 CYS CB C N N 105 CYS SG S N N 106 CYS OXT O N N 107 CYS H H N N 108 CYS H2 H N N 109 CYS HA H N N 110 CYS HB2 H N N 111 CYS HB3 H N N 112 CYS HG H N N 113 CYS HXT H N N 114 GLN N N N N 115 GLN CA C N S 116 GLN C C N N 117 GLN O O N N 118 GLN CB C N N 119 GLN CG C N N 120 GLN CD C N N 121 GLN OE1 O N N 122 GLN NE2 N N N 123 GLN OXT O N N 124 GLN H H N N 125 GLN H2 H N N 126 GLN HA H N N 127 GLN HB2 H N N 128 GLN HB3 H N N 129 GLN HG2 H N N 130 GLN HG3 H N N 131 GLN HE21 H N N 132 GLN HE22 H N N 133 GLN HXT H N N 134 GLU N N N N 135 GLU CA C N S 136 GLU C C N N 137 GLU O O N N 138 GLU CB C N N 139 GLU CG C N N 140 GLU CD C N N 141 GLU OE1 O N N 142 GLU OE2 O N N 143 GLU OXT O N N 144 GLU H H N N 145 GLU H2 H N N 146 GLU HA H N N 147 GLU HB2 H N N 148 GLU HB3 H N N 149 GLU HG2 H N N 150 GLU HG3 H N N 151 GLU HE2 H N N 152 GLU HXT H N N 153 GLY N N N N 154 GLY CA C N N 155 GLY C C N N 156 GLY O O N N 157 GLY OXT O N N 158 GLY H H N N 159 GLY H2 H N N 160 GLY HA2 H N N 161 GLY HA3 H N N 162 GLY HXT H N N 163 HIS N N N N 164 HIS CA C N S 165 HIS C C N N 166 HIS O O N N 167 HIS CB C N N 168 HIS CG C Y N 169 HIS ND1 N Y N 170 HIS CD2 C Y N 171 HIS CE1 C Y N 172 HIS NE2 N Y N 173 HIS OXT O N N 174 HIS H H N N 175 HIS H2 H N N 176 HIS HA H N N 177 HIS HB2 H N N 178 HIS HB3 H N N 179 HIS HD1 H N N 180 HIS HD2 H N N 181 HIS HE1 H N N 182 HIS HE2 H N N 183 HIS HXT H N N 184 ILE N N N N 185 ILE CA C N S 186 ILE C C N N 187 ILE O O N N 188 ILE CB C N S 189 ILE CG1 C N N 190 ILE CG2 C N N 191 ILE CD1 C N N 192 ILE OXT O N N 193 ILE H H N N 194 ILE H2 H N N 195 ILE HA H N N 196 ILE HB H N N 197 ILE HG12 H N N 198 ILE HG13 H N N 199 ILE HG21 H N N 200 ILE HG22 H N N 201 ILE HG23 H N N 202 ILE HD11 H N N 203 ILE HD12 H N N 204 ILE HD13 H N N 205 ILE HXT H N N 206 LEU N N N N 207 LEU CA C N S 208 LEU C C N N 209 LEU O O N N 210 LEU CB C N N 211 LEU CG C N N 212 LEU CD1 C N N 213 LEU CD2 C N N 214 LEU OXT O N N 215 LEU H H N N 216 LEU H2 H N N 217 LEU HA H N N 218 LEU HB2 H N N 219 LEU HB3 H N N 220 LEU HG H N N 221 LEU HD11 H N N 222 LEU HD12 H N N 223 LEU HD13 H N N 224 LEU HD21 H N N 225 LEU HD22 H N N 226 LEU HD23 H N N 227 LEU HXT H N N 228 LYS N N N N 229 LYS CA C N S 230 LYS C C N N 231 LYS O O N N 232 LYS CB C N N 233 LYS CG C N N 234 LYS CD C N N 235 LYS CE C N N 236 LYS NZ N N N 237 LYS OXT O N N 238 LYS H H N N 239 LYS H2 H N N 240 LYS HA H N N 241 LYS HB2 H N N 242 LYS HB3 H N N 243 LYS HG2 H N N 244 LYS HG3 H N N 245 LYS HD2 H N N 246 LYS HD3 H N N 247 LYS HE2 H N N 248 LYS HE3 H N N 249 LYS HZ1 H N N 250 LYS HZ2 H N N 251 LYS HZ3 H N N 252 LYS HXT H N N 253 MET N N N N 254 MET CA C N S 255 MET C C N N 256 MET O O N N 257 MET CB C N N 258 MET CG C N N 259 MET SD S N N 260 MET CE C N N 261 MET OXT O N N 262 MET H H N N 263 MET H2 H N N 264 MET HA H N N 265 MET HB2 H N N 266 MET HB3 H N N 267 MET HG2 H N N 268 MET HG3 H N N 269 MET HE1 H N N 270 MET HE2 H N N 271 MET HE3 H N N 272 MET HXT H N N 273 PHE N N N N 274 PHE CA C N S 275 PHE C C N N 276 PHE O O N N 277 PHE CB C N N 278 PHE CG C Y N 279 PHE CD1 C Y N 280 PHE CD2 C Y N 281 PHE CE1 C Y N 282 PHE CE2 C Y N 283 PHE CZ C Y N 284 PHE OXT O N N 285 PHE H H N N 286 PHE H2 H N N 287 PHE HA H N N 288 PHE HB2 H N N 289 PHE HB3 H N N 290 PHE HD1 H N N 291 PHE HD2 H N N 292 PHE HE1 H N N 293 PHE HE2 H N N 294 PHE HZ H N N 295 PHE HXT H N N 296 PRO N N N N 297 PRO CA C N S 298 PRO C C N N 299 PRO O O N N 300 PRO CB C N N 301 PRO CG C N N 302 PRO CD C N N 303 PRO OXT O N N 304 PRO H H N N 305 PRO HA H N N 306 PRO HB2 H N N 307 PRO HB3 H N N 308 PRO HG2 H N N 309 PRO HG3 H N N 310 PRO HD2 H N N 311 PRO HD3 H N N 312 PRO HXT H N N 313 SER N N N N 314 SER CA C N S 315 SER C C N N 316 SER O O N N 317 SER CB C N N 318 SER OG O N N 319 SER OXT O N N 320 SER H H N N 321 SER H2 H N N 322 SER HA H N N 323 SER HB2 H N N 324 SER HB3 H N N 325 SER HG H N N 326 SER HXT H N N 327 THR N N N N 328 THR CA C N S 329 THR C C N N 330 THR O O N N 331 THR CB C N R 332 THR OG1 O N N 333 THR CG2 C N N 334 THR OXT O N N 335 THR H H N N 336 THR H2 H N N 337 THR HA H N N 338 THR HB H N N 339 THR HG1 H N N 340 THR HG21 H N N 341 THR HG22 H N N 342 THR HG23 H N N 343 THR HXT H N N 344 TRP N N N N 345 TRP CA C N S 346 TRP C C N N 347 TRP O O N N 348 TRP CB C N N 349 TRP CG C Y N 350 TRP CD1 C Y N 351 TRP CD2 C Y N 352 TRP NE1 N Y N 353 TRP CE2 C Y N 354 TRP CE3 C Y N 355 TRP CZ2 C Y N 356 TRP CZ3 C Y N 357 TRP CH2 C Y N 358 TRP OXT O N N 359 TRP H H N N 360 TRP H2 H N N 361 TRP HA H N N 362 TRP HB2 H N N 363 TRP HB3 H N N 364 TRP HD1 H N N 365 TRP HE1 H N N 366 TRP HE3 H N N 367 TRP HZ2 H N N 368 TRP HZ3 H N N 369 TRP HH2 H N N 370 TRP HXT H N N 371 TYR N N N N 372 TYR CA C N S 373 TYR C C N N 374 TYR O O N N 375 TYR CB C N N 376 TYR CG C Y N 377 TYR CD1 C Y N 378 TYR CD2 C Y N 379 TYR CE1 C Y N 380 TYR CE2 C Y N 381 TYR CZ C Y N 382 TYR OH O N N 383 TYR OXT O N N 384 TYR H H N N 385 TYR H2 H N N 386 TYR HA H N N 387 TYR HB2 H N N 388 TYR HB3 H N N 389 TYR HD1 H N N 390 TYR HD2 H N N 391 TYR HE1 H N N 392 TYR HE2 H N N 393 TYR HH H N N 394 TYR HXT H N N 395 VAL N N N N 396 VAL CA C N S 397 VAL C C N N 398 VAL O O N N 399 VAL CB C N N 400 VAL CG1 C N N 401 VAL CG2 C N N 402 VAL OXT O N N 403 VAL H H N N 404 VAL H2 H N N 405 VAL HA H N N 406 VAL HB H N N 407 VAL HG11 H N N 408 VAL HG12 H N N 409 VAL HG13 H N N 410 VAL HG21 H N N 411 VAL HG22 H N N 412 VAL HG23 H N N 413 VAL HXT H N N 414 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1I1W C5 C6 doub Y N 1 A1I1W C5 C8 sing N N 2 A1I1W C5 C03 sing Y N 3 A1I1W C6 C7 sing Y N 4 A1I1W C7 C01 doub Y N 5 A1I1W C01 C02 sing Y N 6 A1I1W C02 C03 doub Y N 7 A1I1W C8 C9 trip N N 8 A1I1W C9 C10 sing N N 9 A1I1W C10 C04 doub Y N 10 A1I1W C10 C11 sing Y N 11 A1I1W C11 C12 doub Y N 12 A1I1W C12 C15 sing N N 13 A1I1W C12 C13 sing Y N 14 A1I1W C13 C14 doub Y N 15 A1I1W C13 O18 sing N N 16 A1I1W C14 C04 sing Y N 17 A1I1W C15 O17 sing N N 18 A1I1W C15 O16 doub N N 19 A1I1W C11 H11 sing N N 20 A1I1W C14 H14 sing N N 21 A1I1W C7 H71 sing N N 22 A1I1W C6 H61 sing N N 23 A1I1W C01 H01 sing N N 24 A1I1W C02 H02 sing N N 25 A1I1W C03 H03 sing N N 26 A1I1W C04 H04 sing N N 27 A1I1W O18 H18 sing N N 28 ALA N CA sing N N 29 ALA N H sing N N 30 ALA N H2 sing N N 31 ALA CA C sing N N 32 ALA CA CB sing N N 33 ALA CA HA sing N N 34 ALA C O doub N N 35 ALA C OXT sing N N 36 ALA CB HB1 sing N N 37 ALA CB HB2 sing N N 38 ALA CB HB3 sing N N 39 ALA OXT HXT sing N N 40 ARG N CA sing N N 41 ARG N H sing N N 42 ARG N H2 sing N N 43 ARG CA C sing N N 44 ARG CA CB sing N N 45 ARG CA HA sing N N 46 ARG C O doub N N 47 ARG C OXT sing N N 48 ARG CB CG sing N N 49 ARG CB HB2 sing N N 50 ARG CB HB3 sing N N 51 ARG CG CD sing N N 52 ARG CG HG2 sing N N 53 ARG CG HG3 sing N N 54 ARG CD NE sing N N 55 ARG CD HD2 sing N N 56 ARG CD HD3 sing N N 57 ARG NE CZ sing N N 58 ARG NE HE sing N N 59 ARG CZ NH1 sing N N 60 ARG CZ NH2 doub N N 61 ARG NH1 HH11 sing N N 62 ARG NH1 HH12 sing N N 63 ARG NH2 HH21 sing N N 64 ARG NH2 HH22 sing N N 65 ARG OXT HXT sing N N 66 ASN N CA sing N N 67 ASN N H sing N N 68 ASN N H2 sing N N 69 ASN CA C sing N N 70 ASN CA CB sing N N 71 ASN CA HA sing N N 72 ASN C O doub N N 73 ASN C OXT sing N N 74 ASN CB CG sing N N 75 ASN CB HB2 sing N N 76 ASN CB HB3 sing N N 77 ASN CG OD1 doub N N 78 ASN CG ND2 sing N N 79 ASN ND2 HD21 sing N N 80 ASN ND2 HD22 sing N N 81 ASN OXT HXT sing N N 82 ASP N CA sing N N 83 ASP N H sing N N 84 ASP N H2 sing N N 85 ASP CA C sing N N 86 ASP CA CB sing N N 87 ASP CA HA sing N N 88 ASP C O doub N N 89 ASP C OXT sing N N 90 ASP CB CG sing N N 91 ASP CB HB2 sing N N 92 ASP CB HB3 sing N N 93 ASP CG OD1 doub N N 94 ASP CG OD2 sing N N 95 ASP OD2 HD2 sing N N 96 ASP OXT HXT sing N N 97 CYS N CA sing N N 98 CYS N H sing N N 99 CYS N H2 sing N N 100 CYS CA C sing N N 101 CYS CA CB sing N N 102 CYS CA HA sing N N 103 CYS C O doub N N 104 CYS C OXT sing N N 105 CYS CB SG sing N N 106 CYS CB HB2 sing N N 107 CYS CB HB3 sing N N 108 CYS SG HG sing N N 109 CYS OXT HXT sing N N 110 GLN N CA sing N N 111 GLN N H sing N N 112 GLN N H2 sing N N 113 GLN CA C sing N N 114 GLN CA CB sing N N 115 GLN CA HA sing N N 116 GLN C O doub N N 117 GLN C OXT sing N N 118 GLN CB CG sing N N 119 GLN CB HB2 sing N N 120 GLN CB HB3 sing N N 121 GLN CG CD sing N N 122 GLN CG HG2 sing N N 123 GLN CG HG3 sing N N 124 GLN CD OE1 doub N N 125 GLN CD NE2 sing N N 126 GLN NE2 HE21 sing N N 127 GLN NE2 HE22 sing N N 128 GLN OXT HXT sing N N 129 GLU N CA sing N N 130 GLU N H sing N N 131 GLU N H2 sing N N 132 GLU CA C sing N N 133 GLU CA CB sing N N 134 GLU CA HA sing N N 135 GLU C O doub N N 136 GLU C OXT sing N N 137 GLU CB CG sing N N 138 GLU CB HB2 sing N N 139 GLU CB HB3 sing N N 140 GLU CG CD sing N N 141 GLU CG HG2 sing N N 142 GLU CG HG3 sing N N 143 GLU CD OE1 doub N N 144 GLU CD OE2 sing N N 145 GLU OE2 HE2 sing N N 146 GLU OXT HXT sing N N 147 GLY N CA sing N N 148 GLY N H sing N N 149 GLY N H2 sing N N 150 GLY CA C sing N N 151 GLY CA HA2 sing N N 152 GLY CA HA3 sing N N 153 GLY C O doub N N 154 GLY C OXT sing N N 155 GLY OXT HXT sing N N 156 HIS N CA sing N N 157 HIS N H sing N N 158 HIS N H2 sing N N 159 HIS CA C sing N N 160 HIS CA CB sing N N 161 HIS CA HA sing N N 162 HIS C O doub N N 163 HIS C OXT sing N N 164 HIS CB CG sing N N 165 HIS CB HB2 sing N N 166 HIS CB HB3 sing N N 167 HIS CG ND1 sing Y N 168 HIS CG CD2 doub Y N 169 HIS ND1 CE1 doub Y N 170 HIS ND1 HD1 sing N N 171 HIS CD2 NE2 sing Y N 172 HIS CD2 HD2 sing N N 173 HIS CE1 NE2 sing Y N 174 HIS CE1 HE1 sing N N 175 HIS NE2 HE2 sing N N 176 HIS OXT HXT sing N N 177 ILE N CA sing N N 178 ILE N H sing N N 179 ILE N H2 sing N N 180 ILE CA C sing N N 181 ILE CA CB sing N N 182 ILE CA HA sing N N 183 ILE C O doub N N 184 ILE C OXT sing N N 185 ILE CB CG1 sing N N 186 ILE CB CG2 sing N N 187 ILE CB HB sing N N 188 ILE CG1 CD1 sing N N 189 ILE CG1 HG12 sing N N 190 ILE CG1 HG13 sing N N 191 ILE CG2 HG21 sing N N 192 ILE CG2 HG22 sing N N 193 ILE CG2 HG23 sing N N 194 ILE CD1 HD11 sing N N 195 ILE CD1 HD12 sing N N 196 ILE CD1 HD13 sing N N 197 ILE OXT HXT sing N N 198 LEU N CA sing N N 199 LEU N H sing N N 200 LEU N H2 sing N N 201 LEU CA C sing N N 202 LEU CA CB sing N N 203 LEU CA HA sing N N 204 LEU C O doub N N 205 LEU C OXT sing N N 206 LEU CB CG sing N N 207 LEU CB HB2 sing N N 208 LEU CB HB3 sing N N 209 LEU CG CD1 sing N N 210 LEU CG CD2 sing N N 211 LEU CG HG sing N N 212 LEU CD1 HD11 sing N N 213 LEU CD1 HD12 sing N N 214 LEU CD1 HD13 sing N N 215 LEU CD2 HD21 sing N N 216 LEU CD2 HD22 sing N N 217 LEU CD2 HD23 sing N N 218 LEU OXT HXT sing N N 219 LYS N CA sing N N 220 LYS N H sing N N 221 LYS N H2 sing N N 222 LYS CA C sing N N 223 LYS CA CB sing N N 224 LYS CA HA sing N N 225 LYS C O doub N N 226 LYS C OXT sing N N 227 LYS CB CG sing N N 228 LYS CB HB2 sing N N 229 LYS CB HB3 sing N N 230 LYS CG CD sing N N 231 LYS CG HG2 sing N N 232 LYS CG HG3 sing N N 233 LYS CD CE sing N N 234 LYS CD HD2 sing N N 235 LYS CD HD3 sing N N 236 LYS CE NZ sing N N 237 LYS CE HE2 sing N N 238 LYS CE HE3 sing N N 239 LYS NZ HZ1 sing N N 240 LYS NZ HZ2 sing N N 241 LYS NZ HZ3 sing N N 242 LYS OXT HXT sing N N 243 MET N CA sing N N 244 MET N H sing N N 245 MET N H2 sing N N 246 MET CA C sing N N 247 MET CA CB sing N N 248 MET CA HA sing N N 249 MET C O doub N N 250 MET C OXT sing N N 251 MET CB CG sing N N 252 MET CB HB2 sing N N 253 MET CB HB3 sing N N 254 MET CG SD sing N N 255 MET CG HG2 sing N N 256 MET CG HG3 sing N N 257 MET SD CE sing N N 258 MET CE HE1 sing N N 259 MET CE HE2 sing N N 260 MET CE HE3 sing N N 261 MET OXT HXT sing N N 262 PHE N CA sing N N 263 PHE N H sing N N 264 PHE N H2 sing N N 265 PHE CA C sing N N 266 PHE CA CB sing N N 267 PHE CA HA sing N N 268 PHE C O doub N N 269 PHE C OXT sing N N 270 PHE CB CG sing N N 271 PHE CB HB2 sing N N 272 PHE CB HB3 sing N N 273 PHE CG CD1 doub Y N 274 PHE CG CD2 sing Y N 275 PHE CD1 CE1 sing Y N 276 PHE CD1 HD1 sing N N 277 PHE CD2 CE2 doub Y N 278 PHE CD2 HD2 sing N N 279 PHE CE1 CZ doub Y N 280 PHE CE1 HE1 sing N N 281 PHE CE2 CZ sing Y N 282 PHE CE2 HE2 sing N N 283 PHE CZ HZ sing N N 284 PHE OXT HXT sing N N 285 PRO N CA sing N N 286 PRO N CD sing N N 287 PRO N H sing N N 288 PRO CA C sing N N 289 PRO CA CB sing N N 290 PRO CA HA sing N N 291 PRO C O doub N N 292 PRO C OXT sing N N 293 PRO CB CG sing N N 294 PRO CB HB2 sing N N 295 PRO CB HB3 sing N N 296 PRO CG CD sing N N 297 PRO CG HG2 sing N N 298 PRO CG HG3 sing N N 299 PRO CD HD2 sing N N 300 PRO CD HD3 sing N N 301 PRO OXT HXT sing N N 302 SER N CA sing N N 303 SER N H sing N N 304 SER N H2 sing N N 305 SER CA C sing N N 306 SER CA CB sing N N 307 SER CA HA sing N N 308 SER C O doub N N 309 SER C OXT sing N N 310 SER CB OG sing N N 311 SER CB HB2 sing N N 312 SER CB HB3 sing N N 313 SER OG HG sing N N 314 SER OXT HXT sing N N 315 THR N CA sing N N 316 THR N H sing N N 317 THR N H2 sing N N 318 THR CA C sing N N 319 THR CA CB sing N N 320 THR CA HA sing N N 321 THR C O doub N N 322 THR C OXT sing N N 323 THR CB OG1 sing N N 324 THR CB CG2 sing N N 325 THR CB HB sing N N 326 THR OG1 HG1 sing N N 327 THR CG2 HG21 sing N N 328 THR CG2 HG22 sing N N 329 THR CG2 HG23 sing N N 330 THR OXT HXT sing N N 331 TRP N CA sing N N 332 TRP N H sing N N 333 TRP N H2 sing N N 334 TRP CA C sing N N 335 TRP CA CB sing N N 336 TRP CA HA sing N N 337 TRP C O doub N N 338 TRP C OXT sing N N 339 TRP CB CG sing N N 340 TRP CB HB2 sing N N 341 TRP CB HB3 sing N N 342 TRP CG CD1 doub Y N 343 TRP CG CD2 sing Y N 344 TRP CD1 NE1 sing Y N 345 TRP CD1 HD1 sing N N 346 TRP CD2 CE2 doub Y N 347 TRP CD2 CE3 sing Y N 348 TRP NE1 CE2 sing Y N 349 TRP NE1 HE1 sing N N 350 TRP CE2 CZ2 sing Y N 351 TRP CE3 CZ3 doub Y N 352 TRP CE3 HE3 sing N N 353 TRP CZ2 CH2 doub Y N 354 TRP CZ2 HZ2 sing N N 355 TRP CZ3 CH2 sing Y N 356 TRP CZ3 HZ3 sing N N 357 TRP CH2 HH2 sing N N 358 TRP OXT HXT sing N N 359 TYR N CA sing N N 360 TYR N H sing N N 361 TYR N H2 sing N N 362 TYR CA C sing N N 363 TYR CA CB sing N N 364 TYR CA HA sing N N 365 TYR C O doub N N 366 TYR C OXT sing N N 367 TYR CB CG sing N N 368 TYR CB HB2 sing N N 369 TYR CB HB3 sing N N 370 TYR CG CD1 doub Y N 371 TYR CG CD2 sing Y N 372 TYR CD1 CE1 sing Y N 373 TYR CD1 HD1 sing N N 374 TYR CD2 CE2 doub Y N 375 TYR CD2 HD2 sing N N 376 TYR CE1 CZ doub Y N 377 TYR CE1 HE1 sing N N 378 TYR CE2 CZ sing Y N 379 TYR CE2 HE2 sing N N 380 TYR CZ OH sing N N 381 TYR OH HH sing N N 382 TYR OXT HXT sing N N 383 VAL N CA sing N N 384 VAL N H sing N N 385 VAL N H2 sing N N 386 VAL CA C sing N N 387 VAL CA CB sing N N 388 VAL CA HA sing N N 389 VAL C O doub N N 390 VAL C OXT sing N N 391 VAL CB CG1 sing N N 392 VAL CB CG2 sing N N 393 VAL CB HB sing N N 394 VAL CG1 HG11 sing N N 395 VAL CG1 HG12 sing N N 396 VAL CG1 HG13 sing N N 397 VAL CG2 HG21 sing N N 398 VAL CG2 HG22 sing N N 399 VAL CG2 HG23 sing N N 400 VAL OXT HXT sing N N 401 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3FS1 _pdbx_initial_refinement_model.details ? # _space_group.name_H-M_alt 'P 42 21 2' _space_group.name_Hall 'P 4n 2n' _space_group.IT_number 94 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 9IBR _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.011394 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011394 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015902 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? ? ? 11.43723 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ #