data_9J0V # _entry.id 9J0V # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 9J0V pdb_00009j0v 10.2210/pdb9j0v/pdb WWPDB D_1300050037 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2024-09-18 2 'Structure model' 2 0 2024-12-25 3 'Structure model' 2 1 2025-01-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Atomic model' 2 2 'Structure model' 'Author supporting evidence' 3 2 'Structure model' 'Data collection' 4 2 'Structure model' 'Database references' 5 2 'Structure model' 'Derived calculations' 6 2 'Structure model' 'Non-polymer description' 7 2 'Structure model' 'Polymer sequence' 8 2 'Structure model' 'Source and taxonomy' 9 2 'Structure model' 'Structure summary' 10 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' chem_comp 3 2 'Structure model' chem_comp_atom 4 2 'Structure model' chem_comp_bond 5 2 'Structure model' citation 6 2 'Structure model' citation_author 7 2 'Structure model' entity 8 2 'Structure model' entity_name_com 9 2 'Structure model' entity_poly 10 2 'Structure model' entity_poly_seq 11 2 'Structure model' entity_src_gen 12 2 'Structure model' pdbx_entity_instance_feature 13 2 'Structure model' pdbx_entity_nonpoly 14 2 'Structure model' pdbx_entry_details 15 2 'Structure model' pdbx_modification_feature 16 2 'Structure model' pdbx_nonpoly_scheme 17 2 'Structure model' pdbx_poly_seq_scheme 18 2 'Structure model' pdbx_struct_assembly_gen 19 2 'Structure model' pdbx_struct_mod_residue 20 2 'Structure model' struct_asym 21 2 'Structure model' struct_conn 22 3 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_site.B_iso_or_equiv' 2 2 'Structure model' '_atom_site.Cartn_x' 3 2 'Structure model' '_atom_site.Cartn_y' 4 2 'Structure model' '_atom_site.Cartn_z' 5 2 'Structure model' '_atom_site.auth_atom_id' 6 2 'Structure model' '_atom_site.auth_comp_id' 7 2 'Structure model' '_atom_site.auth_seq_id' 8 2 'Structure model' '_atom_site.group_PDB' 9 2 'Structure model' '_atom_site.label_alt_id' 10 2 'Structure model' '_atom_site.label_asym_id' 11 2 'Structure model' '_atom_site.label_atom_id' 12 2 'Structure model' '_atom_site.label_comp_id' 13 2 'Structure model' '_atom_site.label_entity_id' 14 2 'Structure model' '_atom_site.label_seq_id' 15 2 'Structure model' '_atom_site.occupancy' 16 2 'Structure model' '_atom_site.type_symbol' 17 2 'Structure model' '_chem_comp.formula' 18 2 'Structure model' '_chem_comp.formula_weight' 19 2 'Structure model' '_chem_comp.id' 20 2 'Structure model' '_chem_comp.mon_nstd_flag' 21 2 'Structure model' '_chem_comp.name' 22 2 'Structure model' '_chem_comp.pdbx_synonyms' 23 2 'Structure model' '_chem_comp.type' 24 2 'Structure model' '_citation.country' 25 2 'Structure model' '_citation.journal_abbrev' 26 2 'Structure model' '_citation.journal_id_CSD' 27 2 'Structure model' '_citation.journal_id_ISSN' 28 2 'Structure model' '_citation.journal_volume' 29 2 'Structure model' '_citation.pdbx_database_id_DOI' 30 2 'Structure model' '_citation.title' 31 2 'Structure model' '_citation.year' 32 2 'Structure model' '_citation_author.identifier_ORCID' 33 2 'Structure model' '_citation_author.name' 34 2 'Structure model' '_entity_poly.nstd_monomer' 35 2 'Structure model' '_entity_poly.pdbx_seq_one_letter_code' 36 2 'Structure model' '_entity_poly_seq.mon_id' 37 2 'Structure model' '_entity_src_gen.pdbx_gene_src_gene' 38 2 'Structure model' '_pdbx_entity_instance_feature.auth_comp_id' 39 2 'Structure model' '_pdbx_entity_instance_feature.comp_id' 40 2 'Structure model' '_pdbx_entry_details.has_protein_modification' 41 2 'Structure model' '_pdbx_poly_seq_scheme.auth_mon_id' 42 2 'Structure model' '_pdbx_poly_seq_scheme.auth_seq_num' 43 2 'Structure model' '_pdbx_poly_seq_scheme.mon_id' 44 2 'Structure model' '_pdbx_poly_seq_scheme.pdb_mon_id' 45 2 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 46 3 'Structure model' '_citation.pdbx_database_id_PubMed' 47 3 'Structure model' '_citation.title' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 9J0V _pdbx_database_status.recvd_initial_deposition_date 2024-08-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 4 _pdbx_contact_author.email vpopov@fbras.ru _pdbx_contact_author.name_first Vladimir _pdbx_contact_author.name_last Popov _pdbx_contact_author.name_mi O. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-0133-7962 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Matyuta, I.O.' 1 0000-0002-6297-8392 'Bakunova, A.K.' 2 ? 'Nikolaeva, A.Y.' 3 ? 'Rakitina, T.V.' 4 ? 'Bezsudnova, E.Y.' 5 0000-0002-4954-7547 'Popov, V.O.' 6 0000-0002-0133-7962 'Boyko, K.M.' 7 0000-0001-8229-189X # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biomolecules _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2218-273X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 14 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;From Structure to Function: Analysis of the First Monomeric Pyridoxal-5'-Phosphate-Dependent Transaminase from the Bacterium Desulfobacula toluolica . ; _citation.year 2024 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/biom14121591 _citation.pdbx_database_id_PubMed 39766298 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bakunova, A.K.' 1 ? primary 'Matyuta, I.O.' 2 ? primary 'Nikolaeva, A.Y.' 3 ? primary 'Rakitina, T.V.' 4 ? primary 'Boyko, K.M.' 5 ? primary 'Popov, V.O.' 6 ? primary 'Bezsudnova, E.Y.' 7 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Dat: predicted D-alanine aminotransferase' 32285.297 1 2.6.1.21 ? ? ? 2 non-polymer syn 'DI(HYDROXYETHYL)ETHER' 106.120 1 ? ? ? ? 3 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 4 water nat water 18.015 98 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MKREAIHNFFVANQIIKSTADMAIFDKVPATAIYEVMQVRQGIPLFFEAHLERFVMSASLVGTRIPKKEAEILHNIADLV EKNKCDHGNVKLVSALMNEKEIFLAYFIPAEFLDSKARLEGVHTILFSGERICPNI(LLP)TIKGSFREQVKAVRESSNA YEALLVNESGHITEGSRSNVFFMGKDNKLYTSPAGSVLKGVTRTHVMQICSRLGLEVLEKTVHTRNLADIQGAFITGTTV DVTPVRSIGNTQLDSPNIPLIRKIVAEYEKKIAGYVSKRLKRARKVYVND ; _entity_poly.pdbx_seq_one_letter_code_can ;MKREAIHNFFVANQIIKSTADMAIFDKVPATAIYEVMQVRQGIPLFFEAHLERFVMSASLVGTRIPKKEAEILHNIADLV EKNKCDHGNVKLVSALMNEKEIFLAYFIPAEFLDSKARLEGVHTILFSGERICPNIKTIKGSFREQVKAVRESSNAYEAL LVNESGHITEGSRSNVFFMGKDNKLYTSPAGSVLKGVTRTHVMQICSRLGLEVLEKTVHTRNLADIQGAFITGTTVDVTP VRSIGNTQLDSPNIPLIRKIVAEYEKKIAGYVSKRLKRARKVYVND ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'DI(HYDROXYETHYL)ETHER' PEG 3 GLYCEROL GOL 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 ARG n 1 4 GLU n 1 5 ALA n 1 6 ILE n 1 7 HIS n 1 8 ASN n 1 9 PHE n 1 10 PHE n 1 11 VAL n 1 12 ALA n 1 13 ASN n 1 14 GLN n 1 15 ILE n 1 16 ILE n 1 17 LYS n 1 18 SER n 1 19 THR n 1 20 ALA n 1 21 ASP n 1 22 MET n 1 23 ALA n 1 24 ILE n 1 25 PHE n 1 26 ASP n 1 27 LYS n 1 28 VAL n 1 29 PRO n 1 30 ALA n 1 31 THR n 1 32 ALA n 1 33 ILE n 1 34 TYR n 1 35 GLU n 1 36 VAL n 1 37 MET n 1 38 GLN n 1 39 VAL n 1 40 ARG n 1 41 GLN n 1 42 GLY n 1 43 ILE n 1 44 PRO n 1 45 LEU n 1 46 PHE n 1 47 PHE n 1 48 GLU n 1 49 ALA n 1 50 HIS n 1 51 LEU n 1 52 GLU n 1 53 ARG n 1 54 PHE n 1 55 VAL n 1 56 MET n 1 57 SER n 1 58 ALA n 1 59 SER n 1 60 LEU n 1 61 VAL n 1 62 GLY n 1 63 THR n 1 64 ARG n 1 65 ILE n 1 66 PRO n 1 67 LYS n 1 68 LYS n 1 69 GLU n 1 70 ALA n 1 71 GLU n 1 72 ILE n 1 73 LEU n 1 74 HIS n 1 75 ASN n 1 76 ILE n 1 77 ALA n 1 78 ASP n 1 79 LEU n 1 80 VAL n 1 81 GLU n 1 82 LYS n 1 83 ASN n 1 84 LYS n 1 85 CYS n 1 86 ASP n 1 87 HIS n 1 88 GLY n 1 89 ASN n 1 90 VAL n 1 91 LYS n 1 92 LEU n 1 93 VAL n 1 94 SER n 1 95 ALA n 1 96 LEU n 1 97 MET n 1 98 ASN n 1 99 GLU n 1 100 LYS n 1 101 GLU n 1 102 ILE n 1 103 PHE n 1 104 LEU n 1 105 ALA n 1 106 TYR n 1 107 PHE n 1 108 ILE n 1 109 PRO n 1 110 ALA n 1 111 GLU n 1 112 PHE n 1 113 LEU n 1 114 ASP n 1 115 SER n 1 116 LYS n 1 117 ALA n 1 118 ARG n 1 119 LEU n 1 120 GLU n 1 121 GLY n 1 122 VAL n 1 123 HIS n 1 124 THR n 1 125 ILE n 1 126 LEU n 1 127 PHE n 1 128 SER n 1 129 GLY n 1 130 GLU n 1 131 ARG n 1 132 ILE n 1 133 CYS n 1 134 PRO n 1 135 ASN n 1 136 ILE n 1 137 LLP n 1 138 THR n 1 139 ILE n 1 140 LYS n 1 141 GLY n 1 142 SER n 1 143 PHE n 1 144 ARG n 1 145 GLU n 1 146 GLN n 1 147 VAL n 1 148 LYS n 1 149 ALA n 1 150 VAL n 1 151 ARG n 1 152 GLU n 1 153 SER n 1 154 SER n 1 155 ASN n 1 156 ALA n 1 157 TYR n 1 158 GLU n 1 159 ALA n 1 160 LEU n 1 161 LEU n 1 162 VAL n 1 163 ASN n 1 164 GLU n 1 165 SER n 1 166 GLY n 1 167 HIS n 1 168 ILE n 1 169 THR n 1 170 GLU n 1 171 GLY n 1 172 SER n 1 173 ARG n 1 174 SER n 1 175 ASN n 1 176 VAL n 1 177 PHE n 1 178 PHE n 1 179 MET n 1 180 GLY n 1 181 LYS n 1 182 ASP n 1 183 ASN n 1 184 LYS n 1 185 LEU n 1 186 TYR n 1 187 THR n 1 188 SER n 1 189 PRO n 1 190 ALA n 1 191 GLY n 1 192 SER n 1 193 VAL n 1 194 LEU n 1 195 LYS n 1 196 GLY n 1 197 VAL n 1 198 THR n 1 199 ARG n 1 200 THR n 1 201 HIS n 1 202 VAL n 1 203 MET n 1 204 GLN n 1 205 ILE n 1 206 CYS n 1 207 SER n 1 208 ARG n 1 209 LEU n 1 210 GLY n 1 211 LEU n 1 212 GLU n 1 213 VAL n 1 214 LEU n 1 215 GLU n 1 216 LYS n 1 217 THR n 1 218 VAL n 1 219 HIS n 1 220 THR n 1 221 ARG n 1 222 ASN n 1 223 LEU n 1 224 ALA n 1 225 ASP n 1 226 ILE n 1 227 GLN n 1 228 GLY n 1 229 ALA n 1 230 PHE n 1 231 ILE n 1 232 THR n 1 233 GLY n 1 234 THR n 1 235 THR n 1 236 VAL n 1 237 ASP n 1 238 VAL n 1 239 THR n 1 240 PRO n 1 241 VAL n 1 242 ARG n 1 243 SER n 1 244 ILE n 1 245 GLY n 1 246 ASN n 1 247 THR n 1 248 GLN n 1 249 LEU n 1 250 ASP n 1 251 SER n 1 252 PRO n 1 253 ASN n 1 254 ILE n 1 255 PRO n 1 256 LEU n 1 257 ILE n 1 258 ARG n 1 259 LYS n 1 260 ILE n 1 261 VAL n 1 262 ALA n 1 263 GLU n 1 264 TYR n 1 265 GLU n 1 266 LYS n 1 267 LYS n 1 268 ILE n 1 269 ALA n 1 270 GLY n 1 271 TYR n 1 272 VAL n 1 273 SER n 1 274 LYS n 1 275 ARG n 1 276 LEU n 1 277 LYS n 1 278 ARG n 1 279 ALA n 1 280 ARG n 1 281 LYS n 1 282 VAL n 1 283 TYR n 1 284 VAL n 1 285 ASN n 1 286 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 286 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'dat, TOL2_C39420' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Desulfobacula toluolica' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 28223 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LLP 'L-peptide linking' n '(2S)-2-amino-6-[[3-hydroxy-2-methyl-5-(phosphonooxymethyl)pyridin-4-yl]methylideneamino]hexanoic acid' "N'-PYRIDOXYL-LYSINE-5'-MONOPHOSPHATE" 'C14 H22 N3 O7 P' 375.314 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PEG non-polymer . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3' 106.120 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 LYS 2 2 ? ? ? A . n A 1 3 ARG 3 3 ? ? ? A . n A 1 4 GLU 4 4 ? ? ? A . n A 1 5 ALA 5 5 ? ? ? A . n A 1 6 ILE 6 6 ? ? ? A . n A 1 7 HIS 7 7 ? ? ? A . n A 1 8 ASN 8 8 ? ? ? A . n A 1 9 PHE 9 9 ? ? ? A . n A 1 10 PHE 10 10 ? ? ? A . n A 1 11 VAL 11 11 ? ? ? A . n A 1 12 ALA 12 12 ? ? ? A . n A 1 13 ASN 13 13 ? ? ? A . n A 1 14 GLN 14 14 ? ? ? A . n A 1 15 ILE 15 15 ? ? ? A . n A 1 16 ILE 16 16 ? ? ? A . n A 1 17 LYS 17 17 ? ? ? A . n A 1 18 SER 18 18 ? ? ? A . n A 1 19 THR 19 19 ? ? ? A . n A 1 20 ALA 20 20 ? ? ? A . n A 1 21 ASP 21 21 ? ? ? A . n A 1 22 MET 22 22 ? ? ? A . n A 1 23 ALA 23 23 ? ? ? A . n A 1 24 ILE 24 24 ? ? ? A . n A 1 25 PHE 25 25 ? ? ? A . n A 1 26 ASP 26 26 ? ? ? A . n A 1 27 LYS 27 27 ? ? ? A . n A 1 28 VAL 28 28 ? ? ? A . n A 1 29 PRO 29 29 ? ? ? A . n A 1 30 ALA 30 30 ? ? ? A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 MET 37 37 37 MET MET A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 PHE 47 47 47 PHE PHE A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 HIS 50 50 50 HIS HIS A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 HIS 74 74 74 HIS HIS A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 CYS 85 85 85 CYS CYS A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 MET 97 97 97 MET MET A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 ALA 105 105 105 ALA ALA A . n A 1 106 TYR 106 106 106 TYR TYR A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 PRO 109 109 109 PRO PRO A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 ARG 118 118 118 ARG ARG A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 HIS 123 123 123 HIS HIS A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 ILE 125 125 125 ILE ILE A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 PHE 127 127 127 PHE PHE A . n A 1 128 SER 128 128 128 SER SER A . n A 1 129 GLY 129 129 129 GLY GLY A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 ARG 131 131 131 ARG ARG A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 CYS 133 133 133 CYS CYS A . n A 1 134 PRO 134 134 134 PRO PRO A . n A 1 135 ASN 135 135 135 ASN ASN A . n A 1 136 ILE 136 136 136 ILE ILE A . n A 1 137 LLP 137 137 301 LLP PLP A . n A 1 138 THR 138 138 138 THR THR A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 SER 142 142 142 SER SER A . n A 1 143 PHE 143 143 143 PHE PHE A . n A 1 144 ARG 144 144 144 ARG ARG A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 GLN 146 146 146 GLN GLN A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 LYS 148 148 148 LYS LYS A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 VAL 150 150 150 VAL VAL A . n A 1 151 ARG 151 151 151 ARG ARG A . n A 1 152 GLU 152 152 152 GLU GLU A . n A 1 153 SER 153 153 153 SER SER A . n A 1 154 SER 154 154 154 SER SER A . n A 1 155 ASN 155 155 155 ASN ASN A . n A 1 156 ALA 156 156 156 ALA ALA A . n A 1 157 TYR 157 157 157 TYR TYR A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 VAL 162 162 162 VAL VAL A . n A 1 163 ASN 163 163 163 ASN ASN A . n A 1 164 GLU 164 164 164 GLU GLU A . n A 1 165 SER 165 165 165 SER SER A . n A 1 166 GLY 166 166 166 GLY GLY A . n A 1 167 HIS 167 167 167 HIS HIS A . n A 1 168 ILE 168 168 168 ILE ILE A . n A 1 169 THR 169 169 169 THR THR A . n A 1 170 GLU 170 170 170 GLU GLU A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 SER 172 172 172 SER SER A . n A 1 173 ARG 173 173 173 ARG ARG A . n A 1 174 SER 174 174 174 SER SER A . n A 1 175 ASN 175 175 175 ASN ASN A . n A 1 176 VAL 176 176 176 VAL VAL A . n A 1 177 PHE 177 177 177 PHE PHE A . n A 1 178 PHE 178 178 178 PHE PHE A . n A 1 179 MET 179 179 179 MET MET A . n A 1 180 GLY 180 180 180 GLY GLY A . n A 1 181 LYS 181 181 181 LYS LYS A . n A 1 182 ASP 182 182 182 ASP ASP A . n A 1 183 ASN 183 183 183 ASN ASN A . n A 1 184 LYS 184 184 184 LYS LYS A . n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 TYR 186 186 186 TYR TYR A . n A 1 187 THR 187 187 187 THR THR A . n A 1 188 SER 188 188 188 SER SER A . n A 1 189 PRO 189 189 189 PRO PRO A . n A 1 190 ALA 190 190 190 ALA ALA A . n A 1 191 GLY 191 191 191 GLY GLY A . n A 1 192 SER 192 192 192 SER SER A . n A 1 193 VAL 193 193 193 VAL VAL A . n A 1 194 LEU 194 194 194 LEU LEU A . n A 1 195 LYS 195 195 195 LYS LYS A . n A 1 196 GLY 196 196 196 GLY GLY A . n A 1 197 VAL 197 197 197 VAL VAL A . n A 1 198 THR 198 198 198 THR THR A . n A 1 199 ARG 199 199 199 ARG ARG A . n A 1 200 THR 200 200 200 THR THR A . n A 1 201 HIS 201 201 201 HIS HIS A . n A 1 202 VAL 202 202 202 VAL VAL A . n A 1 203 MET 203 203 203 MET MET A . n A 1 204 GLN 204 204 204 GLN GLN A . n A 1 205 ILE 205 205 205 ILE ILE A . n A 1 206 CYS 206 206 206 CYS CYS A . n A 1 207 SER 207 207 207 SER SER A . n A 1 208 ARG 208 208 208 ARG ARG A . n A 1 209 LEU 209 209 209 LEU LEU A . n A 1 210 GLY 210 210 210 GLY GLY A . n A 1 211 LEU 211 211 211 LEU LEU A . n A 1 212 GLU 212 212 212 GLU GLU A . n A 1 213 VAL 213 213 213 VAL VAL A . n A 1 214 LEU 214 214 214 LEU LEU A . n A 1 215 GLU 215 215 215 GLU GLU A . n A 1 216 LYS 216 216 216 LYS LYS A . n A 1 217 THR 217 217 217 THR THR A . n A 1 218 VAL 218 218 218 VAL VAL A . n A 1 219 HIS 219 219 219 HIS HIS A . n A 1 220 THR 220 220 220 THR THR A . n A 1 221 ARG 221 221 221 ARG ARG A . n A 1 222 ASN 222 222 222 ASN ASN A . n A 1 223 LEU 223 223 223 LEU LEU A . n A 1 224 ALA 224 224 224 ALA ALA A . n A 1 225 ASP 225 225 225 ASP ASP A . n A 1 226 ILE 226 226 226 ILE ILE A . n A 1 227 GLN 227 227 227 GLN GLN A . n A 1 228 GLY 228 228 228 GLY GLY A . n A 1 229 ALA 229 229 229 ALA ALA A . n A 1 230 PHE 230 230 230 PHE PHE A . n A 1 231 ILE 231 231 231 ILE ILE A . n A 1 232 THR 232 232 232 THR THR A . n A 1 233 GLY 233 233 233 GLY GLY A . n A 1 234 THR 234 234 234 THR THR A . n A 1 235 THR 235 235 235 THR THR A . n A 1 236 VAL 236 236 236 VAL VAL A . n A 1 237 ASP 237 237 237 ASP ASP A . n A 1 238 VAL 238 238 238 VAL VAL A . n A 1 239 THR 239 239 239 THR THR A . n A 1 240 PRO 240 240 240 PRO PRO A . n A 1 241 VAL 241 241 241 VAL VAL A . n A 1 242 ARG 242 242 242 ARG ARG A . n A 1 243 SER 243 243 243 SER SER A . n A 1 244 ILE 244 244 244 ILE ILE A . n A 1 245 GLY 245 245 245 GLY GLY A . n A 1 246 ASN 246 246 246 ASN ASN A . n A 1 247 THR 247 247 247 THR THR A . n A 1 248 GLN 248 248 248 GLN GLN A . n A 1 249 LEU 249 249 249 LEU LEU A . n A 1 250 ASP 250 250 250 ASP ASP A . n A 1 251 SER 251 251 251 SER SER A . n A 1 252 PRO 252 252 252 PRO PRO A . n A 1 253 ASN 253 253 253 ASN ASN A . n A 1 254 ILE 254 254 254 ILE ILE A . n A 1 255 PRO 255 255 255 PRO PRO A . n A 1 256 LEU 256 256 256 LEU LEU A . n A 1 257 ILE 257 257 257 ILE ILE A . n A 1 258 ARG 258 258 258 ARG ARG A . n A 1 259 LYS 259 259 259 LYS LYS A . n A 1 260 ILE 260 260 260 ILE ILE A . n A 1 261 VAL 261 261 261 VAL VAL A . n A 1 262 ALA 262 262 262 ALA ALA A . n A 1 263 GLU 263 263 263 GLU GLU A . n A 1 264 TYR 264 264 264 TYR TYR A . n A 1 265 GLU 265 265 265 GLU GLU A . n A 1 266 LYS 266 266 266 LYS LYS A . n A 1 267 LYS 267 267 267 LYS LYS A . n A 1 268 ILE 268 268 268 ILE ILE A . n A 1 269 ALA 269 269 269 ALA ALA A . n A 1 270 GLY 270 270 270 GLY GLY A . n A 1 271 TYR 271 271 271 TYR TYR A . n A 1 272 VAL 272 272 272 VAL VAL A . n A 1 273 SER 273 273 273 SER SER A . n A 1 274 LYS 274 274 274 LYS LYS A . n A 1 275 ARG 275 275 275 ARG ARG A . n A 1 276 LEU 276 276 276 LEU LEU A . n A 1 277 LYS 277 277 ? ? ? A . n A 1 278 ARG 278 278 ? ? ? A . n A 1 279 ALA 279 279 ? ? ? A . n A 1 280 ARG 280 280 ? ? ? A . n A 1 281 LYS 281 281 ? ? ? A . n A 1 282 VAL 282 282 ? ? ? A . n A 1 283 TYR 283 283 ? ? ? A . n A 1 284 VAL 284 284 ? ? ? A . n A 1 285 ASN 285 285 ? ? ? A . n A 1 286 ASP 286 286 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id LLP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id LLP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PEG 1 301 305 PEG PEG A . C 3 GOL 1 302 306 GOL GOL A . D 4 HOH 1 401 76 HOH HOH A . D 4 HOH 2 402 45 HOH HOH A . D 4 HOH 3 403 10 HOH HOH A . D 4 HOH 4 404 16 HOH HOH A . D 4 HOH 5 405 67 HOH HOH A . D 4 HOH 6 406 11 HOH HOH A . D 4 HOH 7 407 100 HOH HOH A . D 4 HOH 8 408 24 HOH HOH A . D 4 HOH 9 409 71 HOH HOH A . D 4 HOH 10 410 12 HOH HOH A . D 4 HOH 11 411 4 HOH HOH A . D 4 HOH 12 412 103 HOH HOH A . D 4 HOH 13 413 3 HOH HOH A . D 4 HOH 14 414 29 HOH HOH A . D 4 HOH 15 415 92 HOH HOH A . D 4 HOH 16 416 31 HOH HOH A . D 4 HOH 17 417 78 HOH HOH A . D 4 HOH 18 418 54 HOH HOH A . D 4 HOH 19 419 75 HOH HOH A . D 4 HOH 20 420 18 HOH HOH A . D 4 HOH 21 421 66 HOH HOH A . D 4 HOH 22 422 9 HOH HOH A . D 4 HOH 23 423 68 HOH HOH A . D 4 HOH 24 424 64 HOH HOH A . D 4 HOH 25 425 40 HOH HOH A . D 4 HOH 26 426 55 HOH HOH A . D 4 HOH 27 427 26 HOH HOH A . D 4 HOH 28 428 22 HOH HOH A . D 4 HOH 29 429 96 HOH HOH A . D 4 HOH 30 430 42 HOH HOH A . D 4 HOH 31 431 14 HOH HOH A . D 4 HOH 32 432 5 HOH HOH A . D 4 HOH 33 433 6 HOH HOH A . D 4 HOH 34 434 37 HOH HOH A . D 4 HOH 35 435 97 HOH HOH A . D 4 HOH 36 436 46 HOH HOH A . D 4 HOH 37 437 86 HOH HOH A . D 4 HOH 38 438 49 HOH HOH A . D 4 HOH 39 439 19 HOH HOH A . D 4 HOH 40 440 13 HOH HOH A . D 4 HOH 41 441 7 HOH HOH A . D 4 HOH 42 442 2 HOH HOH A . D 4 HOH 43 443 33 HOH HOH A . D 4 HOH 44 444 28 HOH HOH A . D 4 HOH 45 445 35 HOH HOH A . D 4 HOH 46 446 8 HOH HOH A . D 4 HOH 47 447 56 HOH HOH A . D 4 HOH 48 448 34 HOH HOH A . D 4 HOH 49 449 1 HOH HOH A . D 4 HOH 50 450 87 HOH HOH A . D 4 HOH 51 451 70 HOH HOH A . D 4 HOH 52 452 41 HOH HOH A . D 4 HOH 53 453 89 HOH HOH A . D 4 HOH 54 454 62 HOH HOH A . D 4 HOH 55 455 73 HOH HOH A . D 4 HOH 56 456 36 HOH HOH A . D 4 HOH 57 457 107 HOH HOH A . D 4 HOH 58 458 61 HOH HOH A . D 4 HOH 59 459 74 HOH HOH A . D 4 HOH 60 460 60 HOH HOH A . D 4 HOH 61 461 15 HOH HOH A . D 4 HOH 62 462 21 HOH HOH A . D 4 HOH 63 463 30 HOH HOH A . D 4 HOH 64 464 23 HOH HOH A . D 4 HOH 65 465 25 HOH HOH A . D 4 HOH 66 466 20 HOH HOH A . D 4 HOH 67 467 104 HOH HOH A . D 4 HOH 68 468 99 HOH HOH A . D 4 HOH 69 469 52 HOH HOH A . D 4 HOH 70 470 98 HOH HOH A . D 4 HOH 71 471 82 HOH HOH A . D 4 HOH 72 472 101 HOH HOH A . D 4 HOH 73 473 27 HOH HOH A . D 4 HOH 74 474 44 HOH HOH A . D 4 HOH 75 475 94 HOH HOH A . D 4 HOH 76 476 47 HOH HOH A . D 4 HOH 77 477 38 HOH HOH A . D 4 HOH 78 478 59 HOH HOH A . D 4 HOH 79 479 72 HOH HOH A . D 4 HOH 80 480 77 HOH HOH A . D 4 HOH 81 481 102 HOH HOH A . D 4 HOH 82 482 95 HOH HOH A . D 4 HOH 83 483 93 HOH HOH A . D 4 HOH 84 484 69 HOH HOH A . D 4 HOH 85 485 79 HOH HOH A . D 4 HOH 86 486 108 HOH HOH A . D 4 HOH 87 487 81 HOH HOH A . D 4 HOH 88 488 53 HOH HOH A . D 4 HOH 89 489 90 HOH HOH A . D 4 HOH 90 490 105 HOH HOH A . D 4 HOH 91 491 58 HOH HOH A . D 4 HOH 92 492 91 HOH HOH A . D 4 HOH 93 493 84 HOH HOH A . D 4 HOH 94 494 88 HOH HOH A . D 4 HOH 95 495 80 HOH HOH A . D 4 HOH 96 496 51 HOH HOH A . D 4 HOH 97 497 106 HOH HOH A . D 4 HOH 98 498 57 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A THR 31 ? OG1 ? A THR 31 OG1 2 1 Y 1 A THR 31 ? CG2 ? A THR 31 CG2 3 1 Y 1 A ARG 64 ? CG ? A ARG 64 CG 4 1 Y 1 A ARG 64 ? CD ? A ARG 64 CD 5 1 Y 1 A ARG 64 ? NE ? A ARG 64 NE 6 1 Y 1 A ARG 64 ? CZ ? A ARG 64 CZ 7 1 Y 1 A ARG 64 ? NH1 ? A ARG 64 NH1 8 1 Y 1 A ARG 64 ? NH2 ? A ARG 64 NH2 9 1 Y 1 A LYS 68 ? CG ? A LYS 68 CG 10 1 Y 1 A LYS 68 ? CD ? A LYS 68 CD 11 1 Y 1 A LYS 68 ? CE ? A LYS 68 CE 12 1 Y 1 A LYS 68 ? NZ ? A LYS 68 NZ 13 1 Y 1 A GLU 81 ? CG ? A GLU 81 CG 14 1 Y 1 A GLU 81 ? CD ? A GLU 81 CD 15 1 Y 1 A GLU 81 ? OE1 ? A GLU 81 OE1 16 1 Y 1 A GLU 81 ? OE2 ? A GLU 81 OE2 17 1 Y 1 A LYS 82 ? CG ? A LYS 82 CG 18 1 Y 1 A LYS 82 ? CD ? A LYS 82 CD 19 1 Y 1 A LYS 82 ? CE ? A LYS 82 CE 20 1 Y 1 A LYS 82 ? NZ ? A LYS 82 NZ 21 1 Y 1 A ASN 83 ? CG ? A ASN 83 CG 22 1 Y 1 A ASN 83 ? OD1 ? A ASN 83 OD1 23 1 Y 1 A ASN 83 ? ND2 ? A ASN 83 ND2 24 1 Y 1 A LYS 84 ? CG ? A LYS 84 CG 25 1 Y 1 A LYS 84 ? CD ? A LYS 84 CD 26 1 Y 1 A LYS 84 ? CE ? A LYS 84 CE 27 1 Y 1 A LYS 84 ? NZ ? A LYS 84 NZ 28 1 Y 1 A CYS 85 ? SG ? A CYS 85 SG 29 1 Y 1 A ASN 98 ? CG ? A ASN 98 CG 30 1 Y 1 A ASN 98 ? OD1 ? A ASN 98 OD1 31 1 Y 1 A ASN 98 ? ND2 ? A ASN 98 ND2 32 1 Y 1 A GLU 99 ? CD ? A GLU 99 CD 33 1 Y 1 A GLU 99 ? OE1 ? A GLU 99 OE1 34 1 Y 1 A GLU 99 ? OE2 ? A GLU 99 OE2 35 1 Y 1 A LYS 100 ? CE ? A LYS 100 CE 36 1 Y 1 A LYS 100 ? NZ ? A LYS 100 NZ 37 1 Y 1 A PHE 112 ? CG ? A PHE 112 CG 38 1 Y 1 A PHE 112 ? CD1 ? A PHE 112 CD1 39 1 Y 1 A PHE 112 ? CD2 ? A PHE 112 CD2 40 1 Y 1 A PHE 112 ? CE1 ? A PHE 112 CE1 41 1 Y 1 A PHE 112 ? CE2 ? A PHE 112 CE2 42 1 Y 1 A PHE 112 ? CZ ? A PHE 112 CZ 43 1 Y 1 A LYS 140 ? CD ? A LYS 140 CD 44 1 Y 1 A LYS 140 ? CE ? A LYS 140 CE 45 1 Y 1 A LYS 140 ? NZ ? A LYS 140 NZ 46 1 Y 1 A LYS 148 ? NZ ? A LYS 148 NZ 47 1 Y 1 A GLU 164 ? CG ? A GLU 164 CG 48 1 Y 1 A GLU 164 ? CD ? A GLU 164 CD 49 1 Y 1 A GLU 164 ? OE1 ? A GLU 164 OE1 50 1 Y 1 A GLU 164 ? OE2 ? A GLU 164 OE2 51 1 Y 1 A ARG 221 ? NH1 ? A ARG 221 NH1 52 1 Y 1 A LYS 266 ? CE ? A LYS 266 CE 53 1 Y 1 A LYS 266 ? NZ ? A LYS 266 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? . 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 9J0V _cell.details ? _cell.formula_units_Z ? _cell.length_a 37.847 _cell.length_a_esd ? _cell.length_b 56.226 _cell.length_b_esd ? _cell.length_c 118.625 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 9J0V _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 9J0V _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.97 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 37.52 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M Ammonium acetate, 0.1M Bis-tris pH 5.5, 17% PEG 10000' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 288 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-11-06 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.88560 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.88560 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 9J0V _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.79 _reflns.d_resolution_low 40.81 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 24352 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.6 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.97 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.056 _reflns.pdbx_Rpim_I_all 0.028 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 88078 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.047 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.79 _reflns_shell.d_res_low 1.83 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all 4831 _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1401 _reflns_shell.percent_possible_obs 96.2 _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.4 _reflns_shell.pdbx_chi_squared 0.83 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs 1.5 _reflns_shell.pdbx_Rrim_I_all 0.787 _reflns_shell.pdbx_Rpim_I_all 0.405 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.686 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.670 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -0.15 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] -0.80 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 0.96 _refine.B_iso_max ? _refine.B_iso_mean 38.029 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.964 _refine.correlation_coeff_Fo_to_Fc_free 0.953 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 9J0V _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.79 _refine.ls_d_res_low 40.81 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 23150 _refine.ls_number_reflns_R_free 1146 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.51 _refine.ls_percent_reflns_R_free 4.7 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.19522 _refine.ls_R_factor_R_free 0.23575 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.19325 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.128 _refine.pdbx_overall_ESU_R_Free 0.127 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 3.205 _refine.overall_SU_ML 0.096 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.details ? _refine_hist.d_res_high 1.79 _refine_hist.d_res_low 40.81 _refine_hist.number_atoms_solvent 98 _refine_hist.number_atoms_total 1998 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1872 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 28 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.016 0.013 1933 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.003 0.015 1872 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 2.100 1.638 2614 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.501 1.570 4292 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.366 5.000 245 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 31.653 21.798 89 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.413 15.000 333 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 18.155 15.000 13 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.105 0.200 265 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.013 0.020 2158 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.004 0.020 424 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 4.776 3.872 983 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 4.779 3.869 982 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 6.148 5.792 1227 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 6.146 5.796 1228 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 5.892 4.317 950 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 5.889 4.320 951 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 7.953 6.252 1388 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 9.664 46.061 2095 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 9.677 45.935 2075 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.790 _refine_ls_shell.d_res_low 1.836 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 87 _refine_ls_shell.number_reflns_R_work 1661 _refine_ls_shell.percent_reflns_obs 97.93 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.345 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.408 # _struct.entry_id 9J0V _struct.title 'Crystal structure of monomeric PLP-dependent transaminase from Desulfobacula toluolica in P 21 21 21 space group' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 9J0V _struct_keywords.text 'DAAT, D-amino acid transaminase, TA, monomeric TA, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code K0NPP0_DESTT _struct_ref.pdbx_db_accession K0NPP0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKREAIHNFFVANQIIKSTADMAIFDKVPATAIYEVMQVRQGIPLFFEAHLERFVMSASLVGTRIPKKEAEILHNIADLV EKNKCDHGNVKLVSALMNEKEIFLAYFIPAEFLDSKARLEGVHTILFSGERICPNIKTIKGSFREQVKAVRESSNAYEAL LVNESGHITEGSRSNVFFMGKDNKLYTSPAGSVLKGVTRTHVMQICSRLGLEVLEKTVHTRNLADIQGAFITGTTVDVTP VRSIGNTQLDSPNIPLIRKIVAEYEKKIAGYVSKRLKRARKVYVND ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 9J0V _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 286 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession K0NPP0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 286 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 286 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 790 ? 1 MORE -0 ? 1 'SSA (A^2)' 11650 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PHE A 46 ? GLY A 62 ? PHE A 46 GLY A 62 1 ? 17 HELX_P HELX_P2 AA2 LYS A 68 ? LYS A 84 ? LYS A 68 LYS A 84 1 ? 17 HELX_P HELX_P3 AA3 ASP A 114 ? GLY A 121 ? ASP A 114 GLY A 121 1 ? 8 HELX_P HELX_P4 AA4 PHE A 143 ? ASN A 155 ? PHE A 143 ASN A 155 1 ? 13 HELX_P HELX_P5 AA5 PRO A 189 ? VAL A 193 ? PRO A 189 VAL A 193 5 ? 5 HELX_P HELX_P6 AA6 GLY A 196 ? LEU A 209 ? GLY A 196 LEU A 209 1 ? 14 HELX_P HELX_P7 AA7 HIS A 219 ? ALA A 224 ? HIS A 219 ALA A 224 5 ? 6 HELX_P HELX_P8 AA8 ASP A 250 ? ASN A 253 ? ASP A 250 ASN A 253 5 ? 4 HELX_P HELX_P9 AA9 ILE A 254 ? LEU A 276 ? ILE A 254 LEU A 276 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ILE 136 C ? ? ? 1_555 A LLP 137 N ? ? A ILE 136 A LLP 137 1_555 ? ? ? ? ? ? ? 1.307 ? ? covale2 covale both ? A LLP 137 C ? ? ? 1_555 A THR 138 N ? ? A LLP 137 A THR 138 1_555 ? ? ? ? ? ? ? 1.300 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id LLP _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 137 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id LLP _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 137 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id LYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id LLP _pdbx_modification_feature.type 'Pyridoxal phosphate' _pdbx_modification_feature.category 'Named protein modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 8 ? AA3 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? parallel AA2 6 7 ? parallel AA2 7 8 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA3 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 43 ? PRO A 44 ? ILE A 43 PRO A 44 AA1 2 ALA A 32 ? ARG A 40 ? ALA A 32 ARG A 40 AA1 3 GLY A 88 ? MET A 97 ? GLY A 88 MET A 97 AA1 4 LYS A 100 ? ILE A 108 ? LYS A 100 ILE A 108 AA2 1 VAL A 213 ? GLU A 215 ? VAL A 213 GLU A 215 AA2 2 LEU A 185 ? THR A 187 ? LEU A 185 THR A 187 AA2 3 SER A 174 ? GLY A 180 ? SER A 174 GLY A 180 AA2 4 ILE A 168 ? GLY A 171 ? ILE A 168 GLY A 171 AA2 5 GLU A 158 ? VAL A 162 ? GLU A 158 VAL A 162 AA2 6 VAL A 122 ? SER A 128 ? VAL A 122 SER A 128 AA2 7 ASP A 237 ? ILE A 244 ? ASP A 237 ILE A 244 AA2 8 THR A 247 ? GLN A 248 ? THR A 247 GLN A 248 AA3 1 VAL A 213 ? GLU A 215 ? VAL A 213 GLU A 215 AA3 2 LEU A 185 ? THR A 187 ? LEU A 185 THR A 187 AA3 3 SER A 174 ? GLY A 180 ? SER A 174 GLY A 180 AA3 4 ILE A 226 ? GLY A 233 ? ILE A 226 GLY A 233 AA3 5 ASP A 237 ? ILE A 244 ? ASP A 237 ILE A 244 AA3 6 THR A 247 ? GLN A 248 ? THR A 247 GLN A 248 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 43 ? O ILE A 43 N ARG A 40 ? N ARG A 40 AA1 2 3 N VAL A 39 ? N VAL A 39 O GLY A 88 ? O GLY A 88 AA1 3 4 N MET A 97 ? N MET A 97 O LYS A 100 ? O LYS A 100 AA2 1 2 O LEU A 214 ? O LEU A 214 N LEU A 185 ? N LEU A 185 AA2 2 3 O TYR A 186 ? O TYR A 186 N PHE A 178 ? N PHE A 178 AA2 3 4 O SER A 174 ? O SER A 174 N GLY A 171 ? N GLY A 171 AA2 4 5 O GLU A 170 ? O GLU A 170 N LEU A 161 ? N LEU A 161 AA2 5 6 O LEU A 160 ? O LEU A 160 N ILE A 125 ? N ILE A 125 AA2 6 7 N VAL A 122 ? N VAL A 122 O PRO A 240 ? O PRO A 240 AA2 7 8 N ILE A 244 ? N ILE A 244 O THR A 247 ? O THR A 247 AA3 1 2 O LEU A 214 ? O LEU A 214 N LEU A 185 ? N LEU A 185 AA3 2 3 O TYR A 186 ? O TYR A 186 N PHE A 178 ? N PHE A 178 AA3 3 4 N MET A 179 ? N MET A 179 O GLN A 227 ? O GLN A 227 AA3 4 5 N ALA A 229 ? N ALA A 229 O VAL A 241 ? O VAL A 241 AA3 5 6 N ILE A 244 ? N ILE A 244 O THR A 247 ? O THR A 247 # _pdbx_entry_details.entry_id 9J0V _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CD A ARG 258 ? ? NE A ARG 258 ? ? CZ A ARG 258 ? ? 133.76 123.60 10.16 1.40 N 2 1 NE A ARG 258 ? ? CZ A ARG 258 ? ? NH1 A ARG 258 ? ? 127.44 120.30 7.14 0.50 N 3 1 NE A ARG 258 ? ? CZ A ARG 258 ? ? NH2 A ARG 258 ? ? 115.16 120.30 -5.14 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 64 ? ? -35.88 140.10 2 1 LYS A 84 ? ? 80.81 -52.23 3 1 SER A 115 ? ? -12.74 -66.78 4 1 THR A 169 ? ? -101.26 -63.31 5 1 ARG A 173 ? ? -140.80 25.79 6 1 ASP A 237 ? ? 44.92 -129.33 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id LLP _pdbx_struct_mod_residue.label_seq_id 137 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id LLP _pdbx_struct_mod_residue.auth_seq_id 137 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id LYS _pdbx_struct_mod_residue.details 'modified residue' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A LYS 2 ? A LYS 2 3 1 Y 1 A ARG 3 ? A ARG 3 4 1 Y 1 A GLU 4 ? A GLU 4 5 1 Y 1 A ALA 5 ? A ALA 5 6 1 Y 1 A ILE 6 ? A ILE 6 7 1 Y 1 A HIS 7 ? A HIS 7 8 1 Y 1 A ASN 8 ? A ASN 8 9 1 Y 1 A PHE 9 ? A PHE 9 10 1 Y 1 A PHE 10 ? A PHE 10 11 1 Y 1 A VAL 11 ? A VAL 11 12 1 Y 1 A ALA 12 ? A ALA 12 13 1 Y 1 A ASN 13 ? A ASN 13 14 1 Y 1 A GLN 14 ? A GLN 14 15 1 Y 1 A ILE 15 ? A ILE 15 16 1 Y 1 A ILE 16 ? A ILE 16 17 1 Y 1 A LYS 17 ? A LYS 17 18 1 Y 1 A SER 18 ? A SER 18 19 1 Y 1 A THR 19 ? A THR 19 20 1 Y 1 A ALA 20 ? A ALA 20 21 1 Y 1 A ASP 21 ? A ASP 21 22 1 Y 1 A MET 22 ? A MET 22 23 1 Y 1 A ALA 23 ? A ALA 23 24 1 Y 1 A ILE 24 ? A ILE 24 25 1 Y 1 A PHE 25 ? A PHE 25 26 1 Y 1 A ASP 26 ? A ASP 26 27 1 Y 1 A LYS 27 ? A LYS 27 28 1 Y 1 A VAL 28 ? A VAL 28 29 1 Y 1 A PRO 29 ? A PRO 29 30 1 Y 1 A ALA 30 ? A ALA 30 31 1 Y 1 A LYS 277 ? A LYS 277 32 1 Y 1 A ARG 278 ? A ARG 278 33 1 Y 1 A ALA 279 ? A ALA 279 34 1 Y 1 A ARG 280 ? A ARG 280 35 1 Y 1 A LYS 281 ? A LYS 281 36 1 Y 1 A VAL 282 ? A VAL 282 37 1 Y 1 A TYR 283 ? A TYR 283 38 1 Y 1 A VAL 284 ? A VAL 284 39 1 Y 1 A ASN 285 ? A ASN 285 40 1 Y 1 A ASP 286 ? A ASP 286 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 GOL C1 C N N 137 GOL O1 O N N 138 GOL C2 C N N 139 GOL O2 O N N 140 GOL C3 C N N 141 GOL O3 O N N 142 GOL H11 H N N 143 GOL H12 H N N 144 GOL HO1 H N N 145 GOL H2 H N N 146 GOL HO2 H N N 147 GOL H31 H N N 148 GOL H32 H N N 149 GOL HO3 H N N 150 HIS N N N N 151 HIS CA C N S 152 HIS C C N N 153 HIS O O N N 154 HIS CB C N N 155 HIS CG C Y N 156 HIS ND1 N Y N 157 HIS CD2 C Y N 158 HIS CE1 C Y N 159 HIS NE2 N Y N 160 HIS OXT O N N 161 HIS H H N N 162 HIS H2 H N N 163 HIS HA H N N 164 HIS HB2 H N N 165 HIS HB3 H N N 166 HIS HD1 H N N 167 HIS HD2 H N N 168 HIS HE1 H N N 169 HIS HE2 H N N 170 HIS HXT H N N 171 HOH O O N N 172 HOH H1 H N N 173 HOH H2 H N N 174 ILE N N N N 175 ILE CA C N S 176 ILE C C N N 177 ILE O O N N 178 ILE CB C N S 179 ILE CG1 C N N 180 ILE CG2 C N N 181 ILE CD1 C N N 182 ILE OXT O N N 183 ILE H H N N 184 ILE H2 H N N 185 ILE HA H N N 186 ILE HB H N N 187 ILE HG12 H N N 188 ILE HG13 H N N 189 ILE HG21 H N N 190 ILE HG22 H N N 191 ILE HG23 H N N 192 ILE HD11 H N N 193 ILE HD12 H N N 194 ILE HD13 H N N 195 ILE HXT H N N 196 LEU N N N N 197 LEU CA C N S 198 LEU C C N N 199 LEU O O N N 200 LEU CB C N N 201 LEU CG C N N 202 LEU CD1 C N N 203 LEU CD2 C N N 204 LEU OXT O N N 205 LEU H H N N 206 LEU H2 H N N 207 LEU HA H N N 208 LEU HB2 H N N 209 LEU HB3 H N N 210 LEU HG H N N 211 LEU HD11 H N N 212 LEU HD12 H N N 213 LEU HD13 H N N 214 LEU HD21 H N N 215 LEU HD22 H N N 216 LEU HD23 H N N 217 LEU HXT H N N 218 LLP N1 N Y N 219 LLP C2 C Y N 220 LLP "C2'" C N N 221 LLP C3 C Y N 222 LLP O3 O N N 223 LLP C4 C Y N 224 LLP "C4'" C N N 225 LLP C5 C Y N 226 LLP C6 C Y N 227 LLP "C5'" C N N 228 LLP OP4 O N N 229 LLP P P N N 230 LLP OP1 O N N 231 LLP OP2 O N N 232 LLP OP3 O N N 233 LLP N N N N 234 LLP CA C N S 235 LLP CB C N N 236 LLP CG C N N 237 LLP CD C N N 238 LLP CE C N N 239 LLP NZ N N N 240 LLP C C N N 241 LLP O O N N 242 LLP OXT O N N 243 LLP "H2'1" H N N 244 LLP "H2'2" H N N 245 LLP "H2'3" H N N 246 LLP HO3 H N N 247 LLP "H4'1" H N N 248 LLP H6 H N N 249 LLP "H5'1" H N N 250 LLP "H5'2" H N N 251 LLP HOP2 H N N 252 LLP HOP3 H N N 253 LLP H H N N 254 LLP H2 H N N 255 LLP HA H N N 256 LLP HB2 H N N 257 LLP HB3 H N N 258 LLP HG2 H N N 259 LLP HG3 H N N 260 LLP HD2 H N N 261 LLP HD3 H N N 262 LLP HE2 H N N 263 LLP HE3 H N N 264 LLP HXT H N N 265 LYS N N N N 266 LYS CA C N S 267 LYS C C N N 268 LYS O O N N 269 LYS CB C N N 270 LYS CG C N N 271 LYS CD C N N 272 LYS CE C N N 273 LYS NZ N N N 274 LYS OXT O N N 275 LYS H H N N 276 LYS H2 H N N 277 LYS HA H N N 278 LYS HB2 H N N 279 LYS HB3 H N N 280 LYS HG2 H N N 281 LYS HG3 H N N 282 LYS HD2 H N N 283 LYS HD3 H N N 284 LYS HE2 H N N 285 LYS HE3 H N N 286 LYS HZ1 H N N 287 LYS HZ2 H N N 288 LYS HZ3 H N N 289 LYS HXT H N N 290 MET N N N N 291 MET CA C N S 292 MET C C N N 293 MET O O N N 294 MET CB C N N 295 MET CG C N N 296 MET SD S N N 297 MET CE C N N 298 MET OXT O N N 299 MET H H N N 300 MET H2 H N N 301 MET HA H N N 302 MET HB2 H N N 303 MET HB3 H N N 304 MET HG2 H N N 305 MET HG3 H N N 306 MET HE1 H N N 307 MET HE2 H N N 308 MET HE3 H N N 309 MET HXT H N N 310 PEG C1 C N N 311 PEG O1 O N N 312 PEG C2 C N N 313 PEG O2 O N N 314 PEG C3 C N N 315 PEG C4 C N N 316 PEG O4 O N N 317 PEG H11 H N N 318 PEG H12 H N N 319 PEG HO1 H N N 320 PEG H21 H N N 321 PEG H22 H N N 322 PEG H31 H N N 323 PEG H32 H N N 324 PEG H41 H N N 325 PEG H42 H N N 326 PEG HO4 H N N 327 PHE N N N N 328 PHE CA C N S 329 PHE C C N N 330 PHE O O N N 331 PHE CB C N N 332 PHE CG C Y N 333 PHE CD1 C Y N 334 PHE CD2 C Y N 335 PHE CE1 C Y N 336 PHE CE2 C Y N 337 PHE CZ C Y N 338 PHE OXT O N N 339 PHE H H N N 340 PHE H2 H N N 341 PHE HA H N N 342 PHE HB2 H N N 343 PHE HB3 H N N 344 PHE HD1 H N N 345 PHE HD2 H N N 346 PHE HE1 H N N 347 PHE HE2 H N N 348 PHE HZ H N N 349 PHE HXT H N N 350 PRO N N N N 351 PRO CA C N S 352 PRO C C N N 353 PRO O O N N 354 PRO CB C N N 355 PRO CG C N N 356 PRO CD C N N 357 PRO OXT O N N 358 PRO H H N N 359 PRO HA H N N 360 PRO HB2 H N N 361 PRO HB3 H N N 362 PRO HG2 H N N 363 PRO HG3 H N N 364 PRO HD2 H N N 365 PRO HD3 H N N 366 PRO HXT H N N 367 SER N N N N 368 SER CA C N S 369 SER C C N N 370 SER O O N N 371 SER CB C N N 372 SER OG O N N 373 SER OXT O N N 374 SER H H N N 375 SER H2 H N N 376 SER HA H N N 377 SER HB2 H N N 378 SER HB3 H N N 379 SER HG H N N 380 SER HXT H N N 381 THR N N N N 382 THR CA C N S 383 THR C C N N 384 THR O O N N 385 THR CB C N R 386 THR OG1 O N N 387 THR CG2 C N N 388 THR OXT O N N 389 THR H H N N 390 THR H2 H N N 391 THR HA H N N 392 THR HB H N N 393 THR HG1 H N N 394 THR HG21 H N N 395 THR HG22 H N N 396 THR HG23 H N N 397 THR HXT H N N 398 TYR N N N N 399 TYR CA C N S 400 TYR C C N N 401 TYR O O N N 402 TYR CB C N N 403 TYR CG C Y N 404 TYR CD1 C Y N 405 TYR CD2 C Y N 406 TYR CE1 C Y N 407 TYR CE2 C Y N 408 TYR CZ C Y N 409 TYR OH O N N 410 TYR OXT O N N 411 TYR H H N N 412 TYR H2 H N N 413 TYR HA H N N 414 TYR HB2 H N N 415 TYR HB3 H N N 416 TYR HD1 H N N 417 TYR HD2 H N N 418 TYR HE1 H N N 419 TYR HE2 H N N 420 TYR HH H N N 421 TYR HXT H N N 422 VAL N N N N 423 VAL CA C N S 424 VAL C C N N 425 VAL O O N N 426 VAL CB C N N 427 VAL CG1 C N N 428 VAL CG2 C N N 429 VAL OXT O N N 430 VAL H H N N 431 VAL H2 H N N 432 VAL HA H N N 433 VAL HB H N N 434 VAL HG11 H N N 435 VAL HG12 H N N 436 VAL HG13 H N N 437 VAL HG21 H N N 438 VAL HG22 H N N 439 VAL HG23 H N N 440 VAL HXT H N N 441 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 GOL C1 O1 sing N N 129 GOL C1 C2 sing N N 130 GOL C1 H11 sing N N 131 GOL C1 H12 sing N N 132 GOL O1 HO1 sing N N 133 GOL C2 O2 sing N N 134 GOL C2 C3 sing N N 135 GOL C2 H2 sing N N 136 GOL O2 HO2 sing N N 137 GOL C3 O3 sing N N 138 GOL C3 H31 sing N N 139 GOL C3 H32 sing N N 140 GOL O3 HO3 sing N N 141 HIS N CA sing N N 142 HIS N H sing N N 143 HIS N H2 sing N N 144 HIS CA C sing N N 145 HIS CA CB sing N N 146 HIS CA HA sing N N 147 HIS C O doub N N 148 HIS C OXT sing N N 149 HIS CB CG sing N N 150 HIS CB HB2 sing N N 151 HIS CB HB3 sing N N 152 HIS CG ND1 sing Y N 153 HIS CG CD2 doub Y N 154 HIS ND1 CE1 doub Y N 155 HIS ND1 HD1 sing N N 156 HIS CD2 NE2 sing Y N 157 HIS CD2 HD2 sing N N 158 HIS CE1 NE2 sing Y N 159 HIS CE1 HE1 sing N N 160 HIS NE2 HE2 sing N N 161 HIS OXT HXT sing N N 162 HOH O H1 sing N N 163 HOH O H2 sing N N 164 ILE N CA sing N N 165 ILE N H sing N N 166 ILE N H2 sing N N 167 ILE CA C sing N N 168 ILE CA CB sing N N 169 ILE CA HA sing N N 170 ILE C O doub N N 171 ILE C OXT sing N N 172 ILE CB CG1 sing N N 173 ILE CB CG2 sing N N 174 ILE CB HB sing N N 175 ILE CG1 CD1 sing N N 176 ILE CG1 HG12 sing N N 177 ILE CG1 HG13 sing N N 178 ILE CG2 HG21 sing N N 179 ILE CG2 HG22 sing N N 180 ILE CG2 HG23 sing N N 181 ILE CD1 HD11 sing N N 182 ILE CD1 HD12 sing N N 183 ILE CD1 HD13 sing N N 184 ILE OXT HXT sing N N 185 LEU N CA sing N N 186 LEU N H sing N N 187 LEU N H2 sing N N 188 LEU CA C sing N N 189 LEU CA CB sing N N 190 LEU CA HA sing N N 191 LEU C O doub N N 192 LEU C OXT sing N N 193 LEU CB CG sing N N 194 LEU CB HB2 sing N N 195 LEU CB HB3 sing N N 196 LEU CG CD1 sing N N 197 LEU CG CD2 sing N N 198 LEU CG HG sing N N 199 LEU CD1 HD11 sing N N 200 LEU CD1 HD12 sing N N 201 LEU CD1 HD13 sing N N 202 LEU CD2 HD21 sing N N 203 LEU CD2 HD22 sing N N 204 LEU CD2 HD23 sing N N 205 LEU OXT HXT sing N N 206 LLP N1 C2 doub Y N 207 LLP N1 C6 sing Y N 208 LLP C2 "C2'" sing N N 209 LLP C2 C3 sing Y N 210 LLP C3 O3 sing N N 211 LLP C3 C4 doub Y N 212 LLP C4 "C4'" sing N N 213 LLP C4 C5 sing Y N 214 LLP "C4'" NZ doub N N 215 LLP C5 C6 doub Y N 216 LLP C5 "C5'" sing N N 217 LLP "C5'" OP4 sing N N 218 LLP OP4 P sing N N 219 LLP P OP1 doub N N 220 LLP P OP2 sing N N 221 LLP P OP3 sing N N 222 LLP N CA sing N N 223 LLP CA CB sing N N 224 LLP CA C sing N N 225 LLP CB CG sing N N 226 LLP CG CD sing N N 227 LLP CD CE sing N N 228 LLP CE NZ sing N N 229 LLP C O doub N N 230 LLP C OXT sing N N 231 LLP "C2'" "H2'1" sing N N 232 LLP "C2'" "H2'2" sing N N 233 LLP "C2'" "H2'3" sing N N 234 LLP O3 HO3 sing N N 235 LLP "C4'" "H4'1" sing N N 236 LLP C6 H6 sing N N 237 LLP "C5'" "H5'1" sing N N 238 LLP "C5'" "H5'2" sing N N 239 LLP OP2 HOP2 sing N N 240 LLP OP3 HOP3 sing N N 241 LLP N H sing N N 242 LLP N H2 sing N N 243 LLP CA HA sing N N 244 LLP CB HB2 sing N N 245 LLP CB HB3 sing N N 246 LLP CG HG2 sing N N 247 LLP CG HG3 sing N N 248 LLP CD HD2 sing N N 249 LLP CD HD3 sing N N 250 LLP CE HE2 sing N N 251 LLP CE HE3 sing N N 252 LLP OXT HXT sing N N 253 LYS N CA sing N N 254 LYS N H sing N N 255 LYS N H2 sing N N 256 LYS CA C sing N N 257 LYS CA CB sing N N 258 LYS CA HA sing N N 259 LYS C O doub N N 260 LYS C OXT sing N N 261 LYS CB CG sing N N 262 LYS CB HB2 sing N N 263 LYS CB HB3 sing N N 264 LYS CG CD sing N N 265 LYS CG HG2 sing N N 266 LYS CG HG3 sing N N 267 LYS CD CE sing N N 268 LYS CD HD2 sing N N 269 LYS CD HD3 sing N N 270 LYS CE NZ sing N N 271 LYS CE HE2 sing N N 272 LYS CE HE3 sing N N 273 LYS NZ HZ1 sing N N 274 LYS NZ HZ2 sing N N 275 LYS NZ HZ3 sing N N 276 LYS OXT HXT sing N N 277 MET N CA sing N N 278 MET N H sing N N 279 MET N H2 sing N N 280 MET CA C sing N N 281 MET CA CB sing N N 282 MET CA HA sing N N 283 MET C O doub N N 284 MET C OXT sing N N 285 MET CB CG sing N N 286 MET CB HB2 sing N N 287 MET CB HB3 sing N N 288 MET CG SD sing N N 289 MET CG HG2 sing N N 290 MET CG HG3 sing N N 291 MET SD CE sing N N 292 MET CE HE1 sing N N 293 MET CE HE2 sing N N 294 MET CE HE3 sing N N 295 MET OXT HXT sing N N 296 PEG C1 O1 sing N N 297 PEG C1 C2 sing N N 298 PEG C1 H11 sing N N 299 PEG C1 H12 sing N N 300 PEG O1 HO1 sing N N 301 PEG C2 O2 sing N N 302 PEG C2 H21 sing N N 303 PEG C2 H22 sing N N 304 PEG O2 C3 sing N N 305 PEG C3 C4 sing N N 306 PEG C3 H31 sing N N 307 PEG C3 H32 sing N N 308 PEG C4 O4 sing N N 309 PEG C4 H41 sing N N 310 PEG C4 H42 sing N N 311 PEG O4 HO4 sing N N 312 PHE N CA sing N N 313 PHE N H sing N N 314 PHE N H2 sing N N 315 PHE CA C sing N N 316 PHE CA CB sing N N 317 PHE CA HA sing N N 318 PHE C O doub N N 319 PHE C OXT sing N N 320 PHE CB CG sing N N 321 PHE CB HB2 sing N N 322 PHE CB HB3 sing N N 323 PHE CG CD1 doub Y N 324 PHE CG CD2 sing Y N 325 PHE CD1 CE1 sing Y N 326 PHE CD1 HD1 sing N N 327 PHE CD2 CE2 doub Y N 328 PHE CD2 HD2 sing N N 329 PHE CE1 CZ doub Y N 330 PHE CE1 HE1 sing N N 331 PHE CE2 CZ sing Y N 332 PHE CE2 HE2 sing N N 333 PHE CZ HZ sing N N 334 PHE OXT HXT sing N N 335 PRO N CA sing N N 336 PRO N CD sing N N 337 PRO N H sing N N 338 PRO CA C sing N N 339 PRO CA CB sing N N 340 PRO CA HA sing N N 341 PRO C O doub N N 342 PRO C OXT sing N N 343 PRO CB CG sing N N 344 PRO CB HB2 sing N N 345 PRO CB HB3 sing N N 346 PRO CG CD sing N N 347 PRO CG HG2 sing N N 348 PRO CG HG3 sing N N 349 PRO CD HD2 sing N N 350 PRO CD HD3 sing N N 351 PRO OXT HXT sing N N 352 SER N CA sing N N 353 SER N H sing N N 354 SER N H2 sing N N 355 SER CA C sing N N 356 SER CA CB sing N N 357 SER CA HA sing N N 358 SER C O doub N N 359 SER C OXT sing N N 360 SER CB OG sing N N 361 SER CB HB2 sing N N 362 SER CB HB3 sing N N 363 SER OG HG sing N N 364 SER OXT HXT sing N N 365 THR N CA sing N N 366 THR N H sing N N 367 THR N H2 sing N N 368 THR CA C sing N N 369 THR CA CB sing N N 370 THR CA HA sing N N 371 THR C O doub N N 372 THR C OXT sing N N 373 THR CB OG1 sing N N 374 THR CB CG2 sing N N 375 THR CB HB sing N N 376 THR OG1 HG1 sing N N 377 THR CG2 HG21 sing N N 378 THR CG2 HG22 sing N N 379 THR CG2 HG23 sing N N 380 THR OXT HXT sing N N 381 TYR N CA sing N N 382 TYR N H sing N N 383 TYR N H2 sing N N 384 TYR CA C sing N N 385 TYR CA CB sing N N 386 TYR CA HA sing N N 387 TYR C O doub N N 388 TYR C OXT sing N N 389 TYR CB CG sing N N 390 TYR CB HB2 sing N N 391 TYR CB HB3 sing N N 392 TYR CG CD1 doub Y N 393 TYR CG CD2 sing Y N 394 TYR CD1 CE1 sing Y N 395 TYR CD1 HD1 sing N N 396 TYR CD2 CE2 doub Y N 397 TYR CD2 HD2 sing N N 398 TYR CE1 CZ doub Y N 399 TYR CE1 HE1 sing N N 400 TYR CE2 CZ sing Y N 401 TYR CE2 HE2 sing N N 402 TYR CZ OH sing N N 403 TYR OH HH sing N N 404 TYR OXT HXT sing N N 405 VAL N CA sing N N 406 VAL N H sing N N 407 VAL N H2 sing N N 408 VAL CA C sing N N 409 VAL CA CB sing N N 410 VAL CA HA sing N N 411 VAL C O doub N N 412 VAL C OXT sing N N 413 VAL CB CG1 sing N N 414 VAL CB CG2 sing N N 415 VAL CB HB sing N N 416 VAL CG1 HG11 sing N N 417 VAL CG1 HG12 sing N N 418 VAL CG1 HG13 sing N N 419 VAL CG2 HG21 sing N N 420 VAL CG2 HG22 sing N N 421 VAL CG2 HG23 sing N N 422 VAL OXT HXT sing N N 423 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name AlphaFold _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 9J0V _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.026422 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017785 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008430 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S # loop_ #