data_9INA # _entry.id 9INA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.406 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9INA pdb_00009ina 10.2210/pdb9ina/pdb WWPDB D_1300049215 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2025-07-09 ? 2 'Structure model' 1 1 2025-08-20 ? 3 'Structure model' 1 2 2025-10-01 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 3 'Structure model' '_citation.journal_volume' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9INA _pdbx_database_status.recvd_initial_deposition_date 2024-07-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email pravinmcu@gmail.com _pdbx_contact_author.name_first Pravindra _pdbx_contact_author.name_last Kumar _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2128-7736 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Mahto, J.K.' 1 0000-0001-9941-8244 'Kumar, P.' 2 0000-0003-2128-7736 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Bacteriol. _citation.journal_id_ASTM JOBAAY _citation.journal_id_CSD 0767 _citation.journal_id_ISSN 1098-5530 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 207 _citation.language ? _citation.page_first e0022125 _citation.page_last e0022125 _citation.title 'Structure-guided engineering of an aromatic ring-hydroxylating dioxygenase for broad-spectrum phthalate degradation.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1128/jb.00221-25 _citation.pdbx_database_id_PubMed 40793770 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mahto, J.K.' 1 0000-0001-5255-3975 primary 'Mishra, I.' 2 ? primary 'Jangid, K.' 3 0000-0002-1440-6971 primary 'Kumar, P.' 4 0000-0003-2128-7736 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Rieske (2Fe-2S) domain protein' 50725.848 1 ? ? ? ? 2 non-polymer syn 'FE (II) ION' 55.845 1 ? ? ? ? 3 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER' 175.820 1 ? ? ? ? 4 water nat water 18.015 7 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'isophthalate dioxygenase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSENLYFQGHMASMNKEMSETLTRVGPNTRMGNLLRRYWVPALMSSEIAEADGPQVRVQLLGEKLLAFRN TDGKACLISEFCSHRGVSLYFGRNEENGIRCAYHGVKFDGDGQCVDVPSSPQSCARMHIKGYPCVERGGIVWTYMGPEEH KPSPPELEWCTLPPEHVFVSKRLQYSNWLQAMEGGIDTAHVSYVHRFEVDTDPMHQGVKALDYIKADGNVKFEIEQTPFG LSLFGRRNGEPDSYYWRITQWLFPWFTLIAPFGNHALGGHVWVPIDDHNCWAWSINWQPDQPLTKEERQSMEEGKGIHVE YEEPGSFIPKANRNNDYGMDRVAQREERSYSGIFGFSAQDYSLQESMGPIQDHAAERLLPTDKAIVMARRMLNEAALGLE QGETPPALDASEQHVRPAGVLLPRDQDPVAWAREELADATKKPVFSL ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSENLYFQGHMASMNKEMSETLTRVGPNTRMGNLLRRYWVPALMSSEIAEADGPQVRVQLLGEKLLAFRN TDGKACLISEFCSHRGVSLYFGRNEENGIRCAYHGVKFDGDGQCVDVPSSPQSCARMHIKGYPCVERGGIVWTYMGPEEH KPSPPELEWCTLPPEHVFVSKRLQYSNWLQAMEGGIDTAHVSYVHRFEVDTDPMHQGVKALDYIKADGNVKFEIEQTPFG LSLFGRRNGEPDSYYWRITQWLFPWFTLIAPFGNHALGGHVWVPIDDHNCWAWSINWQPDQPLTKEERQSMEEGKGIHVE YEEPGSFIPKANRNNDYGMDRVAQREERSYSGIFGFSAQDYSLQESMGPIQDHAAERLLPTDKAIVMARRMLNEAALGLE QGETPPALDASEQHVRPAGVLLPRDQDPVAWAREELADATKKPVFSL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FE (II) ION' FE2 3 'FE2/S2 (INORGANIC) CLUSTER' FES 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLU n 1 14 ASN n 1 15 LEU n 1 16 TYR n 1 17 PHE n 1 18 GLN n 1 19 GLY n 1 20 HIS n 1 21 MET n 1 22 ALA n 1 23 SER n 1 24 MET n 1 25 ASN n 1 26 LYS n 1 27 GLU n 1 28 MET n 1 29 SER n 1 30 GLU n 1 31 THR n 1 32 LEU n 1 33 THR n 1 34 ARG n 1 35 VAL n 1 36 GLY n 1 37 PRO n 1 38 ASN n 1 39 THR n 1 40 ARG n 1 41 MET n 1 42 GLY n 1 43 ASN n 1 44 LEU n 1 45 LEU n 1 46 ARG n 1 47 ARG n 1 48 TYR n 1 49 TRP n 1 50 VAL n 1 51 PRO n 1 52 ALA n 1 53 LEU n 1 54 MET n 1 55 SER n 1 56 SER n 1 57 GLU n 1 58 ILE n 1 59 ALA n 1 60 GLU n 1 61 ALA n 1 62 ASP n 1 63 GLY n 1 64 PRO n 1 65 GLN n 1 66 VAL n 1 67 ARG n 1 68 VAL n 1 69 GLN n 1 70 LEU n 1 71 LEU n 1 72 GLY n 1 73 GLU n 1 74 LYS n 1 75 LEU n 1 76 LEU n 1 77 ALA n 1 78 PHE n 1 79 ARG n 1 80 ASN n 1 81 THR n 1 82 ASP n 1 83 GLY n 1 84 LYS n 1 85 ALA n 1 86 CYS n 1 87 LEU n 1 88 ILE n 1 89 SER n 1 90 GLU n 1 91 PHE n 1 92 CYS n 1 93 SER n 1 94 HIS n 1 95 ARG n 1 96 GLY n 1 97 VAL n 1 98 SER n 1 99 LEU n 1 100 TYR n 1 101 PHE n 1 102 GLY n 1 103 ARG n 1 104 ASN n 1 105 GLU n 1 106 GLU n 1 107 ASN n 1 108 GLY n 1 109 ILE n 1 110 ARG n 1 111 CYS n 1 112 ALA n 1 113 TYR n 1 114 HIS n 1 115 GLY n 1 116 VAL n 1 117 LYS n 1 118 PHE n 1 119 ASP n 1 120 GLY n 1 121 ASP n 1 122 GLY n 1 123 GLN n 1 124 CYS n 1 125 VAL n 1 126 ASP n 1 127 VAL n 1 128 PRO n 1 129 SER n 1 130 SER n 1 131 PRO n 1 132 GLN n 1 133 SER n 1 134 CYS n 1 135 ALA n 1 136 ARG n 1 137 MET n 1 138 HIS n 1 139 ILE n 1 140 LYS n 1 141 GLY n 1 142 TYR n 1 143 PRO n 1 144 CYS n 1 145 VAL n 1 146 GLU n 1 147 ARG n 1 148 GLY n 1 149 GLY n 1 150 ILE n 1 151 VAL n 1 152 TRP n 1 153 THR n 1 154 TYR n 1 155 MET n 1 156 GLY n 1 157 PRO n 1 158 GLU n 1 159 GLU n 1 160 HIS n 1 161 LYS n 1 162 PRO n 1 163 SER n 1 164 PRO n 1 165 PRO n 1 166 GLU n 1 167 LEU n 1 168 GLU n 1 169 TRP n 1 170 CYS n 1 171 THR n 1 172 LEU n 1 173 PRO n 1 174 PRO n 1 175 GLU n 1 176 HIS n 1 177 VAL n 1 178 PHE n 1 179 VAL n 1 180 SER n 1 181 LYS n 1 182 ARG n 1 183 LEU n 1 184 GLN n 1 185 TYR n 1 186 SER n 1 187 ASN n 1 188 TRP n 1 189 LEU n 1 190 GLN n 1 191 ALA n 1 192 MET n 1 193 GLU n 1 194 GLY n 1 195 GLY n 1 196 ILE n 1 197 ASP n 1 198 THR n 1 199 ALA n 1 200 HIS n 1 201 VAL n 1 202 SER n 1 203 TYR n 1 204 VAL n 1 205 HIS n 1 206 ARG n 1 207 PHE n 1 208 GLU n 1 209 VAL n 1 210 ASP n 1 211 THR n 1 212 ASP n 1 213 PRO n 1 214 MET n 1 215 HIS n 1 216 GLN n 1 217 GLY n 1 218 VAL n 1 219 LYS n 1 220 ALA n 1 221 LEU n 1 222 ASP n 1 223 TYR n 1 224 ILE n 1 225 LYS n 1 226 ALA n 1 227 ASP n 1 228 GLY n 1 229 ASN n 1 230 VAL n 1 231 LYS n 1 232 PHE n 1 233 GLU n 1 234 ILE n 1 235 GLU n 1 236 GLN n 1 237 THR n 1 238 PRO n 1 239 PHE n 1 240 GLY n 1 241 LEU n 1 242 SER n 1 243 LEU n 1 244 PHE n 1 245 GLY n 1 246 ARG n 1 247 ARG n 1 248 ASN n 1 249 GLY n 1 250 GLU n 1 251 PRO n 1 252 ASP n 1 253 SER n 1 254 TYR n 1 255 TYR n 1 256 TRP n 1 257 ARG n 1 258 ILE n 1 259 THR n 1 260 GLN n 1 261 TRP n 1 262 LEU n 1 263 PHE n 1 264 PRO n 1 265 TRP n 1 266 PHE n 1 267 THR n 1 268 LEU n 1 269 ILE n 1 270 ALA n 1 271 PRO n 1 272 PHE n 1 273 GLY n 1 274 ASN n 1 275 HIS n 1 276 ALA n 1 277 LEU n 1 278 GLY n 1 279 GLY n 1 280 HIS n 1 281 VAL n 1 282 TRP n 1 283 VAL n 1 284 PRO n 1 285 ILE n 1 286 ASP n 1 287 ASP n 1 288 HIS n 1 289 ASN n 1 290 CYS n 1 291 TRP n 1 292 ALA n 1 293 TRP n 1 294 SER n 1 295 ILE n 1 296 ASN n 1 297 TRP n 1 298 GLN n 1 299 PRO n 1 300 ASP n 1 301 GLN n 1 302 PRO n 1 303 LEU n 1 304 THR n 1 305 LYS n 1 306 GLU n 1 307 GLU n 1 308 ARG n 1 309 GLN n 1 310 SER n 1 311 MET n 1 312 GLU n 1 313 GLU n 1 314 GLY n 1 315 LYS n 1 316 GLY n 1 317 ILE n 1 318 HIS n 1 319 VAL n 1 320 GLU n 1 321 TYR n 1 322 GLU n 1 323 GLU n 1 324 PRO n 1 325 GLY n 1 326 SER n 1 327 PHE n 1 328 ILE n 1 329 PRO n 1 330 LYS n 1 331 ALA n 1 332 ASN n 1 333 ARG n 1 334 ASN n 1 335 ASN n 1 336 ASP n 1 337 TYR n 1 338 GLY n 1 339 MET n 1 340 ASP n 1 341 ARG n 1 342 VAL n 1 343 ALA n 1 344 GLN n 1 345 ARG n 1 346 GLU n 1 347 GLU n 1 348 ARG n 1 349 SER n 1 350 TYR n 1 351 SER n 1 352 GLY n 1 353 ILE n 1 354 PHE n 1 355 GLY n 1 356 PHE n 1 357 SER n 1 358 ALA n 1 359 GLN n 1 360 ASP n 1 361 TYR n 1 362 SER n 1 363 LEU n 1 364 GLN n 1 365 GLU n 1 366 SER n 1 367 MET n 1 368 GLY n 1 369 PRO n 1 370 ILE n 1 371 GLN n 1 372 ASP n 1 373 HIS n 1 374 ALA n 1 375 ALA n 1 376 GLU n 1 377 ARG n 1 378 LEU n 1 379 LEU n 1 380 PRO n 1 381 THR n 1 382 ASP n 1 383 LYS n 1 384 ALA n 1 385 ILE n 1 386 VAL n 1 387 MET n 1 388 ALA n 1 389 ARG n 1 390 ARG n 1 391 MET n 1 392 LEU n 1 393 ASN n 1 394 GLU n 1 395 ALA n 1 396 ALA n 1 397 LEU n 1 398 GLY n 1 399 LEU n 1 400 GLU n 1 401 GLN n 1 402 GLY n 1 403 GLU n 1 404 THR n 1 405 PRO n 1 406 PRO n 1 407 ALA n 1 408 LEU n 1 409 ASP n 1 410 ALA n 1 411 SER n 1 412 GLU n 1 413 GLN n 1 414 HIS n 1 415 VAL n 1 416 ARG n 1 417 PRO n 1 418 ALA n 1 419 GLY n 1 420 VAL n 1 421 LEU n 1 422 LEU n 1 423 PRO n 1 424 ARG n 1 425 ASP n 1 426 GLN n 1 427 ASP n 1 428 PRO n 1 429 VAL n 1 430 ALA n 1 431 TRP n 1 432 ALA n 1 433 ARG n 1 434 GLU n 1 435 GLU n 1 436 LEU n 1 437 ALA n 1 438 ASP n 1 439 ALA n 1 440 THR n 1 441 LYS n 1 442 LYS n 1 443 PRO n 1 444 VAL n 1 445 PHE n 1 446 SER n 1 447 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 447 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CtesDRAFT_PD2139 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Comamonas testosteroni KF-1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 399795 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE2 non-polymer . 'FE (II) ION' ? 'Fe 2' 55.845 FES non-polymer . 'FE2/S2 (INORGANIC) CLUSTER' ? 'Fe2 S2' 175.820 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -22 ? ? ? A . n A 1 2 GLY 2 -21 ? ? ? A . n A 1 3 SER 3 -20 ? ? ? A . n A 1 4 SER 4 -19 ? ? ? A . n A 1 5 HIS 5 -18 ? ? ? A . n A 1 6 HIS 6 -17 ? ? ? A . n A 1 7 HIS 7 -16 ? ? ? A . n A 1 8 HIS 8 -15 -15 HIS HIS A . n A 1 9 HIS 9 -14 -14 HIS HIS A . n A 1 10 HIS 10 -13 -13 HIS HIS A . n A 1 11 SER 11 -12 -12 SER SER A . n A 1 12 SER 12 -11 -11 SER SER A . n A 1 13 GLU 13 -10 -10 GLU GLU A . n A 1 14 ASN 14 -9 -9 ASN ASN A . n A 1 15 LEU 15 -8 -8 LEU LEU A . n A 1 16 TYR 16 -7 -7 TYR TYR A . n A 1 17 PHE 17 -6 -6 PHE PHE A . n A 1 18 GLN 18 -5 -5 GLN GLN A . n A 1 19 GLY 19 -4 -4 GLY GLY A . n A 1 20 HIS 20 -3 -3 HIS HIS A . n A 1 21 MET 21 -2 -2 MET MET A . n A 1 22 ALA 22 -1 -1 ALA ALA A . n A 1 23 SER 23 0 0 SER SER A . n A 1 24 MET 24 1 1 MET MET A . n A 1 25 ASN 25 2 2 ASN ASN A . n A 1 26 LYS 26 3 3 LYS LYS A . n A 1 27 GLU 27 4 4 GLU GLU A . n A 1 28 MET 28 5 5 MET MET A . n A 1 29 SER 29 6 6 SER SER A . n A 1 30 GLU 30 7 7 GLU GLU A . n A 1 31 THR 31 8 8 THR THR A . n A 1 32 LEU 32 9 9 LEU LEU A . n A 1 33 THR 33 10 10 THR THR A . n A 1 34 ARG 34 11 11 ARG ARG A . n A 1 35 VAL 35 12 12 VAL VAL A . n A 1 36 GLY 36 13 13 GLY GLY A . n A 1 37 PRO 37 14 14 PRO PRO A . n A 1 38 ASN 38 15 15 ASN ASN A . n A 1 39 THR 39 16 16 THR THR A . n A 1 40 ARG 40 17 17 ARG ARG A . n A 1 41 MET 41 18 18 MET MET A . n A 1 42 GLY 42 19 19 GLY GLY A . n A 1 43 ASN 43 20 20 ASN ASN A . n A 1 44 LEU 44 21 21 LEU LEU A . n A 1 45 LEU 45 22 22 LEU LEU A . n A 1 46 ARG 46 23 23 ARG ARG A . n A 1 47 ARG 47 24 24 ARG ARG A . n A 1 48 TYR 48 25 25 TYR TYR A . n A 1 49 TRP 49 26 26 TRP TRP A . n A 1 50 VAL 50 27 27 VAL VAL A . n A 1 51 PRO 51 28 28 PRO PRO A . n A 1 52 ALA 52 29 29 ALA ALA A . n A 1 53 LEU 53 30 30 LEU LEU A . n A 1 54 MET 54 31 31 MET MET A . n A 1 55 SER 55 32 32 SER SER A . n A 1 56 SER 56 33 33 SER SER A . n A 1 57 GLU 57 34 34 GLU GLU A . n A 1 58 ILE 58 35 35 ILE ILE A . n A 1 59 ALA 59 36 36 ALA ALA A . n A 1 60 GLU 60 37 37 GLU GLU A . n A 1 61 ALA 61 38 38 ALA ALA A . n A 1 62 ASP 62 39 39 ASP ASP A . n A 1 63 GLY 63 40 40 GLY GLY A . n A 1 64 PRO 64 41 41 PRO PRO A . n A 1 65 GLN 65 42 42 GLN GLN A . n A 1 66 VAL 66 43 43 VAL VAL A . n A 1 67 ARG 67 44 44 ARG ARG A . n A 1 68 VAL 68 45 45 VAL VAL A . n A 1 69 GLN 69 46 46 GLN GLN A . n A 1 70 LEU 70 47 47 LEU LEU A . n A 1 71 LEU 71 48 48 LEU LEU A . n A 1 72 GLY 72 49 49 GLY GLY A . n A 1 73 GLU 73 50 50 GLU GLU A . n A 1 74 LYS 74 51 51 LYS LYS A . n A 1 75 LEU 75 52 52 LEU LEU A . n A 1 76 LEU 76 53 53 LEU LEU A . n A 1 77 ALA 77 54 54 ALA ALA A . n A 1 78 PHE 78 55 55 PHE PHE A . n A 1 79 ARG 79 56 56 ARG ARG A . n A 1 80 ASN 80 57 57 ASN ASN A . n A 1 81 THR 81 58 58 THR THR A . n A 1 82 ASP 82 59 59 ASP ASP A . n A 1 83 GLY 83 60 60 GLY GLY A . n A 1 84 LYS 84 61 61 LYS LYS A . n A 1 85 ALA 85 62 62 ALA ALA A . n A 1 86 CYS 86 63 63 CYS CYS A . n A 1 87 LEU 87 64 64 LEU LEU A . n A 1 88 ILE 88 65 65 ILE ILE A . n A 1 89 SER 89 66 66 SER SER A . n A 1 90 GLU 90 67 67 GLU GLU A . n A 1 91 PHE 91 68 68 PHE PHE A . n A 1 92 CYS 92 69 69 CYS CYS A . n A 1 93 SER 93 70 70 SER SER A . n A 1 94 HIS 94 71 71 HIS HIS A . n A 1 95 ARG 95 72 72 ARG ARG A . n A 1 96 GLY 96 73 73 GLY GLY A . n A 1 97 VAL 97 74 74 VAL VAL A . n A 1 98 SER 98 75 75 SER SER A . n A 1 99 LEU 99 76 76 LEU LEU A . n A 1 100 TYR 100 77 77 TYR TYR A . n A 1 101 PHE 101 78 78 PHE PHE A . n A 1 102 GLY 102 79 79 GLY GLY A . n A 1 103 ARG 103 80 80 ARG ARG A . n A 1 104 ASN 104 81 81 ASN ASN A . n A 1 105 GLU 105 82 82 GLU GLU A . n A 1 106 GLU 106 83 83 GLU GLU A . n A 1 107 ASN 107 84 84 ASN ASN A . n A 1 108 GLY 108 85 85 GLY GLY A . n A 1 109 ILE 109 86 86 ILE ILE A . n A 1 110 ARG 110 87 87 ARG ARG A . n A 1 111 CYS 111 88 88 CYS CYS A . n A 1 112 ALA 112 89 89 ALA ALA A . n A 1 113 TYR 113 90 90 TYR TYR A . n A 1 114 HIS 114 91 91 HIS HIS A . n A 1 115 GLY 115 92 92 GLY GLY A . n A 1 116 VAL 116 93 93 VAL VAL A . n A 1 117 LYS 117 94 94 LYS LYS A . n A 1 118 PHE 118 95 95 PHE PHE A . n A 1 119 ASP 119 96 96 ASP ASP A . n A 1 120 GLY 120 97 97 GLY GLY A . n A 1 121 ASP 121 98 98 ASP ASP A . n A 1 122 GLY 122 99 99 GLY GLY A . n A 1 123 GLN 123 100 100 GLN GLN A . n A 1 124 CYS 124 101 101 CYS CYS A . n A 1 125 VAL 125 102 102 VAL VAL A . n A 1 126 ASP 126 103 103 ASP ASP A . n A 1 127 VAL 127 104 104 VAL VAL A . n A 1 128 PRO 128 105 105 PRO PRO A . n A 1 129 SER 129 106 106 SER SER A . n A 1 130 SER 130 107 107 SER SER A . n A 1 131 PRO 131 108 108 PRO PRO A . n A 1 132 GLN 132 109 109 GLN GLN A . n A 1 133 SER 133 110 110 SER SER A . n A 1 134 CYS 134 111 111 CYS CYS A . n A 1 135 ALA 135 112 112 ALA ALA A . n A 1 136 ARG 136 113 113 ARG ARG A . n A 1 137 MET 137 114 114 MET MET A . n A 1 138 HIS 138 115 115 HIS HIS A . n A 1 139 ILE 139 116 116 ILE ILE A . n A 1 140 LYS 140 117 117 LYS LYS A . n A 1 141 GLY 141 118 118 GLY GLY A . n A 1 142 TYR 142 119 119 TYR TYR A . n A 1 143 PRO 143 120 120 PRO PRO A . n A 1 144 CYS 144 121 121 CYS CYS A . n A 1 145 VAL 145 122 122 VAL VAL A . n A 1 146 GLU 146 123 123 GLU GLU A . n A 1 147 ARG 147 124 124 ARG ARG A . n A 1 148 GLY 148 125 125 GLY GLY A . n A 1 149 GLY 149 126 126 GLY GLY A . n A 1 150 ILE 150 127 127 ILE ILE A . n A 1 151 VAL 151 128 128 VAL VAL A . n A 1 152 TRP 152 129 129 TRP TRP A . n A 1 153 THR 153 130 130 THR THR A . n A 1 154 TYR 154 131 131 TYR TYR A . n A 1 155 MET 155 132 132 MET MET A . n A 1 156 GLY 156 133 133 GLY GLY A . n A 1 157 PRO 157 134 134 PRO PRO A . n A 1 158 GLU 158 135 135 GLU GLU A . n A 1 159 GLU 159 136 136 GLU GLU A . n A 1 160 HIS 160 137 137 HIS HIS A . n A 1 161 LYS 161 138 138 LYS LYS A . n A 1 162 PRO 162 139 139 PRO PRO A . n A 1 163 SER 163 140 140 SER SER A . n A 1 164 PRO 164 141 141 PRO PRO A . n A 1 165 PRO 165 142 142 PRO PRO A . n A 1 166 GLU 166 143 143 GLU GLU A . n A 1 167 LEU 167 144 144 LEU LEU A . n A 1 168 GLU 168 145 145 GLU GLU A . n A 1 169 TRP 169 146 146 TRP TRP A . n A 1 170 CYS 170 147 147 CYS CYS A . n A 1 171 THR 171 148 148 THR THR A . n A 1 172 LEU 172 149 149 LEU LEU A . n A 1 173 PRO 173 150 150 PRO PRO A . n A 1 174 PRO 174 151 151 PRO PRO A . n A 1 175 GLU 175 152 152 GLU GLU A . n A 1 176 HIS 176 153 153 HIS HIS A . n A 1 177 VAL 177 154 154 VAL VAL A . n A 1 178 PHE 178 155 155 PHE PHE A . n A 1 179 VAL 179 156 156 VAL VAL A . n A 1 180 SER 180 157 157 SER SER A . n A 1 181 LYS 181 158 158 LYS LYS A . n A 1 182 ARG 182 159 159 ARG ARG A . n A 1 183 LEU 183 160 160 LEU LEU A . n A 1 184 GLN 184 161 161 GLN GLN A . n A 1 185 TYR 185 162 162 TYR TYR A . n A 1 186 SER 186 163 163 SER SER A . n A 1 187 ASN 187 164 164 ASN ASN A . n A 1 188 TRP 188 165 165 TRP TRP A . n A 1 189 LEU 189 166 166 LEU LEU A . n A 1 190 GLN 190 167 167 GLN GLN A . n A 1 191 ALA 191 168 168 ALA ALA A . n A 1 192 MET 192 169 169 MET MET A . n A 1 193 GLU 193 170 170 GLU GLU A . n A 1 194 GLY 194 171 171 GLY GLY A . n A 1 195 GLY 195 172 172 GLY GLY A . n A 1 196 ILE 196 173 173 ILE ILE A . n A 1 197 ASP 197 174 174 ASP ASP A . n A 1 198 THR 198 175 175 THR THR A . n A 1 199 ALA 199 176 176 ALA ALA A . n A 1 200 HIS 200 177 177 HIS HIS A . n A 1 201 VAL 201 178 178 VAL VAL A . n A 1 202 SER 202 179 179 SER SER A . n A 1 203 TYR 203 180 180 TYR TYR A . n A 1 204 VAL 204 181 181 VAL VAL A . n A 1 205 HIS 205 182 182 HIS HIS A . n A 1 206 ARG 206 183 183 ARG ARG A . n A 1 207 PHE 207 184 184 PHE PHE A . n A 1 208 GLU 208 185 185 GLU GLU A . n A 1 209 VAL 209 186 186 VAL VAL A . n A 1 210 ASP 210 187 187 ASP ASP A . n A 1 211 THR 211 188 188 THR THR A . n A 1 212 ASP 212 189 189 ASP ASP A . n A 1 213 PRO 213 190 190 PRO PRO A . n A 1 214 MET 214 191 191 MET MET A . n A 1 215 HIS 215 192 192 HIS HIS A . n A 1 216 GLN 216 193 193 GLN GLN A . n A 1 217 GLY 217 194 194 GLY GLY A . n A 1 218 VAL 218 195 195 VAL VAL A . n A 1 219 LYS 219 196 196 LYS LYS A . n A 1 220 ALA 220 197 197 ALA ALA A . n A 1 221 LEU 221 198 198 LEU LEU A . n A 1 222 ASP 222 199 199 ASP ASP A . n A 1 223 TYR 223 200 200 TYR TYR A . n A 1 224 ILE 224 201 201 ILE ILE A . n A 1 225 LYS 225 202 202 LYS LYS A . n A 1 226 ALA 226 203 203 ALA ALA A . n A 1 227 ASP 227 204 204 ASP ASP A . n A 1 228 GLY 228 205 205 GLY GLY A . n A 1 229 ASN 229 206 206 ASN ASN A . n A 1 230 VAL 230 207 207 VAL VAL A . n A 1 231 LYS 231 208 208 LYS LYS A . n A 1 232 PHE 232 209 209 PHE PHE A . n A 1 233 GLU 233 210 210 GLU GLU A . n A 1 234 ILE 234 211 211 ILE ILE A . n A 1 235 GLU 235 212 212 GLU GLU A . n A 1 236 GLN 236 213 213 GLN GLN A . n A 1 237 THR 237 214 214 THR THR A . n A 1 238 PRO 238 215 215 PRO PRO A . n A 1 239 PHE 239 216 216 PHE PHE A . n A 1 240 GLY 240 217 217 GLY GLY A . n A 1 241 LEU 241 218 218 LEU LEU A . n A 1 242 SER 242 219 219 SER SER A . n A 1 243 LEU 243 220 220 LEU LEU A . n A 1 244 PHE 244 221 221 PHE PHE A . n A 1 245 GLY 245 222 222 GLY GLY A . n A 1 246 ARG 246 223 223 ARG ARG A . n A 1 247 ARG 247 224 224 ARG ARG A . n A 1 248 ASN 248 225 225 ASN ASN A . n A 1 249 GLY 249 226 226 GLY GLY A . n A 1 250 GLU 250 227 227 GLU GLU A . n A 1 251 PRO 251 228 228 PRO PRO A . n A 1 252 ASP 252 229 229 ASP ASP A . n A 1 253 SER 253 230 230 SER SER A . n A 1 254 TYR 254 231 231 TYR TYR A . n A 1 255 TYR 255 232 232 TYR TYR A . n A 1 256 TRP 256 233 233 TRP TRP A . n A 1 257 ARG 257 234 234 ARG ARG A . n A 1 258 ILE 258 235 235 ILE ILE A . n A 1 259 THR 259 236 236 THR THR A . n A 1 260 GLN 260 237 237 GLN GLN A . n A 1 261 TRP 261 238 238 TRP TRP A . n A 1 262 LEU 262 239 239 LEU LEU A . n A 1 263 PHE 263 240 240 PHE PHE A . n A 1 264 PRO 264 241 241 PRO PRO A . n A 1 265 TRP 265 242 242 TRP TRP A . n A 1 266 PHE 266 243 243 PHE PHE A . n A 1 267 THR 267 244 244 THR THR A . n A 1 268 LEU 268 245 245 LEU LEU A . n A 1 269 ILE 269 246 246 ILE ILE A . n A 1 270 ALA 270 247 247 ALA ALA A . n A 1 271 PRO 271 248 248 PRO PRO A . n A 1 272 PHE 272 249 249 PHE PHE A . n A 1 273 GLY 273 250 250 GLY GLY A . n A 1 274 ASN 274 251 251 ASN ASN A . n A 1 275 HIS 275 252 252 HIS HIS A . n A 1 276 ALA 276 253 253 ALA ALA A . n A 1 277 LEU 277 254 254 LEU LEU A . n A 1 278 GLY 278 255 255 GLY GLY A . n A 1 279 GLY 279 256 256 GLY GLY A . n A 1 280 HIS 280 257 257 HIS HIS A . n A 1 281 VAL 281 258 258 VAL VAL A . n A 1 282 TRP 282 259 259 TRP TRP A . n A 1 283 VAL 283 260 260 VAL VAL A . n A 1 284 PRO 284 261 261 PRO PRO A . n A 1 285 ILE 285 262 262 ILE ILE A . n A 1 286 ASP 286 263 263 ASP ASP A . n A 1 287 ASP 287 264 264 ASP ASP A . n A 1 288 HIS 288 265 265 HIS HIS A . n A 1 289 ASN 289 266 266 ASN ASN A . n A 1 290 CYS 290 267 267 CYS CYS A . n A 1 291 TRP 291 268 268 TRP TRP A . n A 1 292 ALA 292 269 269 ALA ALA A . n A 1 293 TRP 293 270 270 TRP TRP A . n A 1 294 SER 294 271 271 SER SER A . n A 1 295 ILE 295 272 272 ILE ILE A . n A 1 296 ASN 296 273 273 ASN ASN A . n A 1 297 TRP 297 274 274 TRP TRP A . n A 1 298 GLN 298 275 275 GLN GLN A . n A 1 299 PRO 299 276 276 PRO PRO A . n A 1 300 ASP 300 277 277 ASP ASP A . n A 1 301 GLN 301 278 278 GLN GLN A . n A 1 302 PRO 302 279 279 PRO PRO A . n A 1 303 LEU 303 280 280 LEU LEU A . n A 1 304 THR 304 281 281 THR THR A . n A 1 305 LYS 305 282 282 LYS LYS A . n A 1 306 GLU 306 283 283 GLU GLU A . n A 1 307 GLU 307 284 284 GLU GLU A . n A 1 308 ARG 308 285 285 ARG ARG A . n A 1 309 GLN 309 286 286 GLN GLN A . n A 1 310 SER 310 287 287 SER SER A . n A 1 311 MET 311 288 288 MET MET A . n A 1 312 GLU 312 289 289 GLU GLU A . n A 1 313 GLU 313 290 290 GLU GLU A . n A 1 314 GLY 314 291 291 GLY GLY A . n A 1 315 LYS 315 292 292 LYS LYS A . n A 1 316 GLY 316 293 293 GLY GLY A . n A 1 317 ILE 317 294 294 ILE ILE A . n A 1 318 HIS 318 295 295 HIS HIS A . n A 1 319 VAL 319 296 296 VAL VAL A . n A 1 320 GLU 320 297 297 GLU GLU A . n A 1 321 TYR 321 298 298 TYR TYR A . n A 1 322 GLU 322 299 299 GLU GLU A . n A 1 323 GLU 323 300 300 GLU GLU A . n A 1 324 PRO 324 301 301 PRO PRO A . n A 1 325 GLY 325 302 302 GLY GLY A . n A 1 326 SER 326 303 303 SER SER A . n A 1 327 PHE 327 304 304 PHE PHE A . n A 1 328 ILE 328 305 305 ILE ILE A . n A 1 329 PRO 329 306 306 PRO PRO A . n A 1 330 LYS 330 307 307 LYS LYS A . n A 1 331 ALA 331 308 308 ALA ALA A . n A 1 332 ASN 332 309 309 ASN ASN A . n A 1 333 ARG 333 310 310 ARG ARG A . n A 1 334 ASN 334 311 311 ASN ASN A . n A 1 335 ASN 335 312 312 ASN ASN A . n A 1 336 ASP 336 313 313 ASP ASP A . n A 1 337 TYR 337 314 314 TYR TYR A . n A 1 338 GLY 338 315 315 GLY GLY A . n A 1 339 MET 339 316 316 MET MET A . n A 1 340 ASP 340 317 317 ASP ASP A . n A 1 341 ARG 341 318 318 ARG ARG A . n A 1 342 VAL 342 319 319 VAL VAL A . n A 1 343 ALA 343 320 320 ALA ALA A . n A 1 344 GLN 344 321 321 GLN GLN A . n A 1 345 ARG 345 322 322 ARG ARG A . n A 1 346 GLU 346 323 323 GLU GLU A . n A 1 347 GLU 347 324 324 GLU GLU A . n A 1 348 ARG 348 325 325 ARG ARG A . n A 1 349 SER 349 326 326 SER SER A . n A 1 350 TYR 350 327 327 TYR TYR A . n A 1 351 SER 351 328 328 SER SER A . n A 1 352 GLY 352 329 329 GLY GLY A . n A 1 353 ILE 353 330 330 ILE ILE A . n A 1 354 PHE 354 331 331 PHE PHE A . n A 1 355 GLY 355 332 332 GLY GLY A . n A 1 356 PHE 356 333 333 PHE PHE A . n A 1 357 SER 357 334 334 SER SER A . n A 1 358 ALA 358 335 335 ALA ALA A . n A 1 359 GLN 359 336 336 GLN GLN A . n A 1 360 ASP 360 337 337 ASP ASP A . n A 1 361 TYR 361 338 338 TYR TYR A . n A 1 362 SER 362 339 339 SER SER A . n A 1 363 LEU 363 340 340 LEU LEU A . n A 1 364 GLN 364 341 341 GLN GLN A . n A 1 365 GLU 365 342 342 GLU GLU A . n A 1 366 SER 366 343 343 SER SER A . n A 1 367 MET 367 344 344 MET MET A . n A 1 368 GLY 368 345 345 GLY GLY A . n A 1 369 PRO 369 346 346 PRO PRO A . n A 1 370 ILE 370 347 347 ILE ILE A . n A 1 371 GLN 371 348 348 GLN GLN A . n A 1 372 ASP 372 349 349 ASP ASP A . n A 1 373 HIS 373 350 350 HIS HIS A . n A 1 374 ALA 374 351 351 ALA ALA A . n A 1 375 ALA 375 352 352 ALA ALA A . n A 1 376 GLU 376 353 353 GLU GLU A . n A 1 377 ARG 377 354 354 ARG ARG A . n A 1 378 LEU 378 355 355 LEU LEU A . n A 1 379 LEU 379 356 356 LEU LEU A . n A 1 380 PRO 380 357 357 PRO PRO A . n A 1 381 THR 381 358 358 THR THR A . n A 1 382 ASP 382 359 359 ASP ASP A . n A 1 383 LYS 383 360 360 LYS LYS A . n A 1 384 ALA 384 361 361 ALA ALA A . n A 1 385 ILE 385 362 362 ILE ILE A . n A 1 386 VAL 386 363 363 VAL VAL A . n A 1 387 MET 387 364 364 MET MET A . n A 1 388 ALA 388 365 365 ALA ALA A . n A 1 389 ARG 389 366 366 ARG ARG A . n A 1 390 ARG 390 367 367 ARG ARG A . n A 1 391 MET 391 368 368 MET MET A . n A 1 392 LEU 392 369 369 LEU LEU A . n A 1 393 ASN 393 370 370 ASN ASN A . n A 1 394 GLU 394 371 371 GLU GLU A . n A 1 395 ALA 395 372 372 ALA ALA A . n A 1 396 ALA 396 373 373 ALA ALA A . n A 1 397 LEU 397 374 374 LEU LEU A . n A 1 398 GLY 398 375 375 GLY GLY A . n A 1 399 LEU 399 376 376 LEU LEU A . n A 1 400 GLU 400 377 377 GLU GLU A . n A 1 401 GLN 401 378 378 GLN GLN A . n A 1 402 GLY 402 379 379 GLY GLY A . n A 1 403 GLU 403 380 380 GLU GLU A . n A 1 404 THR 404 381 381 THR THR A . n A 1 405 PRO 405 382 382 PRO PRO A . n A 1 406 PRO 406 383 383 PRO PRO A . n A 1 407 ALA 407 384 384 ALA ALA A . n A 1 408 LEU 408 385 385 LEU LEU A . n A 1 409 ASP 409 386 386 ASP ASP A . n A 1 410 ALA 410 387 387 ALA ALA A . n A 1 411 SER 411 388 388 SER SER A . n A 1 412 GLU 412 389 389 GLU GLU A . n A 1 413 GLN 413 390 390 GLN GLN A . n A 1 414 HIS 414 391 391 HIS HIS A . n A 1 415 VAL 415 392 392 VAL VAL A . n A 1 416 ARG 416 393 393 ARG ARG A . n A 1 417 PRO 417 394 394 PRO PRO A . n A 1 418 ALA 418 395 395 ALA ALA A . n A 1 419 GLY 419 396 396 GLY GLY A . n A 1 420 VAL 420 397 397 VAL VAL A . n A 1 421 LEU 421 398 398 LEU LEU A . n A 1 422 LEU 422 399 399 LEU LEU A . n A 1 423 PRO 423 400 400 PRO PRO A . n A 1 424 ARG 424 401 401 ARG ARG A . n A 1 425 ASP 425 402 402 ASP ASP A . n A 1 426 GLN 426 403 403 GLN GLN A . n A 1 427 ASP 427 404 404 ASP ASP A . n A 1 428 PRO 428 405 405 PRO PRO A . n A 1 429 VAL 429 406 406 VAL VAL A . n A 1 430 ALA 430 407 407 ALA ALA A . n A 1 431 TRP 431 408 408 TRP TRP A . n A 1 432 ALA 432 409 409 ALA ALA A . n A 1 433 ARG 433 410 410 ARG ARG A . n A 1 434 GLU 434 411 411 GLU GLU A . n A 1 435 GLU 435 412 412 GLU GLU A . n A 1 436 LEU 436 413 413 LEU LEU A . n A 1 437 ALA 437 414 414 ALA ALA A . n A 1 438 ASP 438 415 415 ASP ASP A . n A 1 439 ALA 439 416 416 ALA ALA A . n A 1 440 THR 440 417 417 THR THR A . n A 1 441 LYS 441 418 418 LYS LYS A . n A 1 442 LYS 442 419 419 LYS LYS A . n A 1 443 PRO 443 420 420 PRO PRO A . n A 1 444 VAL 444 421 421 VAL VAL A . n A 1 445 PHE 445 422 422 PHE PHE A . n A 1 446 SER 446 423 423 SER SER A . n A 1 447 LEU 447 424 424 LEU LEU A . n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 FE2 ? ? FE2 ? ? 'SUBJECT OF INVESTIGATION' ? 2 FES ? ? FES ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FE2 1 501 502 FE2 FE2 A . C 3 FES 1 502 503 FES FES A . D 4 HOH 1 601 6 HOH HOH A . D 4 HOH 2 602 1 HOH HOH A . D 4 HOH 3 603 4 HOH HOH A . D 4 HOH 4 604 7 HOH HOH A . D 4 HOH 5 605 5 HOH HOH A . D 4 HOH 6 606 2 HOH HOH A . D 4 HOH 7 607 3 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0419 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9INA _cell.details ? _cell.formula_units_Z ? _cell.length_a 150.740 _cell.length_a_esd ? _cell.length_b 150.740 _cell.length_b_esd ? _cell.length_c 150.740 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9INA _symmetry.cell_setting ? _symmetry.Int_Tables_number 198 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 3' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9INA _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 5.68 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 78.36 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% PEG3350, 0.2 M potassium thiocyanate, 0.1 M tris-HCl pH 7.0' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-09-07 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ELETTRA BEAMLINE 11.2C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 11.2C _diffrn_source.pdbx_synchrotron_site ELETTRA # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9INA _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.96 _reflns.d_resolution_low 106.82 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 23991 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 1.9 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.96 _reflns_shell.d_res_low 3.14 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.5 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 3849 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.809 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.00 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.00 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 0.00 _refine.B_iso_max ? _refine.B_iso_mean 77.384 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.895 _refine.correlation_coeff_Fo_to_Fc_free 0.936 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9INA _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.96 _refine.ls_d_res_low 106.82 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 22785 _refine.ls_number_reflns_R_free 1206 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.99 _refine.ls_percent_reflns_R_free 