data_9ILK # _entry.id 9ILK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.406 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9ILK pdb_00009ilk 10.2210/pdb9ilk/pdb WWPDB D_1300048939 ? ? BMRB 36678 ? 10.13018/BMR36678 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2025-10-15 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 9ILK _pdbx_database_status.recvd_initial_deposition_date 2024-06-30 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'monomeric SarA, truncation of residue 20-124' _pdbx_database_related.db_id 36678 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email binxia@pku.edu.cn _pdbx_contact_author.name_first Bin _pdbx_contact_author.name_last Xia _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-2197-6403 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Xia, B.' 1 0000-0002-2197-6403 'Fu, D.H.' 2 0009-0005-8415-6890 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Solution Structure of the monomeric DNA-binding domain of SarA' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xia, B.' 1 0000-0002-2197-6403 primary 'Fu, D.H.' 2 0009-0005-8415-6890 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Transcriptional regulator SarA' _entity.formula_weight 13796.781 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details 'truncation of residues 20-124 of SarA' # _entity_name_com.entity_id 1 _entity_name_com.name 'Staphylococcal accessory regulator A' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDKLKSLIKKEFSISFEEFAVLTYISENKEKEYYLKDIINHLNYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVNA QQRKKIESLLSRVNKRITEANNEIELLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MDKLKSLIKKEFSISFEEFAVLTYISENKEKEYYLKDIINHLNYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVNA QQRKKIESLLSRVNKRITEANNEIELLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 LYS n 1 4 LEU n 1 5 LYS n 1 6 SER n 1 7 LEU n 1 8 ILE n 1 9 LYS n 1 10 LYS n 1 11 GLU n 1 12 PHE n 1 13 SER n 1 14 ILE n 1 15 SER n 1 16 PHE n 1 17 GLU n 1 18 GLU n 1 19 PHE n 1 20 ALA n 1 21 VAL n 1 22 LEU n 1 23 THR n 1 24 TYR n 1 25 ILE n 1 26 SER n 1 27 GLU n 1 28 ASN n 1 29 LYS n 1 30 GLU n 1 31 LYS n 1 32 GLU n 1 33 TYR n 1 34 TYR n 1 35 LEU n 1 36 LYS n 1 37 ASP n 1 38 ILE n 1 39 ILE n 1 40 ASN n 1 41 HIS n 1 42 LEU n 1 43 ASN n 1 44 TYR n 1 45 LYS n 1 46 GLN n 1 47 PRO n 1 48 GLN n 1 49 VAL n 1 50 VAL n 1 51 LYS n 1 52 ALA n 1 53 VAL n 1 54 LYS n 1 55 ILE n 1 56 LEU n 1 57 SER n 1 58 GLN n 1 59 GLU n 1 60 ASP n 1 61 TYR n 1 62 PHE n 1 63 ASP n 1 64 LYS n 1 65 LYS n 1 66 ARG n 1 67 ASN n 1 68 GLU n 1 69 HIS n 1 70 ASP n 1 71 GLU n 1 72 ARG n 1 73 THR n 1 74 VAL n 1 75 LEU n 1 76 ILE n 1 77 LEU n 1 78 VAL n 1 79 ASN n 1 80 ALA n 1 81 GLN n 1 82 GLN n 1 83 ARG n 1 84 LYS n 1 85 LYS n 1 86 ILE n 1 87 GLU n 1 88 SER n 1 89 LEU n 1 90 LEU n 1 91 SER n 1 92 ARG n 1 93 VAL n 1 94 ASN n 1 95 LYS n 1 96 ARG n 1 97 ILE n 1 98 THR n 1 99 GLU n 1 100 ALA n 1 101 ASN n 1 102 ASN n 1 103 GLU n 1 104 ILE n 1 105 GLU n 1 106 LEU n 1 107 LEU n 1 108 GLU n 1 109 HIS n 1 110 HIS n 1 111 HIS n 1 112 HIS n 1 113 HIS n 1 114 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 114 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'sarA, SA0573' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus subsp. aureus N315' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 158879 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 THR 23 23 23 THR THR A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 TYR 44 44 44 TYR TYR A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 GLN 46 46 46 GLN GLN A . n A 1 47 PRO 47 47 47 PRO PRO A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 LEU 56 56 56 LEU LEU A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 PHE 62 62 62 PHE PHE A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 VAL 78 78 78 VAL VAL A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 ARG 92 92 92 ARG ARG A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 ASN 94 94 94 ASN ASN A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 ASN 102 102 102 ASN ASN A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 LEU 107 107 107 LEU LEU A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 HIS 109 109 109 HIS HIS A . n A 1 110 HIS 110 110 110 HIS HIS A . n A 1 111 HIS 111 111 111 HIS HIS A . n A 1 112 HIS 112 112 112 HIS HIS A . n A 1 113 HIS 113 113 113 HIS HIS A . n A 1 114 HIS 114 114 114 HIS HIS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9ILK _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 9ILK _struct.title 'monomeric SarA, truncation of residue 20-124' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9ILK _struct_keywords.text 'S.aureus, DNA-binding, winged-helix, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SARA_STAAN _struct_ref.pdbx_db_accession Q7A732 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DKLKSLIKKEFSISFEEFAVLTYISENKEKEYYLKDIINHLNYKQPQVVKAVKILSQEDYFDKKRNEHDERTVLILVNAQ QRKKIESLLSRVNKRITEANNEIEL ; _struct_ref.pdbx_align_begin 20 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9ILK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 106 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q7A732 _struct_ref_seq.db_align_beg 20 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 124 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 106 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9ILK MET A 1 ? UNP Q7A732 ? ? 'initiating methionine' 1 1 1 9ILK LEU A 107 ? UNP Q7A732 ? ? 'expression tag' 107 2 1 9ILK GLU A 108 ? UNP Q7A732 ? ? 'expression tag' 108 3 1 9ILK HIS A 109 ? UNP Q7A732 ? ? 'expression tag' 109 4 1 9ILK HIS A 110 ? UNP Q7A732 ? ? 'expression tag' 110 5 1 9ILK HIS A 111 ? UNP Q7A732 ? ? 'expression tag' 111 6 1 9ILK HIS A 112 ? UNP Q7A732 ? ? 'expression tag' 112 7 1 9ILK HIS A 113 ? UNP Q7A732 ? ? 'expression tag' 113 8 1 9ILK HIS A 114 ? UNP Q7A732 ? ? 