5.0 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.17640 _refine.ls_R_factor_R_free 0.20571 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.17484 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.337 _refine.pdbx_overall_ESU_R_Free 0.244 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 10.812 _refine.overall_SU_ML 0.189 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 2.96 _refine_hist.d_res_low 106.82 _refine_hist.number_atoms_solvent 7 _refine_hist.number_atoms_total 3526 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 3514 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 0.012 3632 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.016 3260 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 2.034 1.832 4929 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.675 1.764 7527 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 8.346 5.000 440 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 9.763 5.000 27 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 19.067 10.000 581 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.092 0.200 496 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 4415 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 873 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 5.935 7.445 1763 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 5.910 7.446 1763 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 8.027 13.411 2202 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 8.026 13.414 2203 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 7.904 8.098 1869 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 7.913 8.103 1866 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 11.034 14.543 2724 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 12.044 73.43 3890 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 12.048 73.43 3891 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.964 _refine_ls_shell.d_res_low 3.041 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 91 _refine_ls_shell.number_reflns_R_work 1679 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.287 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.323 # _struct.entry_id 9INA _struct.title 'Crystal Structure of isophthalate dioxygenase from Comamonas testosteroni KF1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9INA _struct_keywords.text 'dioxygenase, bacterial protein, metalloprotein, Rieske domain, oxidoreductase' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B7WRK8_COMTK _struct_ref.pdbx_db_accession B7WRK8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNKEMSETLTRVGPNTRMGNLLRRYWVPALMSSEIAEADGPQVRVQLLGEKLLAFRNTDGKACLISEFCSHRGVSLYFGR NEENGIRCAYHGVKFDGDGQCVDVPSSPQSCARMHIKGYPCVERGGIVWTYMGPEEHKPSPPELEWCTLPPEHVFVSKRL QYSNWLQAMEGGIDTAHVSYVHRFEVDTDPMHQGVKALDYIKADGNVKFEIEQTPFGLSLFGRRNGEPDSYYWRITQWLF PWFTLIAPFGNHALGGHVWVPIDDHNCWAWSINWQPDQPLTKEERQSMEEGKGIHVEYEEPGSFIPKANRNNDYGMDRVA QREERSYSGIFGFSAQDYSLQESMGPIQDHAAERLLPTDKAIVMARRMLNEAALGLEQGETPPALDASEQHVRPAGVLLP RDQDPVAWAREELADATKKPVFSL ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9INA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 24 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 447 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B7WRK8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 424 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 424 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 9INA MET A 1 ? UNP B7WRK8 ? ? 'initiating methionine' -22 1 1 9INA GLY A 2 ? UNP B7WRK8 ? ? 'expression tag' -21 2 1 9INA SER A 3 ? UNP B7WRK8 ? ? 'expression tag' -20 3 1 9INA SER A 4 ? UNP B7WRK8 ? ? 'expression tag' -19 4 1 9INA HIS A 5 ? UNP B7WRK8 ? ? 'expression tag' -18 5 1 9INA HIS A 6 ? UNP B7WRK8 ? ? 'expression tag' -17 6 1 9INA HIS A 7 ? UNP B7WRK8 ? ? 'expression tag' -16 7 1 9INA HIS A 8 ? UNP B7WRK8 ? ? 'expression tag' -15 8 1 9INA HIS A 9 ? UNP B7WRK8 ? ? 'expression tag' -14 9 1 9INA HIS A 10 ? UNP B7WRK8 ? ? 'expression tag' -13 10 1 9INA SER A 11 ? UNP B7WRK8 ? ? 'expression tag' -12 11 1 9INA SER A 12 ? UNP B7WRK8 ? ? 'expression tag' -11 12 1 9INA GLU A 13 ? UNP B7WRK8 ? ? 'expression tag' -10 13 1 9INA ASN A 14 ? UNP B7WRK8 ? ? 'expression tag' -9 14 1 9INA LEU A 15 ? UNP B7WRK8 ? ? 'expression tag' -8 15 1 9INA TYR A 16 ? UNP B7WRK8 ? ? 'expression tag' -7 16 1 9INA PHE A 17 ? UNP B7WRK8 ? ? 'expression tag' -6 17 1 9INA GLN A 18 ? UNP B7WRK8 ? ? 'expression tag' -5 18 1 9INA GLY A 19 ? UNP B7WRK8 ? ? 'expression tag' -4 19 1 9INA HIS A 20 ? UNP B7WRK8 ? ? 'expression tag' -3 20 1 9INA MET A 21 ? UNP B7WRK8 ? ? 'expression tag' -2 21 1 9INA ALA A 22 ? UNP B7WRK8 ? ? 'expression tag' -1 22 1 9INA SER A 23 ? UNP B7WRK8 ? ? 'expression tag' 0 23 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 9320 ? 1 MORE -111 ? 1 'SSA (A^2)' 49680 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_555 z+1/2,-x+1/2,-y 0.0000000000 0.0000000000 1.0000000000 75.3700000000 -1.0000000000 0.0000000000 0.0000000000 75.3700000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 3 'crystal symmetry operation' 12_554 -y+1/2,-z,x-1/2 0.0000000000 -1.0000000000 0.0000000000 75.3700000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -75.3700000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 25 ? ARG A 34 ? ASN A 2 ARG A 11 1 ? 10 HELX_P HELX_P2 AA2 THR A 39 ? ARG A 47 ? THR A 16 ARG A 24 1 ? 9 HELX_P HELX_P3 AA3 SER A 56 ? ALA A 59 ? SER A 33 ALA A 36 5 ? 4 HELX_P HELX_P4 AA4 SER A 98 ? GLY A 102 ? SER A 75 GLY A 79 5 ? 5 HELX_P HELX_P5 AA5 SER A 130 ? MET A 137 ? SER A 107 MET A 114 5 ? 8 HELX_P HELX_P6 AA6 PRO A 157 ? LYS A 161 ? PRO A 134 LYS A 138 5 ? 5 HELX_P HELX_P7 AA7 LEU A 167 ? LEU A 172 ? LEU A 144 LEU A 149 1 ? 6 HELX_P HELX_P8 AA8 PRO A 173 ? GLU A 175 ? PRO A 150 GLU A 152 5 ? 3 HELX_P HELX_P9 AA9 ASN A 187 ? GLY A 194 ? ASN A 164 GLY A 171 1 ? 8 HELX_P HELX_P10 AB1 GLY A 195 ? ILE A 196 ? GLY A 172 ILE A 173 5 ? 2 HELX_P HELX_P11 AB2 ASP A 197 ? TYR A 203 ? ASP A 174 TYR A 180 5 ? 7 HELX_P HELX_P12 AB3 PHE A 207 ? ASP A 212 ? PHE A 184 ASP A 189 1 ? 6 HELX_P HELX_P13 AB4 LYS A 219 ? ALA A 226 ? LYS A 196 ALA A 203 1 ? 8 HELX_P HELX_P14 AB5 THR A 304 ? GLU A 313 ? THR A 281 GLU A 290 1 ? 10 HELX_P HELX_P15 AB6 ASN A 335 ? MET A 339 ? ASN A 312 MET A 316 5 ? 5 HELX_P HELX_P16 AB7 ASP A 340 ? GLU A 346 ? ASP A 317 GLU A 323 1 ? 7 HELX_P HELX_P17 AB8 GLY A 355 ? SER A 366 ? GLY A 332 SER A 343 1 ? 12 HELX_P HELX_P18 AB9 LEU A 379 ? THR A 381 ? LEU A 356 THR A 358 5 ? 3 HELX_P HELX_P19 AC1 ASP A 382 ? GLN A 401 ? ASP A 359 GLN A 378 1 ? 20 HELX_P HELX_P20 AC2 ASP A 409 ? HIS A 414 ? ASP A 386 HIS A 391 5 ? 6 HELX_P HELX_P21 AC3 ASP A 427 ? LEU A 436 ? ASP A 404 LEU A 413 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 92 SG ? ? ? 1_555 C FES . FE2 ? ? A CYS 69 A FES 502 1_555 ? ? ? ? ? ? ? 2.217 ? ? metalc2 metalc ? ? A HIS 94 ND1 ? ? ? 1_555 C FES . FE1 ? ? A HIS 71 A FES 502 1_555 ? ? ? ? ? ? ? 2.046 ? ? metalc3 metalc ? ? A CYS 111 SG ? ? ? 1_555 C FES . FE2 ? ? A CYS 88 A FES 502 1_555 ? ? ? ? ? ? ? 2.206 ? ? metalc4 metalc ? ? A HIS 114 ND1 ? ? ? 1_555 C FES . FE1 ? ? A HIS 91 A FES 502 1_555 ? ? ? ? ? ? ? 1.961 ? ? metalc5 metalc ? ? A HIS 200 NE2 ? ? ? 1_555 B FE2 . FE ? ? A HIS 177 A FE2 501 1_555 ? ? ? ? ? ? ? 1.813 ? ? metalc6 metalc ? ? A HIS 205 NE2 ? ? ? 1_555 B FE2 . FE ? ? A HIS 182 A FE2 501 1_555 ? ? ? ? ? ? ? 2.076 ? ? metalc7 metalc ? ? A ASP 360 OD2 ? ? ? 1_555 B FE2 . FE ? ? A ASP 337 A FE2 501 1_555 ? ? ? ? ? ? ? 1.825 ? ? metalc8 metalc ? ? B FE2 . FE ? ? ? 1_555 D HOH . O ? ? A FE2 501 A HOH 606 1_555 ? ? ? ? ? ? ? 2.794 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 92 ? A CYS 69 ? 1_555 FE2 ? C FES . ? A FES 502 ? 1_555 S1 ? C FES . ? A FES 502 ? 1_555 108.3 ? 2 SG ? A CYS 92 ? A CYS 69 ? 1_555 FE2 ? C FES . ? A FES 502 ? 1_555 S2 ? C FES . ? A FES 502 ? 1_555 111.6 ? 3 S1 ? C FES . ? A FES 502 ? 1_555 FE2 ? C FES . ? A FES 502 ? 1_555 S2 ? C FES . ? A FES 502 ? 1_555 104.6 ? 4 SG ? A CYS 92 ? A CYS 69 ? 1_555 FE2 ? C FES . ? A FES 502 ? 1_555 SG ? A CYS 111 ? A CYS 88 ? 1_555 108.4 ? 5 S1 ? C FES . ? A FES 502 ? 1_555 FE2 ? C FES . ? A FES 502 ? 1_555 SG ? A CYS 111 ? A CYS 88 ? 1_555 106.2 ? 6 S2 ? C FES . ? A FES 502 ? 1_555 FE2 ? C FES . ? A FES 502 ? 1_555 SG ? A CYS 111 ? A CYS 88 ? 1_555 117.3 ? 7 ND1 ? A HIS 94 ? A HIS 71 ? 1_555 FE1 ? C FES . ? A FES 502 ? 1_555 S1 ? C FES . ? A FES 502 ? 1_555 108.6 ? 8 ND1 ? A HIS 94 ? A HIS 71 ? 1_555 FE1 ? C FES . ? A FES 502 ? 1_555 S2 ? C FES . ? A FES 502 ? 1_555 108.7 ? 9 S1 ? C FES . ? A FES 502 ? 1_555 FE1 ? C FES . ? A FES 502 ? 1_555 S2 ? C FES . ? A FES 502 ? 1_555 101.3 ? 10 ND1 ? A HIS 94 ? A HIS 71 ? 1_555 FE1 ? C FES . ? A FES 502 ? 1_555 ND1 ? A HIS 114 ? A HIS 91 ? 1_555 95.7 ? 11 S1 ? C FES . ? A FES 502 ? 1_555 FE1 ? C FES . ? A FES 502 ? 1_555 ND1 ? A HIS 114 ? A HIS 91 ? 1_555 114.1 ? 12 S2 ? C FES . ? A FES 502 ? 1_555 FE1 ? C FES . ? A FES 502 ? 1_555 ND1 ? A HIS 114 ? A HIS 91 ? 1_555 127.4 ? 13 NE2 ? A HIS 200 ? A HIS 177 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 NE2 ? A HIS 205 ? A HIS 182 ? 1_555 89.6 ? 14 NE2 ? A HIS 200 ? A HIS 177 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 OD2 ? A ASP 360 ? A ASP 337 ? 1_555 104.9 ? 15 NE2 ? A HIS 205 ? A HIS 182 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 OD2 ? A ASP 360 ? A ASP 337 ? 1_555 87.5 ? 16 NE2 ? A HIS 200 ? A HIS 177 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 O ? D HOH . ? A HOH 606 ? 1_555 130.9 ? 17 NE2 ? A HIS 205 ? A HIS 182 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 O ? D HOH . ? A HOH 606 ? 1_555 98.3 ? 18 OD2 ? A ASP 360 ? A ASP 337 ? 1_555 FE ? B FE2 . ? A FE2 501 ? 1_555 O ? D HOH . ? A HOH 606 ? 1_555 123.7 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PHE _struct_mon_prot_cis.label_seq_id 263 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PHE _struct_mon_prot_cis.auth_seq_id 240 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 264 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 241 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -4.73 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 3 ? AA3 ? 4 ? AA4 ? 4 ? AA5 ? 7 ? AA6 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA5 3 4 ? anti-parallel AA5 4 5 ? anti-parallel AA5 5 6 ? anti-parallel AA5 6 7 ? anti-parallel AA6 1 2 ? anti-parallel AA6 2 3 ? anti-parallel AA6 3 4 ? anti-parallel AA6 4 5 ? anti-parallel AA6 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 16 ? PHE A 17 ? TYR A -7 PHE A -6 AA1 2 HIS A 20 ? MET A 21 ? HIS A -3 MET A -2 AA2 1 VAL A 50 ? MET A 54 ? VAL A 27 MET A 31 AA2 2 ILE A 150 ? THR A 153 ? ILE A 127 THR A 130 AA2 3 CYS A 144 ? ARG A 147 ? CYS A 121 ARG A 124 AA3 1 VAL A 66 ? LEU A 70 ? VAL A 43 LEU A 47 AA3 2 GLU A 73 ? ARG A 79 ? GLU A 50 ARG A 56 AA3 3 ALA A 85 ? SER A 89 ? ALA A 62 SER A 66 AA3 4 GLY A 141 ? TYR A 142 ? GLY A 118 TYR A 119 AA4 1 ARG A 103 ? ASN A 104 ? ARG A 80 ASN A 81 AA4 2 ILE A 109 ? ARG A 110 ? ILE A 86 ARG A 87 AA4 3 LYS A 117 ? PHE A 118 ? LYS A 94 PHE A 95 AA4 4 CYS A 124 ? ASP A 126 ? CYS A 101 ASP A 103 AA5 1 VAL A 177 ? GLN A 184 ? VAL A 154 GLN A 161 AA5 2 CYS A 290 ? TRP A 297 ? CYS A 267 TRP A 274 AA5 3 LEU A 277 ? PRO A 284 ? LEU A 254 PRO A 261 AA5 4 PHE A 266 ? ILE A 269 ? PHE A 243 ILE A 246 AA5 5 SER A 253 ? LEU A 262 ? SER A 230 LEU A 239 AA5 6 GLY A 240 ? ASN A 248 ? GLY A 217 ASN A 225 AA5 7 LYS A 231 ? THR A 237 ? LYS A 208 THR A 214 AA6 1 VAL A 177 ? GLN A 184 ? VAL A 154 GLN A 161 AA6 2 CYS A 290 ? TRP A 297 ? CYS A 267 TRP A 274 AA6 3 LEU A 277 ? PRO A 284 ? LEU A 254 PRO A 261 AA6 4 PHE A 266 ? ILE A 269 ? PHE A 243 ILE A 246 AA6 5 SER A 253 ? LEU A 262 ? SER A 230 LEU A 239 AA6 6 ALA A 418 ? PRO A 423 ? ALA A 395 PRO A 400 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 17 ? N PHE A -6 O HIS A 20 ? O HIS A -3 AA2 1 2 N LEU A 53 ? N LEU A 30 O VAL A 151 ? O VAL A 128 AA2 2 3 O TRP A 152 ? O TRP A 129 N VAL A 145 ? N VAL A 122 AA3 1 2 N VAL A 68 ? N VAL A 45 O LEU A 75 ? O LEU A 52 AA3 2 3 N PHE A 78 ? N PHE A 55 O CYS A 86 ? O CYS A 63 AA3 3 4 N LEU A 87 ? N LEU A 64 O TYR A 142 ? O TYR A 119 AA4 1 2 N ARG A 103 ? N ARG A 80 O ARG A 110 ? O ARG A 87 AA4 2 3 N ILE A 109 ? N ILE A 86 O PHE A 118 ? O PHE A 95 AA4 3 4 N LYS A 117 ? N LYS A 94 O VAL A 125 ? O VAL A 102 AA5 1 2 N ARG A 182 ? N ARG A 159 O ALA A 292 ? O ALA A 269 AA5 2 3 O ILE A 295 ? O ILE A 272 N GLY A 279 ? N GLY A 256 AA5 3 4 O GLY A 278 ? O GLY A 255 N ILE A 269 ? N ILE A 246 AA5 4 5 O PHE A 266 ? O PHE A 243 N LEU A 262 ? N LEU A 239 AA5 5 6 O ARG A 257 ? O ARG A 234 N GLY A 245 ? N GLY A 222 AA5 6 7 O PHE A 244 ? O PHE A 221 N GLU A 233 ? N GLU A 210 AA6 1 2 N ARG A 182 ? N ARG A 159 O ALA A 292 ? O ALA A 269 AA6 2 3 O ILE A 295 ? O ILE A 272 N GLY A 279 ? N GLY A 256 AA6 3 4 O GLY A 278 ? O GLY A 255 N ILE A 269 ? N ILE A 246 AA6 4 5 O PHE A 266 ? O PHE A 243 N LEU A 262 ? N LEU A 239 AA6 5 6 N ILE A 258 ? N ILE A 235 O ALA A 418 ? O ALA A 395 # _pdbx_entry_details.entry_id 9INA _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 NH2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ARG _pdbx_validate_symm_contact.auth_seq_id_1 113 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 LEU _pdbx_validate_symm_contact.auth_seq_id_2 355 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 6_555 _pdbx_validate_symm_contact.dist 2.10 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CD _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 PRO _pdbx_validate_rmsd_bond.auth_seq_id_1 151 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 N _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 PRO _pdbx_validate_rmsd_bond.auth_seq_id_2 151 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.275 _pdbx_validate_rmsd_bond.bond_target_value 1.474 _pdbx_validate_rmsd_bond.bond_deviation -0.199 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.014 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CG A MET -2 ? ? SD A MET -2 ? ? CE A MET -2 ? ? 90.31 100.20 -9.89 1.60 N 2 1 CG A MET 1 ? ? SD A MET 1 ? ? CE A MET 1 ? ? 109.86 100.20 9.66 1.60 N 3 1 CG A MET 31 ? ? SD A MET 31 ? ? CE A MET 31 ? ? 115.17 100.20 14.97 1.60 N 4 1 C A PRO 150 ? ? N A PRO 151 ? ? CD A PRO 151 ? ? 110.00 128.40 -18.40 2.10 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 29 ? ? -93.94 -61.86 2 1 ASN A 57 ? ? -76.73 -168.55 3 1 HIS A 71 ? ? -61.82 -80.67 4 1 SER A 107 ? ? -176.04 71.53 5 1 PRO A 151 ? ? -37.08 -38.76 6 1 TYR A 162 ? ? -90.83 57.67 7 1 ASP A 174 ? ? -154.39 80.88 8 1 TYR A 180 ? ? -107.83 -79.44 9 1 HIS A 192 ? ? -140.31 -26.63 10 1 ASP A 204 ? ? -162.78 110.69 11 1 TRP A 242 ? ? -142.30 32.59 12 1 ASP A 263 ? ? -144.01 -151.82 13 1 PHE A 304 ? ? 71.69 -1.34 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 24 ? ? 0.102 'SIDE CHAIN' 2 1 ARG A 87 ? ? 0.082 'SIDE CHAIN' 3 1 ARG A 124 ? ? 0.116 'SIDE CHAIN' 4 1 ARG A 159 ? ? 0.078 'SIDE CHAIN' 5 1 ARG A 183 ? ? 0.184 'SIDE CHAIN' 6 1 ARG A 410 ? ? 0.118 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -22 ? A MET 1 2 1 Y 1 A GLY -21 ? A GLY 2 3 1 Y 1 A SER -20 ? A SER 3 4 1 Y 1 A SER -19 ? A SER 4 5 1 Y 1 A HIS -18 ? A HIS 5 6 1 Y 1 A HIS -17 ? A HIS 6 7 1 Y 1 A HIS -16 ? A HIS 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FE2 FE FE N N 88 FES FE1 FE N N 89 FES FE2 FE N N 90 FES S1 S N N 91 FES S2 S N N 92 GLN N N N N 93 GLN CA C N S 94 GLN C C N N 95 GLN O O N N 96 GLN CB C N N 97 GLN CG C N N 98 GLN CD C N N 99 GLN OE1 O N N 100 GLN NE2 N N N 101 GLN OXT O N N 102 GLN H H N N 103 GLN H2 H N N 104 GLN HA H N N 105 GLN HB2 H N N 106 GLN HB3 H N N 107 GLN HG2 H N N 108 GLN HG3 H N N 109 GLN HE21 H N N 110 GLN HE22 H N N 111 GLN HXT H N N 112 GLU N N N N 113 GLU CA C N S 114 GLU C C N N 115 GLU O O N N 116 GLU CB C N N 117 GLU CG C N N 118 GLU CD C N N 119 GLU OE1 O N N 120 GLU OE2 O N N 121 GLU OXT O N N 122 GLU H H N N 123 GLU H2 H N N 124 GLU HA H N N 125 GLU HB2 H N N 126 GLU HB3 H N N 127 GLU HG2 H N N 128 GLU HG3 H N N 129 GLU HE2 H N N 130 GLU HXT H N N 131 GLY N N N N 132 GLY CA C N N 133 GLY C C N N 134 GLY O O N N 135 GLY OXT O N N 136 GLY H H N N 137 GLY H2 H N N 138 GLY HA2 H N N 139 GLY HA3 H N N 140 GLY HXT H N N 141 HIS N N N N 142 HIS CA C N S 143 HIS C C N N 144 HIS O O N N 145 HIS CB C N N 146 HIS CG C Y N 147 HIS ND1 N Y N 148 HIS CD2 C Y N 149 HIS CE1 C Y N 150 HIS NE2 N Y N 151 HIS OXT O N N 152 HIS H H N N 153 HIS H2 H N N 154 HIS HA H N N 155 HIS HB2 H N N 156 HIS HB3 H N N 157 HIS HD1 H N N 158 HIS HD2 H N N 159 HIS HE1 H N N 160 HIS HE2 H N N 161 HIS HXT H N N 162 HOH O O N N 163 HOH H1 H N N 164 HOH H2 H N N 165 ILE N N N N 166 ILE CA C N S 167 ILE C C N N 168 ILE O O N N 169 ILE CB C N S 170 ILE CG1 C N N 171 ILE CG2 C N N 172 ILE CD1 C N N 173 ILE OXT O N N 174 ILE H H N N 175 ILE H2 H N N 176 ILE HA H N N 177 ILE HB H N N 178 ILE HG12 H N N 179 ILE HG13 H N N 180 ILE HG21 H N N 181 ILE HG22 H N N 182 ILE HG23 H N N 183 ILE HD11 H N N 184 ILE HD12 H N N 185 ILE HD13 H N N 186 ILE HXT H N N 187 LEU N N N N 188 LEU CA C N S 189 LEU C C N N 190 LEU O O N N 191 LEU CB C N N 192 LEU CG C N N 193 LEU CD1 C N N 194 LEU CD2 C N N 195 LEU OXT O N N 196 LEU H H N N 197 LEU H2 H N N 198 LEU HA H N N 199 LEU HB2 H N N 200 LEU HB3 H N N 201 LEU HG H N N 202 LEU HD11 H N N 203 LEU HD12 H N N 204 LEU HD13 H N N 205 LEU HD21 H N N 206 LEU HD22 H N N 207 LEU HD23 H N N 208 LEU HXT H N N 209 LYS N N N N 210 LYS CA C N S 211 LYS C C N N 212 LYS O O N N 213 LYS CB C N N 214 LYS CG C N N 215 LYS CD C N N 216 LYS CE C N N 217 LYS NZ N N N 218 LYS OXT O N N 219 LYS H H N N 220 LYS H2 H N N 221 LYS HA H N N 222 LYS HB2 H N N 223 LYS HB3 H N N 224 LYS HG2 H N N 225 LYS HG3 H N N 226 LYS HD2 H N N 227 LYS HD3 H N N 228 LYS HE2 H N N 229 LYS HE3 H N N 230 LYS HZ1 H N N 231 LYS HZ2 H N N 232 LYS HZ3 H N N 233 LYS HXT H N N 234 MET N N N N 235 MET CA C N S 236 MET C C N N 237 MET O O N N 238 MET CB C N N 239 MET CG C N N 240 MET SD S N N 241 MET CE C N N 242 MET OXT O N N 243 MET H H N N 244 MET H2 H N N 245 MET HA H N N 246 MET HB2 H N N 247 MET HB3 H N N 248 MET HG2 H N N 249 MET HG3 H N N 250 MET HE1 H N N 251 MET HE2 H N N 252 MET HE3 H N N 253 MET HXT H N N 254 PHE N N N N 255 PHE CA C N S 256 PHE C C N N 257 PHE O O N N 258 PHE CB C N N 259 PHE CG C Y N 260 PHE CD1 C Y N 261 PHE CD2 C Y N 262 PHE CE1 C Y N 263 PHE CE2 C Y N 264 PHE CZ C Y N 265 PHE OXT O N N 266 PHE H H N N 267 PHE H2 H N N 268 PHE HA H N N 269 PHE HB2 H N N 270 PHE HB3 H N N 271 PHE HD1 H N N 272 PHE HD2 H N N 273 PHE HE1 H N N 274 PHE HE2 H N N 275 PHE HZ H N N 276 PHE HXT H N N 277 PRO N N N N 278 PRO CA C N S 279 PRO C C N N 280 PRO O O N N 281 PRO CB C N N 282 PRO CG C N N 283 PRO CD C N N 284 PRO OXT O N N 285 PRO H H N N 286 PRO HA H N N 287 PRO HB2 H N N 288 PRO HB3 H N N 289 PRO HG2 H N N 290 PRO HG3 H N N 291 PRO HD2 H N N 292 PRO HD3 H N N 293 PRO HXT H N N 294 SER N N N N 295 SER CA C N S 296 SER C C N N 297 SER O O N N 298 SER CB C N N 299 SER OG O N N 300 SER OXT O N N 301 SER H H N N 302 SER H2 H N N 303 SER HA H N N 304 SER HB2 H N N 305 SER HB3 H N N 306 SER HG H N N 307 SER HXT H N N 308 THR N N N N 309 THR CA C N S 310 THR C C N N 311 THR O O N N 312 THR CB C N R 313 THR OG1 O N N 314 THR CG2 C N N 315 THR OXT O N N 316 THR H H N N 317 THR H2 H N N 318 THR HA H N N 319 THR HB H N N 320 THR HG1 H N N 321 THR HG21 H N N 322 THR HG22 H N N 323 THR HG23 H N N 324 THR HXT H N N 325 TRP N N N N 326 TRP CA C N S 327 TRP C C N N 328 TRP O O N N 329 TRP CB C N N 330 TRP CG C Y N 331 TRP CD1 C Y N 332 TRP CD2 C Y N 333 TRP NE1 N Y N 334 TRP CE2 C Y N 335 TRP CE3 C Y N 336 TRP CZ2 C Y N 337 TRP CZ3 C Y N 338 TRP CH2 C Y N 339 TRP OXT O N N 340 TRP H H N N 341 TRP H2 H N N 342 TRP HA H N N 343 TRP HB2 H N N 344 TRP HB3 H N N 345 TRP HD1 H N N 346 TRP HE1 H N N 347 TRP HE3 H N N 348 TRP HZ2 H N N 349 TRP HZ3 H N N 350 TRP HH2 H N N 351 TRP HXT H N N 352 TYR N N N N 353 TYR CA C N S 354 TYR C C N N 355 TYR O O N N 356 TYR CB C N N 357 TYR CG C Y N 358 TYR CD1 C Y N 359 TYR CD2 C Y N 360 TYR CE1 C Y N 361 TYR CE2 C Y N 362 TYR CZ C Y N 363 TYR OH O N N 364 TYR OXT O N N 365 TYR H H N N 366 TYR H2 H N N 367 TYR HA H N N 368 TYR HB2 H N N 369 TYR HB3 H N N 370 TYR HD1 H N N 371 TYR HD2 H N N 372 TYR HE1 H N N 373 TYR HE2 H N N 374 TYR HH H N N 375 TYR HXT H N N 376 VAL N N N N 377 VAL CA C N S 378 VAL C C N N 379 VAL O O N N 380 VAL CB C N N 381 VAL CG1 C N N 382 VAL CG2 C N N 383 VAL OXT O N N 384 VAL H H N N 385 VAL H2 H N N 386 VAL HA H N N 387 VAL HB H N N 388 VAL HG11 H N N 389 VAL HG12 H N N 390 VAL HG13 H N N 391 VAL HG21 H N N 392 VAL HG22 H N N 393 VAL HG23 H N N 394 VAL HXT H N N 395 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 FES FE1 S1 sing N N 83 FES FE1 S2 sing N N 84 FES FE2 S1 sing N N 85 FES FE2 S2 sing N N 86 GLN N CA sing N N 87 GLN N H sing N N 88 GLN N H2 sing N N 89 GLN CA C sing N N 90 GLN CA CB sing N N 91 GLN CA HA sing N N 92 GLN C O doub N N 93 GLN C OXT sing N N 94 GLN CB CG sing N N 95 GLN CB HB2 sing N N 96 GLN CB HB3 sing N N 97 GLN CG CD sing N N 98 GLN CG HG2 sing N N 99 GLN CG HG3 sing N N 100 GLN CD OE1 doub N N 101 GLN CD NE2 sing N N 102 GLN NE2 HE21 sing N N 103 GLN NE2 HE22 sing N N 104 GLN OXT HXT sing N N 105 GLU N CA sing N N 106 GLU N H sing N N 107 GLU N H2 sing N N 108 GLU CA C sing N N 109 GLU CA CB sing N N 110 GLU CA HA sing N N 111 GLU C O doub N N 112 GLU C OXT sing N N 113 GLU CB CG sing N N 114 GLU CB HB2 sing N N 115 GLU CB HB3 sing N N 116 GLU CG CD sing N N 117 GLU CG HG2 sing N N 118 GLU CG HG3 sing N N 119 GLU CD OE1 doub N N 120 GLU CD OE2 sing N N 121 GLU OE2 HE2 sing N N 122 GLU OXT HXT sing N N 123 GLY N CA sing N N 124 GLY N H sing N N 125 GLY N H2 sing N N 126 GLY CA C sing N N 127 GLY CA HA2 sing N N 128 GLY CA HA3 sing N N 129 GLY C O doub N N 130 GLY C OXT sing N N 131 GLY OXT HXT sing N N 132 HIS N CA sing N N 133 HIS N H sing N N 134 HIS N H2 sing N N 135 HIS CA C sing N N 136 HIS CA CB sing N N 137 HIS CA HA sing N N 138 HIS C O doub N N 139 HIS C OXT sing N N 140 HIS CB CG sing N N 141 HIS CB HB2 sing N N 142 HIS CB HB3 sing N N 143 HIS CG ND1 sing Y N 144 HIS CG CD2 doub Y N 145 HIS ND1 CE1 doub Y N 146 HIS ND1 HD1 sing N N 147 HIS CD2 NE2 sing Y N 148 HIS CD2 HD2 sing N N 149 HIS CE1 NE2 sing Y N 150 HIS CE1 HE1 sing N N 151 HIS NE2 HE2 sing N N 152 HIS OXT HXT sing N N 153 HOH O H1 sing N N 154 HOH O H2 sing N N 155 ILE N CA sing N N 156 ILE N H sing N N 157 ILE N H2 sing N N 158 ILE CA C sing N N 159 ILE CA CB sing N N 160 ILE CA HA sing N N 161 ILE C O doub N N 162 ILE C OXT sing N N 163 ILE CB CG1 sing N N 164 ILE CB CG2 sing N N 165 ILE CB HB sing N N 166 ILE CG1 CD1 sing N N 167 ILE CG1 HG12 sing N N 168 ILE CG1 HG13 sing N N 169 ILE CG2 HG21 sing N N 170 ILE CG2 HG22 sing N N 171 ILE CG2 HG23 sing N N 172 ILE CD1 HD11 sing N N 173 ILE CD1 HD12 sing N N 174 ILE CD1 HD13 sing N N 175 ILE OXT HXT sing N N 176 LEU N CA sing N N 177 LEU N H sing N N 178 LEU N H2 sing N N 179 LEU CA C sing N N 180 LEU CA CB sing N N 181 LEU CA HA sing N N 182 LEU C O doub N N 183 LEU C OXT sing N N 184 LEU CB CG sing N N 185 LEU CB HB2 sing N N 186 LEU CB HB3 sing N N 187 LEU CG CD1 sing N N 188 LEU CG CD2 sing N N 189 LEU CG HG sing N N 190 LEU CD1 HD11 sing N N 191 LEU CD1 HD12 sing N N 192 LEU CD1 HD13 sing N N 193 LEU CD2 HD21 sing N N 194 LEU CD2 HD22 sing N N 195 LEU CD2 HD23 sing N N 196 LEU OXT HXT sing N N 197 LYS N CA sing N N 198 LYS N H sing N N 199 LYS N H2 sing N N 200 LYS CA C sing N N 201 LYS CA CB sing N N 202 LYS CA HA sing N N 203 LYS C O doub N N 204 LYS C OXT sing N N 205 LYS CB CG sing N N 206 LYS CB HB2 sing N N 207 LYS CB HB3 sing N N 208 LYS CG CD sing N N 209 LYS CG HG2 sing N N 210 LYS CG HG3 sing N N 211 LYS CD CE sing N N 212 LYS CD HD2 sing N N 213 LYS CD HD3 sing N N 214 LYS CE NZ sing N N 215 LYS CE HE2 sing N N 216 LYS CE HE3 sing N N 217 LYS NZ HZ1 sing N N 218 LYS NZ HZ2 sing N N 219 LYS NZ HZ3 sing N N 220 LYS OXT HXT sing N N 221 MET N CA sing N N 222 MET N H sing N N 223 MET N H2 sing N N 224 MET CA C sing N N 225 MET CA CB sing N N 226 MET CA HA sing N N 227 MET C O doub N N 228 MET C OXT sing N N 229 MET CB CG sing N N 230 MET CB HB2 sing N N 231 MET CB HB3 sing N N 232 MET CG SD sing N N 233 MET CG HG2 sing N N 234 MET CG HG3 sing N N 235 MET SD CE sing N N 236 MET CE HE1 sing N N 237 MET CE HE2 sing N N 238 MET CE HE3 sing N N 239 MET OXT HXT sing N N 240 PHE N CA sing N N 241 PHE N H sing N N 242 PHE N H2 sing N N 243 PHE CA C sing N N 244 PHE CA CB sing N N 245 PHE CA HA sing N N 246 PHE C O doub N N 247 PHE C OXT sing N N 248 PHE CB CG sing N N 249 PHE CB HB2 sing N N 250 PHE CB HB3 sing N N 251 PHE CG CD1 doub Y N 252 PHE CG CD2 sing Y N 253 PHE CD1 CE1 sing Y N 254 PHE CD1 HD1 sing N N 255 PHE CD2 CE2 doub Y N 256 PHE CD2 HD2 sing N N 257 PHE CE1 CZ doub Y N 258 PHE CE1 HE1 sing N N 259 PHE CE2 CZ sing Y N 260 PHE CE2 HE2 sing N N 261 PHE CZ HZ sing N N 262 PHE OXT HXT sing N N 263 PRO N CA sing N N 264 PRO N CD sing N N 265 PRO N H sing N N 266 PRO CA C sing N N 267 PRO CA CB sing N N 268 PRO CA HA sing N N 269 PRO C O doub N N 270 PRO C OXT sing N N 271 PRO CB CG sing N N 272 PRO CB HB2 sing N N 273 PRO CB HB3 sing N N 274 PRO CG CD sing N N 275 PRO CG HG2 sing N N 276 PRO CG HG3 sing N N 277 PRO CD HD2 sing N N 278 PRO CD HD3 sing N N 279 PRO OXT HXT sing N N 280 SER N CA sing N N 281 SER N H sing N N 282 SER N H2 sing N N 283 SER CA C sing N N 284 SER CA CB sing N N 285 SER CA HA sing N N 286 SER C O doub N N 287 SER C OXT sing N N 288 SER CB OG sing N N 289 SER CB HB2 sing N N 290 SER CB HB3 sing N N 291 SER OG HG sing N N 292 SER OXT HXT sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TRP N CA sing N N 310 TRP N H sing N N 311 TRP N H2 sing N N 312 TRP CA C sing N N 313 TRP CA CB sing N N 314 TRP CA HA sing N N 315 TRP C O doub N N 316 TRP C OXT sing N N 317 TRP CB CG sing N N 318 TRP CB HB2 sing N N 319 TRP CB HB3 sing N N 320 TRP CG CD1 doub Y N 321 TRP CG CD2 sing Y N 322 TRP CD1 NE1 sing Y N 323 TRP CD1 HD1 sing N N 324 TRP CD2 CE2 doub Y N 325 TRP CD2 CE3 sing Y N 326 TRP NE1 CE2 sing Y N 327 TRP NE1 HE1 sing N N 328 TRP CE2 CZ2 sing Y N 329 TRP CE3 CZ3 doub Y N 330 TRP CE3 HE3 sing N N 331 TRP CZ2 CH2 doub Y N 332 TRP CZ2 HZ2 sing N N 333 TRP CZ3 CH2 sing Y N 334 TRP CZ3 HZ3 sing N N 335 TRP CH2 HH2 sing N N 336 TRP OXT HXT sing N N 337 TYR N CA sing N N 338 TYR N H sing N N 339 TYR N H2 sing N N 340 TYR CA C sing N N 341 TYR CA CB sing N N 342 TYR CA HA sing N N 343 TYR C O doub N N 344 TYR C OXT sing N N 345 TYR CB CG sing N N 346 TYR CB HB2 sing N N 347 TYR CB HB3 sing N N 348 TYR CG CD1 doub Y N 349 TYR CG CD2 sing Y N 350 TYR CD1 CE1 sing Y N 351 TYR CD1 HD1 sing N N 352 TYR CD2 CE2 doub Y N 353 TYR CD2 HD2 sing N N 354 TYR CE1 CZ doub Y N 355 TYR CE1 HE1 sing N N 356 TYR CE2 CZ sing Y N 357 TYR CE2 HE2 sing N N 358 TYR CZ OH sing N N 359 TYR OH HH sing N N 360 TYR OXT HXT sing N N 361 VAL N CA sing N N 362 VAL N H sing N N 363 VAL N H2 sing N N 364 VAL CA C sing N N 365 VAL CA CB sing N N 366 VAL CA HA sing N N 367 VAL C O doub N N 368 VAL C OXT sing N N 369 VAL CB CG1 sing N N 370 VAL CB CG2 sing N N 371 VAL CB HB sing N N 372 VAL CG1 HG11 sing N N 373 VAL CG1 HG12 sing N N 374 VAL CG1 HG13 sing N N 375 VAL CG2 HG21 sing N N 376 VAL CG2 HG22 sing N N 377 VAL CG2 HG23 sing N N 378 VAL OXT HXT sing N N 379 # _pdbx_audit_support.funding_organization 'Department of Biotechnology (DBT, India)' _pdbx_audit_support.country India _pdbx_audit_support.grant_number 'BT/HRD/NBA/37/01/2015 (VIII)' _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9INA _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.006634 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006634 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006634 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C FE N O S # loop_ #