'expression tag' 114 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 2 ? SER A 13 ? ASP A 2 SER A 13 1 ? 12 HELX_P HELX_P2 AA2 SER A 15 ? ASN A 28 ? SER A 15 ASN A 28 1 ? 14 HELX_P HELX_P3 AA3 LEU A 35 ? LEU A 42 ? LEU A 35 LEU A 42 1 ? 8 HELX_P HELX_P4 AA4 LYS A 45 ? GLU A 59 ? LYS A 45 GLU A 59 1 ? 15 HELX_P HELX_P5 AA5 ASN A 79 ? HIS A 109 ? ASN A 79 HIS A 109 1 ? 31 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 32 ? TYR A 34 ? GLU A 32 TYR A 34 AA1 2 VAL A 74 ? LEU A 77 ? VAL A 74 LEU A 77 AA1 3 ASP A 63 ? ARG A 66 ? ASP A 63 ARG A 66 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TYR A 33 ? N TYR A 33 O ILE A 76 ? O ILE A 76 AA1 2 3 O LEU A 75 ? O LEU A 75 N LYS A 65 ? N LYS A 65 # _pdbx_entry_details.entry_id 9ILK _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 96 ? ? CZ A ARG 96 ? ? NH2 A ARG 96 ? ? 124.22 120.30 3.92 0.50 N 2 3 NE A ARG 96 ? ? CZ A ARG 96 ? ? NH1 A ARG 96 ? ? 123.45 120.30 3.15 0.50 N 3 4 NE A ARG 96 ? ? CZ A ARG 96 ? ? NH1 A ARG 96 ? ? 123.52 120.30 3.22 0.50 N 4 5 NE A ARG 83 ? ? CZ A ARG 83 ? ? NH2 A ARG 83 ? ? 117.28 120.30 -3.02 0.50 N 5 6 NE A ARG 66 ? ? CZ A ARG 66 ? ? NH1 A ARG 66 ? ? 123.61 120.30 3.31 0.50 N 6 6 NE A ARG 96 ? ? CZ A ARG 96 ? ? NH2 A ARG 96 ? ? 123.51 120.30 3.21 0.50 N 7 7 NE A ARG 66 ? ? CZ A ARG 66 ? ? NH1 A ARG 66 ? ? 123.31 120.30 3.01 0.50 N 8 8 NE A ARG 96 ? ? CZ A ARG 96 ? ? NH2 A ARG 96 ? ? 123.83 120.30 3.53 0.50 N 9 9 NE A ARG 96 ? ? CZ A ARG 96 ? ? NH1 A ARG 96 ? ? 123.77 120.30 3.47 0.50 N 10 10 NE A ARG 96 ? ? CZ A ARG 96 ? ? NH1 A ARG 96 ? ? 123.61 120.30 3.31 0.50 N 11 11 NE A ARG 96 ? ? CZ A ARG 96 ? ? NH2 A ARG 96 ? ? 123.79 120.30 3.49 0.50 N 12 13 NE A ARG 83 ? ? CZ A ARG 83 ? ? NH1 A ARG 83 ? ? 117.12 120.30 -3.18 0.50 N 13 14 NE A ARG 96 ? ? CZ A ARG 96 ? ? NH1 A ARG 96 ? ? 123.61 120.30 3.31 0.50 N 14 16 NE A ARG 96 ? ? CZ A ARG 96 ? ? NH2 A ARG 96 ? ? 123.45 120.30 3.15 0.50 N 15 17 NE A ARG 96 ? ? CZ A ARG 96 ? ? NH2 A ARG 96 ? ? 123.71 120.30 3.41 0.50 N 16 18 NE A ARG 66 ? ? CZ A ARG 66 ? ? NH1 A ARG 66 ? ? 123.76 120.30 3.46 0.50 N 17 18 NE A ARG 96 ? ? CZ A ARG 96 ? ? NH2 A ARG 96 ? ? 123.35 120.30 3.05 0.50 N 18 20 NE A ARG 83 ? ? CZ A ARG 83 ? ? NH2 A ARG 83 ? ? 123.77 120.30 3.47 0.50 N 19 20 NE A ARG 96 ? ? CZ A ARG 96 ? ? NH1 A ARG 96 ? ? 124.22 120.30 3.92 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 13 ? ? 57.70 17.33 2 1 LYS A 29 ? ? -35.93 110.39 3 2 ASP A 60 ? ? 59.52 17.15 4 4 ASN A 28 ? ? -95.90 31.09 5 4 LYS A 29 ? ? -39.04 119.96 6 5 SER A 13 ? ? 59.53 17.75 7 5 LYS A 29 ? ? -35.94 108.99 8 5 HIS A 109 ? ? -66.43 0.60 9 5 HIS A 110 ? ? -58.54 -5.58 10 6 LYS A 29 ? ? -32.67 113.21 11 6 ASP A 60 ? ? 56.06 11.40 12 7 ASN A 28 ? ? -93.05 31.28 13 7 LYS A 29 ? ? -36.39 113.72 14 8 ASN A 28 ? ? -89.56 31.55 15 8 LYS A 29 ? ? -32.87 115.51 16 8 ASP A 60 ? ? 59.11 19.33 17 10 LYS A 29 ? ? -40.71 109.75 18 10 ASP A 60 ? ? 56.16 13.03 19 11 LYS A 29 ? ? -37.85 119.03 20 12 LYS A 29 ? ? -37.22 107.93 21 13 LYS A 29 ? ? -39.73 112.02 22 13 HIS A 109 ? ? -98.99 35.54 23 14 SER A 13 ? ? 59.48 17.21 24 14 LYS A 29 ? ? -39.68 110.70 25 15 ASN A 28 ? ? -97.85 31.27 26 15 LYS A 29 ? ? -33.88 114.16 27 17 ASN A 28 ? ? -95.68 31.08 28 17 LYS A 29 ? ? -31.58 108.47 29 17 ASP A 60 ? ? 59.30 19.96 30 18 ASN A 28 ? ? -92.15 31.62 31 18 LYS A 29 ? ? -36.56 112.77 32 19 ASP A 60 ? ? 55.89 10.60 33 20 LYS A 29 ? ? -35.41 116.33 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 83 ? ? 0.090 'SIDE CHAIN' 2 11 ARG A 96 ? ? 0.077 'SIDE CHAIN' 3 19 TYR A 24 ? ? 0.066 'SIDE CHAIN' # _pdbx_nmr_ensemble.entry_id 9ILK _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 9ILK _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 2 _pdbx_nmr_sample_details.contents ;50 mM sodium phosphate, 50 mM NaCl, 90 % H2O, 10 % [U-99% 2H] D2O, 0.01 % DSS, 0.01 % sodium azide, 5 % EDTA-free Protease Inhibitor Cocktail, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label '15N, 13C_monomeric SarA' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 2 'sodium phosphate' 50 ? mM 'natural abundance' 2 NaCl 50 ? mM 'natural abundance' 2 H2O 90 ? % 'natural abundance' 2 D2O 10 ? % '[U-99% 2H]' 2 DSS 0.01 ? % 'natural abundance' 2 'sodium azide' 0.01 ? % 'natural abundance' 2 'EDTA-free Protease Inhibitor Cocktail' 5 ? % 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 2 '2D 1H-15N HSQC' 2 isotropic 2 1 2 '2D 1H-13C HSQC' 2 isotropic 3 1 2 '3D 1H-15N NOESY' 2 isotropic 4 1 2 '3D 1H-13C NOESY aromatic' 2 isotropic 5 1 2 '3D 1H-13C NOESY' 2 isotropic 6 1 2 '3D CBCA(CO)NH' 1 isotropic 7 1 2 '3D HNCACB' 1 isotropic 8 1 2 '3D HCCH-COSY' 1 isotropic 9 1 2 '3D HCCH-TOCSY' 1 isotropic 10 1 2 '3D CCH-COSY' 1 isotropic 11 1 2 '3D CCH-TOCSY' 1 isotropic # _pdbx_nmr_refine.entry_id 9ILK _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 6 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' NMRView ? 'Johnson, One Moon Scientific' 2 'structure calculation' Amber ? 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, ... and Kollman' 3 'structure calculation' DYANA ? 'Guntert, Braun and Wuthrich' 4 'peak picking' NMRView ? 'Johnson, One Moon Scientific' 5 'data analysis' TALOS-N ? 'Yang Shen, Ad Bax' 6 refinement Amber ? 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, ... and Kollman' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 HIS N N N N 113 HIS CA C N S 114 HIS C C N N 115 HIS O O N N 116 HIS CB C N N 117 HIS CG C Y N 118 HIS ND1 N Y N 119 HIS CD2 C Y N 120 HIS CE1 C Y N 121 HIS NE2 N Y N 122 HIS OXT O N N 123 HIS H H N N 124 HIS H2 H N N 125 HIS HA H N N 126 HIS HB2 H N N 127 HIS HB3 H N N 128 HIS HD1 H N N 129 HIS HD2 H N N 130 HIS HE1 H N N 131 HIS HE2 H N N 132 HIS HXT H N N 133 ILE N N N N 134 ILE CA C N S 135 ILE C C N N 136 ILE O O N N 137 ILE CB C N S 138 ILE CG1 C N N 139 ILE CG2 C N N 140 ILE CD1 C N N 141 ILE OXT O N N 142 ILE H H N N 143 ILE H2 H N N 144 ILE HA H N N 145 ILE HB H N N 146 ILE HG12 H N N 147 ILE HG13 H N N 148 ILE HG21 H N N 149 ILE HG22 H N N 150 ILE HG23 H N N 151 ILE HD11 H N N 152 ILE HD12 H N N 153 ILE HD13 H N N 154 ILE HXT H N N 155 LEU N N N N 156 LEU CA C N S 157 LEU C C N N 158 LEU O O N N 159 LEU CB C N N 160 LEU CG C N N 161 LEU CD1 C N N 162 LEU CD2 C N N 163 LEU OXT O N N 164 LEU H H N N 165 LEU H2 H N N 166 LEU HA H N N 167 LEU HB2 H N N 168 LEU HB3 H N N 169 LEU HG H N N 170 LEU HD11 H N N 171 LEU HD12 H N N 172 LEU HD13 H N N 173 LEU HD21 H N N 174 LEU HD22 H N N 175 LEU HD23 H N N 176 LEU HXT H N N 177 LYS N N N N 178 LYS CA C N S 179 LYS C C N N 180 LYS O O N N 181 LYS CB C N N 182 LYS CG C N N 183 LYS CD C N N 184 LYS CE C N N 185 LYS NZ N N N 186 LYS OXT O N N 187 LYS H H N N 188 LYS H2 H N N 189 LYS HA H N N 190 LYS HB2 H N N 191 LYS HB3 H N N 192 LYS HG2 H N N 193 LYS HG3 H N N 194 LYS HD2 H N N 195 LYS HD3 H N N 196 LYS HE2 H N N 197 LYS HE3 H N N 198 LYS HZ1 H N N 199 LYS HZ2 H N N 200 LYS HZ3 H N N 201 LYS HXT H N N 202 MET N N N N 203 MET CA C N S 204 MET C C N N 205 MET O O N N 206 MET CB C N N 207 MET CG C N N 208 MET SD S N N 209 MET CE C N N 210 MET OXT O N N 211 MET H H N N 212 MET H2 H N N 213 MET HA H N N 214 MET HB2 H N N 215 MET HB3 H N N 216 MET HG2 H N N 217 MET HG3 H N N 218 MET HE1 H N N 219 MET HE2 H N N 220 MET HE3 H N N 221 MET HXT H N N 222 PHE N N N N 223 PHE CA C N S 224 PHE C C N N 225 PHE O O N N 226 PHE CB C N N 227 PHE CG C Y N 228 PHE CD1 C Y N 229 PHE CD2 C Y N 230 PHE CE1 C Y N 231 PHE CE2 C Y N 232 PHE CZ C Y N 233 PHE OXT O N N 234 PHE H H N N 235 PHE H2 H N N 236 PHE HA H N N 237 PHE HB2 H N N 238 PHE HB3 H N N 239 PHE HD1 H N N 240 PHE HD2 H N N 241 PHE HE1 H N N 242 PHE HE2 H N N 243 PHE HZ H N N 244 PHE HXT H N N 245 PRO N N N N 246 PRO CA C N S 247 PRO C C N N 248 PRO O O N N 249 PRO CB C N N 250 PRO CG C N N 251 PRO CD C N N 252 PRO OXT O N N 253 PRO H H N N 254 PRO HA H N N 255 PRO HB2 H N N 256 PRO HB3 H N N 257 PRO HG2 H N N 258 PRO HG3 H N N 259 PRO HD2 H N N 260 PRO HD3 H N N 261 PRO HXT H N N 262 SER N N N N 263 SER CA C N S 264 SER C C N N 265 SER O O N N 266 SER CB C N N 267 SER OG O N N 268 SER OXT O N N 269 SER H H N N 270 SER H2 H N N 271 SER HA H N N 272 SER HB2 H N N 273 SER HB3 H N N 274 SER HG H N N 275 SER HXT H N N 276 THR N N N N 277 THR CA C N S 278 THR C C N N 279 THR O O N N 280 THR CB C N R 281 THR OG1 O N N 282 THR CG2 C N N 283 THR OXT O N N 284 THR H H N N 285 THR H2 H N N 286 THR HA H N N 287 THR HB H N N 288 THR HG1 H N N 289 THR HG21 H N N 290 THR HG22 H N N 291 THR HG23 H N N 292 THR HXT H N N 293 TYR N N N N 294 TYR CA C N S 295 TYR C C N N 296 TYR O O N N 297 TYR CB C N N 298 TYR CG C Y N 299 TYR CD1 C Y N 300 TYR CD2 C Y N 301 TYR CE1 C Y N 302 TYR CE2 C Y N 303 TYR CZ C Y N 304 TYR OH O N N 305 TYR OXT O N N 306 TYR H H N N 307 TYR H2 H N N 308 TYR HA H N N 309 TYR HB2 H N N 310 TYR HB3 H N N 311 TYR HD1 H N N 312 TYR HD2 H N N 313 TYR HE1 H N N 314 TYR HE2 H N N 315 TYR HH H N N 316 TYR HXT H N N 317 VAL N N N N 318 VAL CA C N S 319 VAL C C N N 320 VAL O O N N 321 VAL CB C N N 322 VAL CG1 C N N 323 VAL CG2 C N N 324 VAL OXT O N N 325 VAL H H N N 326 VAL H2 H N N 327 VAL HA H N N 328 VAL HB H N N 329 VAL HG11 H N N 330 VAL HG12 H N N 331 VAL HG13 H N N 332 VAL HG21 H N N 333 VAL HG22 H N N 334 VAL HG23 H N N 335 VAL HXT H N N 336 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 HIS N CA sing N N 107 HIS N H sing N N 108 HIS N H2 sing N N 109 HIS CA C sing N N 110 HIS CA CB sing N N 111 HIS CA HA sing N N 112 HIS C O doub N N 113 HIS C OXT sing N N 114 HIS CB CG sing N N 115 HIS CB HB2 sing N N 116 HIS CB HB3 sing N N 117 HIS CG ND1 sing Y N 118 HIS CG CD2 doub Y N 119 HIS ND1 CE1 doub Y N 120 HIS ND1 HD1 sing N N 121 HIS CD2 NE2 sing Y N 122 HIS CD2 HD2 sing N N 123 HIS CE1 NE2 sing Y N 124 HIS CE1 HE1 sing N N 125 HIS NE2 HE2 sing N N 126 HIS OXT HXT sing N N 127 ILE N CA sing N N 128 ILE N H sing N N 129 ILE N H2 sing N N 130 ILE CA C sing N N 131 ILE CA CB sing N N 132 ILE CA HA sing N N 133 ILE C O doub N N 134 ILE C OXT sing N N 135 ILE CB CG1 sing N N 136 ILE CB CG2 sing N N 137 ILE CB HB sing N N 138 ILE CG1 CD1 sing N N 139 ILE CG1 HG12 sing N N 140 ILE CG1 HG13 sing N N 141 ILE CG2 HG21 sing N N 142 ILE CG2 HG22 sing N N 143 ILE CG2 HG23 sing N N 144 ILE CD1 HD11 sing N N 145 ILE CD1 HD12 sing N N 146 ILE CD1 HD13 sing N N 147 ILE OXT HXT sing N N 148 LEU N CA sing N N 149 LEU N H sing N N 150 LEU N H2 sing N N 151 LEU CA C sing N N 152 LEU CA CB sing N N 153 LEU CA HA sing N N 154 LEU C O doub N N 155 LEU C OXT sing N N 156 LEU CB CG sing N N 157 LEU CB HB2 sing N N 158 LEU CB HB3 sing N N 159 LEU CG CD1 sing N N 160 LEU CG CD2 sing N N 161 LEU CG HG sing N N 162 LEU CD1 HD11 sing N N 163 LEU CD1 HD12 sing N N 164 LEU CD1 HD13 sing N N 165 LEU CD2 HD21 sing N N 166 LEU CD2 HD22 sing N N 167 LEU CD2 HD23 sing N N 168 LEU OXT HXT sing N N 169 LYS N CA sing N N 170 LYS N H sing N N 171 LYS N H2 sing N N 172 LYS CA C sing N N 173 LYS CA CB sing N N 174 LYS CA HA sing N N 175 LYS C O doub N N 176 LYS C OXT sing N N 177 LYS CB CG sing N N 178 LYS CB HB2 sing N N 179 LYS CB HB3 sing N N 180 LYS CG CD sing N N 181 LYS CG HG2 sing N N 182 LYS CG HG3 sing N N 183 LYS CD CE sing N N 184 LYS CD HD2 sing N N 185 LYS CD HD3 sing N N 186 LYS CE NZ sing N N 187 LYS CE HE2 sing N N 188 LYS CE HE3 sing N N 189 LYS NZ HZ1 sing N N 190 LYS NZ HZ2 sing N N 191 LYS NZ HZ3 sing N N 192 LYS OXT HXT sing N N 193 MET N CA sing N N 194 MET N H sing N N 195 MET N H2 sing N N 196 MET CA C sing N N 197 MET CA CB sing N N 198 MET CA HA sing N N 199 MET C O doub N N 200 MET C OXT sing N N 201 MET CB CG sing N N 202 MET CB HB2 sing N N 203 MET CB HB3 sing N N 204 MET CG SD sing N N 205 MET CG HG2 sing N N 206 MET CG HG3 sing N N 207 MET SD CE sing N N 208 MET CE HE1 sing N N 209 MET CE HE2 sing N N 210 MET CE HE3 sing N N 211 MET OXT HXT sing N N 212 PHE N CA sing N N 213 PHE N H sing N N 214 PHE N H2 sing N N 215 PHE CA C sing N N 216 PHE CA CB sing N N 217 PHE CA HA sing N N 218 PHE C O doub N N 219 PHE C OXT sing N N 220 PHE CB CG sing N N 221 PHE CB HB2 sing N N 222 PHE CB HB3 sing N N 223 PHE CG CD1 doub Y N 224 PHE CG CD2 sing Y N 225 PHE CD1 CE1 sing Y N 226 PHE CD1 HD1 sing N N 227 PHE CD2 CE2 doub Y N 228 PHE CD2 HD2 sing N N 229 PHE CE1 CZ doub Y N 230 PHE CE1 HE1 sing N N 231 PHE CE2 CZ sing Y N 232 PHE CE2 HE2 sing N N 233 PHE CZ HZ sing N N 234 PHE OXT HXT sing N N 235 PRO N CA sing N N 236 PRO N CD sing N N 237 PRO N H sing N N 238 PRO CA C sing N N 239 PRO CA CB sing N N 240 PRO CA HA sing N N 241 PRO C O doub N N 242 PRO C OXT sing N N 243 PRO CB CG sing N N 244 PRO CB HB2 sing N N 245 PRO CB HB3 sing N N 246 PRO CG CD sing N N 247 PRO CG HG2 sing N N 248 PRO CG HG3 sing N N 249 PRO CD HD2 sing N N 250 PRO CD HD3 sing N N 251 PRO OXT HXT sing N N 252 SER N CA sing N N 253 SER N H sing N N 254 SER N H2 sing N N 255 SER CA C sing N N 256 SER CA CB sing N N 257 SER CA HA sing N N 258 SER C O doub N N 259 SER C OXT sing N N 260 SER CB OG sing N N 261 SER CB HB2 sing N N 262 SER CB HB3 sing N N 263 SER OG HG sing N N 264 SER OXT HXT sing N N 265 THR N CA sing N N 266 THR N H sing N N 267 THR N H2 sing N N 268 THR CA C sing N N 269 THR CA CB sing N N 270 THR CA HA sing N N 271 THR C O doub N N 272 THR C OXT sing N N 273 THR CB OG1 sing N N 274 THR CB CG2 sing N N 275 THR CB HB sing N N 276 THR OG1 HG1 sing N N 277 THR CG2 HG21 sing N N 278 THR CG2 HG22 sing N N 279 THR CG2 HG23 sing N N 280 THR OXT HXT sing N N 281 TYR N CA sing N N 282 TYR N H sing N N 283 TYR N H2 sing N N 284 TYR CA C sing N N 285 TYR CA CB sing N N 286 TYR CA HA sing N N 287 TYR C O doub N N 288 TYR C OXT sing N N 289 TYR CB CG sing N N 290 TYR CB HB2 sing N N 291 TYR CB HB3 sing N N 292 TYR CG CD1 doub Y N 293 TYR CG CD2 sing Y N 294 TYR CD1 CE1 sing Y N 295 TYR CD1 HD1 sing N N 296 TYR CD2 CE2 doub Y N 297 TYR CD2 HD2 sing N N 298 TYR CE1 CZ doub Y N 299 TYR CE1 HE1 sing N N 300 TYR CE2 CZ sing Y N 301 TYR CE2 HE2 sing N N 302 TYR CZ OH sing N N 303 TYR OH HH sing N N 304 TYR OXT HXT sing N N 305 VAL N CA sing N N 306 VAL N H sing N N 307 VAL N H2 sing N N 308 VAL CA C sing N N 309 VAL CA CB sing N N 310 VAL CA HA sing N N 311 VAL C O doub N N 312 VAL C OXT sing N N 313 VAL CB CG1 sing N N 314 VAL CB CG2 sing N N 315 VAL CB HB sing N N 316 VAL CG1 HG11 sing N N 317 VAL CG1 HG12 sing N N 318 VAL CG1 HG13 sing N N 319 VAL CG2 HG21 sing N N 320 VAL CG2 HG22 sing N N 321 VAL CG2 HG23 sing N N 322 VAL OXT HXT sing N N 323 # _pdbx_audit_support.funding_organization 'National Basic Research Program of China (973 Program)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 AVANCE ? Bruker 500 ? 2 AVANCE ? Bruker 800 ? # _atom_sites.entry_id 9ILK _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #